SWISS-MODEL | Workspace | Model Results

SWISS-MODEL Homology Modelling Report

Model Building Report

This document lists the results for the homology modelling project "S3THD1" submitted to SWISS-MODEL workspace on Oct. 18, 2017, 4:52 p.m..The submitted primary amino acid sequence is given in Table T1.

If you use any results in your research, please cite the relevant publications:

Marco Biasini; Stefan Bienert; Andrew Waterhouse; Konstantin Arnold; Gabriel Studer; Tobias Schmidt; Florian Kiefer; Tiziano Gallo Cassarino; Martino Bertoni; Lorenza Bordoli; Torsten Schwede. (2014). SWISS-MODEL: modelling protein tertiary and quaternary structure using evolutionary information. Nucleic Acids Research (1 July 2014) 42 (W1): W252-W258; doi: 10.1093/nar/gku340.
Arnold, K., Bordoli, L., Kopp, J. and Schwede, T. (2006) The SWISS-MODEL workspace: a web-based environment for protein structure homology modelling. Bioinformatics, 22, 195-201.
Benkert, P., Biasini, M. and Schwede, T. (2011) Toward the estimation of the absolute quality of individual protein structure models. Bioinformatics, 27, 343-350

Results

The SWISS-MODEL template library (SMTL version 2017-10-11, PDB release 2017-10-06) was searched with Blast (Altschul et al., 1997) and HHBlits (Remmert, et al., 2011) for evolutionary related structures matching the target sequence in Table T1. For details on the template search, see Materials and Methods. Overall 840 templates were found (Table T2).

Models

The following model was built (see Materials and Methods "Model Building"):

Model #01	File	Built with	Oligo-State	Ligands	GMQE	QMEAN
	PDB	ProMod3 Version 1.1.0.	MONOMER (matching prediction)	1 x TLA: L(+)-TARTARIC ACID;	0.68	-1.37

QMEAN	-1.37
Cβ	-0.09
All Atom	0.10
Solvation	0.77
Torsion	-1.56

Template	Seq Identity	Oligo-state	Found by	Method	Resolution	Seq Similarity	Range	Coverage	Description
2jfw.1.A	30.71	homo-dimer	HHblits	X-ray	2.00Å	0.36	14 - 287	0.93	GLUTAMATE RACEMASE

Ligand	Added to Model	Description
TLA	✓	L(+)-TARTARIC ACID
TLA	✕ - Binding site not conserved.	L(+)-TARTARIC ACID

Target    MTAIQPLFTELEPMPKALADAPIGIFDSGIGGMSVAAEIAKYLPNERIVYYADTAYVPYGPRSDEEIRELTARAVDWLYR
2jfw.1.A  -------------MIRLTDNRPIGFIDSGVGGLTVVKEALKQLPNENILFVGDTARCPYGPRPAEQVIQYTWEMTDYLVE

Target    QGCKIAVVACNTASAFSLDHLREHYGEHFPIVGL-VPALKPAVLQTRSKVVAVLATPATFRGQLIKDVVEKFAVPAGVKV
2jfw.1.A  QGIKMLVIACNTATAVALEEIKAAL--SIPVIGVILPGTRAAVKKTQNKQVGIIGTIGTVKSQAYEKALKEKV--PELTV

Target    MTLTSLELVPCVEAGQQMSPACLNALREVLQPAVEQGADYLVLGCTHYPFLNEAIHYLFDNQFTLVDSGLAVARQTARIL
2jfw.1.A  TSLACPKFVSVVESNEYHSSVAKKIVAETLAPLTTKKIDTLILGCTHYPLLRPIIQNVMGENVQLIDSGAETVGEVSMLL

Target    IKNELLCDQMRQNVA-RIECYVSGNNADALQPVLQNMIP-QELTWTLHNLS
2jfw.1.A  DYFNLSNSPQ--NGRTLCQFYTTGSAKLFEE-IAEDWLGIGHLNVEHIEL-

Materials and Methods

Template Search

Template search with Blast and HHBlits has been performed against the SWISS-MODEL template library (SMTL, last update: 2017-10-11, last included PDB release: 2017-10-06).

The target sequence was searched with BLAST (Altschul et al., 1997) against the primary amino acid sequence contained in the SMTL. A total of 37 templates were found.

An initial HHblits profile has been built using the procedure outlined in (Remmert, et al., 2011), followed by 1 iteration of HHblits against NR20. The obtained profile has then be searched against all profiles of the SMTL. A total of 804 templates were found.

Template Selection

For each identified template, the template's quality has been predicted from features of the target-template alignment. The templates with the highest quality have then been selected for model building.

Model Building

Models are built based on the target-template alignment using ProMod3. Coordinates which are conserved between the target and the template are copied from the template to the model. Insertions and deletions are remodelled using a fragment library. Side chains are then rebuilt. Finally, the geometry of the resulting model is regularized by using a force field. In case loop modelling with ProMod3 fails, an alternative model is built with PROMOD-II (Guex, et al., 1997).

Model Quality Estimation

The global and per-residue model quality has been assessed using the QMEAN scoring function (Benkert, et al., 2011) . For improved performance, weights of the individual QMEAN terms have been trained specifically for SWISS-MODEL.

Ligand Modelling

Ligands present in the template structure are transferred by homology to the model when the following criteria are met (Gallo -Casserino, to be published): (a) The ligands are annotated as biologically relevant in the template library, (b) the ligand is in contact with the model, (c) the ligand is not clashing with the protein, (d) the residues in contact with the ligand are conserved between the target and the template. If any of these four criteria is not satisfied, a certain ligand will not be included in the model. The model summary includes information on why and which ligand has not been included.

Oligomeric State Conservation

Homo-oligomeric structure of the target protein is predicted based on the analysis of pairwise interfaces of the identified template structures. For each relevant interface between polypeptide chains (interfaces with more than 10 residue-residue interactions), the QscoreOligomer (Mariani et al., 2011) is predicted from features such as similarity to target and frequency of observing this interface in the identified templates (Kiefer, Bertoni, Biasini, to be published). The prediction is performed with a random forest regressor using these features as input parameters to predict the probability of conservation for each interface. The QscoreOligomer of the whole complex is then calculated as the weight-averaged QscoreOligomer of the interfaces. The oligomeric state of the target is predicted to be the same as in the template when QscoreOligomer is predicted to be higher or equal to 0.5.

References

Altschul, S.F., Madden, T.L., Schaffer, A.A., Zhang, J., Zhang, Z., Miller, W. and Lipman, D.J. (1997) Gapped BLAST and PSI-BLAST: a new generation of protein database search programs. Nucleic Acids Res, 25, 3389-3402.
Remmert, M., Biegert, A., Hauser, A. and Soding, J. (2012) HHblits: lightning-fast iterative protein sequence searching by HMM-HMM alignment. Nat Methods, 9, 173-175.
Guex, N. and Peitsch, M.C. (1997) SWISS-MODEL and the Swiss-PdbViewer: an environment for comparative protein modeling. Electrophoresis, 18, 2714-2723.
Sali, A. and Blundell, T.L. (1993) Comparative protein modelling by satisfaction of spatial restraints. J Mol Biol, 234, 779-815.
Benkert, P., Biasini, M. and Schwede, T. (2011) Toward the estimation of the absolute quality of individual protein structure models. Bioinformatics, 27, 343-350.
Mariani, V., Kiefer, F., Schmidt, T., Haas, J. and Schwede, T. (2011) Assessment of template based protein structure predictions in CASP9. Proteins, 79 Suppl 10, 37-58.

Table T1:

Primary amino acid sequence for which templates were searched and models were built.

MTAIQPLFTELEPMPKALADAPIGIFDSGIGGMSVAAEIAKYLPNERIVYYADTAYVPYGPRSDEEIRELTARAVDWLYRQGCKIAVVACNTASAFSLDH
LREHYGEHFPIVGLVPALKPAVLQTRSKVVAVLATPATFRGQLIKDVVEKFAVPAGVKVMTLTSLELVPCVEAGQQMSPACLNALREVLQPAVEQGADYL
VLGCTHYPFLNEAIHYLFDNQFTLVDSGLAVARQTARILIKNELLCDQMRQNVARIECYVSGNNADALQPVLQNMIPQELTWTLHNLS

Table T2:

Template	Seq Identity	Oligo-state	Found by	Method	Resolution	Seq Similarity	Coverage	Description
2jfw.1.A	30.71	homo-dimer	HHblits	X-ray	2.00Å	0.36	0.93	GLUTAMATE RACEMASE
2jfp.1.A	30.71	homo-dimer	HHblits	X-ray	1.98Å	0.36	0.93	GLUTAMATE RACEMASE
2jfo.1.B	30.71	homo-dimer	HHblits	X-ray	2.50Å	0.36	0.93	GLUTAMATE RACEMASE
2vvt.1.A	31.30	homo-dimer	HHblits	X-ray	1.65Å	0.36	0.91	GLUTAMATE RACEMASE
2vvt.1.B	31.30	homo-dimer	HHblits	X-ray	1.65Å	0.36	0.91	GLUTAMATE RACEMASE
2jfn.1.A	39.37	monomer	BLAST	X-ray	1.90Å	0.38	0.88	GLUTAMATE RACEMASE
2jfn.1.A	33.97	monomer	HHblits	X-ray	1.90Å	0.36	0.91	GLUTAMATE RACEMASE
1zuw.1.A	31.03	homo-dimer	HHblits	X-ray	1.75Å	0.36	0.91	glutamate racemase 1
1zuw.1.B	31.03	homo-dimer	HHblits	X-ray	1.75Å	0.36	0.91	glutamate racemase 1
2gzm.1.A	31.80	homo-dimer	HHblits	X-ray	1.99Å	0.36	0.91	Glutamate racemase
2gzm.1.B	31.80	homo-dimer	HHblits	X-ray	1.99Å	0.36	0.91	Glutamate racemase
2gzm.2.B	31.80	homo-dimer	HHblits	X-ray	1.99Å	0.36	0.91	Glutamate racemase
2oho.1.A	29.89	homo-dimer	HHblits	X-ray	2.25Å	0.36	0.91	Glutamate Racemase
2oho.1.B	29.89	homo-dimer	HHblits	X-ray	2.25Å	0.36	0.91	Glutamate Racemase
3hfr.1.A	29.77	homo-dimer	HHblits	X-ray	2.30Å	0.35	0.91	Glutamate racemase
3hfr.1.B	29.77	homo-dimer	HHblits	X-ray	2.30Å	0.35	0.91	Glutamate racemase
2ohv.1.A	30.00	homo-dimer	HHblits	X-ray	2.50Å	0.36	0.90	Glutamate Racemase
2ohg.1.A	30.00	homo-dimer	HHblits	X-ray	2.50Å	0.36	0.90	Glutamate racemase
2dwu.1.A	28.35	homo-dimer	HHblits	X-ray	1.60Å	0.35	0.91	Glutamate racemase
2dwu.2.A	28.35	homo-dimer	HHblits	X-ray	1.60Å	0.35	0.91	Glutamate racemase
5ijw.1.A	34.48	homo-dimer	HHblits	X-ray	1.76Å	0.35	0.91	Glutamate racemase
5ijw.1.B	34.48	homo-dimer	HHblits	X-ray	1.76Å	0.35	0.91	Glutamate racemase
2jfq.1.A	28.68	homo-dimer	HHblits	X-ray	2.15Å	0.36	0.90	GLUTAMATE RACEMASE
2jfq.1.B	28.68	homo-dimer	HHblits	X-ray	2.15Å	0.36	0.90	GLUTAMATE RACEMASE
5hj7.1.A	33.59	homo-dimer	HHblits	X-ray	2.30Å	0.35	0.89	Glutamate racemase
3out.1.A	29.20	homo-hexamer	HHblits	X-ray	1.65Å	0.35	0.87	Glutamate racemase
1b73.1.A	30.20	homo-dimer	HHblits	X-ray	2.30Å	0.35	0.85	GLUTAMATE RACEMASE
5w1q.1.A	26.53	homo-dimer	HHblits	X-ray	1.95Å	0.34	0.85	Glutamate racemase
3uho.1.A	27.69	monomer	HHblits	X-ray	2.20Å	0.35	0.84	Glutamate racemase
3uhf.2.A	27.69	monomer	HHblits	X-ray	1.83Å	0.35	0.84	Glutamate racemase
3uhp.1.A	27.69	monomer	HHblits	X-ray	2.79Å	0.35	0.84	Glutamate racemase
2jfy.1.B	25.82	homo-dimer	HHblits	X-ray	1.90Å	0.34	0.85	GLUTAMATE RACEMASE
2jfz.1.A	25.82	homo-dimer	HHblits	X-ray	1.86Å	0.34	0.85	GLUTAMATE RACEMASE
2jfx.1.A	25.82	homo-dimer	HHblits	X-ray	2.30Å	0.34	0.85	GLUTAMATE RACEMASE
2jfx.1.B	25.82	homo-dimer	HHblits	X-ray	2.30Å	0.34	0.85	GLUTAMATE RACEMASE
2jfy.1.A	25.82	homo-dimer	HHblits	X-ray	1.90Å	0.34	0.85	GLUTAMATE RACEMASE
4b1f.1.B	25.82	homo-dimer	HHblits	X-ray	2.05Å	0.34	0.85	GLUTAMATE RACEMASE
2w4i.1.A	25.82	homo-tetramer	HHblits	X-ray	1.87Å	0.34	0.85	GLUTAMATE RACEMASE
2gzm.1.A	35.84	homo-dimer	BLAST	X-ray	1.99Å	0.38	0.78	Glutamate racemase
2gzm.1.B	35.84	homo-dimer	BLAST	X-ray	1.99Å	0.38	0.78	Glutamate racemase
2gzm.2.B	35.84	homo-dimer	BLAST	X-ray	1.99Å	0.38	0.78	Glutamate racemase
1zuw.1.A	36.16	homo-dimer	BLAST	X-ray	1.75Å	0.39	0.78	glutamate racemase 1
1zuw.1.B	36.16	homo-dimer	BLAST	X-ray	1.75Å	0.39	0.78	glutamate racemase 1
5w1q.1.A	32.89	homo-dimer	BLAST	X-ray	1.95Å	0.38	0.78	Glutamate racemase
2jfw.1.A	36.99	homo-dimer	BLAST	X-ray	2.00Å	0.39	0.76	GLUTAMATE RACEMASE
5ijw.1.A	39.82	homo-dimer	BLAST	X-ray	1.76Å	0.38	0.77	Glutamate racemase
5ijw.1.B	39.82	homo-dimer	BLAST	X-ray	1.76Å	0.38	0.77	Glutamate racemase
2dwu.1.A	32.29	homo-dimer	BLAST	X-ray	1.60Å	0.37	0.77	Glutamate racemase
2dwu.2.A	32.29	homo-dimer	BLAST	X-ray	1.60Å	0.37	0.77	Glutamate racemase
5hj7.1.A	38.18	homo-dimer	BLAST	X-ray	2.30Å	0.38	0.76	Glutamate racemase
2jfp.1.A	37.09	homo-dimer	BLAST	X-ray	1.98Å	0.39	0.74	GLUTAMATE RACEMASE
2jfo.1.B	37.09	homo-dimer	BLAST	X-ray	2.50Å	0.39	0.74	GLUTAMATE RACEMASE
2vvt.1.A	37.09	homo-dimer	BLAST	X-ray	1.65Å	0.39	0.74	GLUTAMATE RACEMASE
2vvt.1.B	37.09	homo-dimer	BLAST	X-ray	1.65Å	0.39	0.74	GLUTAMATE RACEMASE
2jfq.1.A	33.80	homo-dimer	BLAST	X-ray	2.15Å	0.38	0.75	GLUTAMATE RACEMASE
2jfq.1.B	33.80	homo-dimer	BLAST	X-ray	2.15Å	0.38	0.75	GLUTAMATE RACEMASE
3out.1.A	34.58	homo-hexamer	BLAST	X-ray	1.65Å	0.38	0.74	Glutamate racemase
2ohv.1.A	36.15	homo-dimer	BLAST	X-ray	2.50Å	0.38	0.74	Glutamate Racemase
2ohg.1.A	36.15	homo-dimer	BLAST	X-ray	2.50Å	0.38	0.74	Glutamate racemase
2oho.1.A	36.15	homo-dimer	BLAST	X-ray	2.25Å	0.38	0.74	Glutamate Racemase
2oho.1.B	36.15	homo-dimer	BLAST	X-ray	2.25Å	0.38	0.74	Glutamate Racemase
3hfr.1.A	37.26	homo-dimer	BLAST	X-ray	2.30Å	0.39	0.74	Glutamate racemase
3hfr.1.B	37.26	homo-dimer	BLAST	X-ray	2.30Å	0.39	0.74	Glutamate racemase
3uho.1.A	33.81	monomer	BLAST	X-ray	2.20Å	0.38	0.73	Glutamate racemase
3uhf.2.A	33.81	monomer	BLAST	X-ray	1.83Å	0.38	0.73	Glutamate racemase
3uhp.1.A	33.81	monomer	BLAST	X-ray	2.79Å	0.38	0.73	Glutamate racemase
1b73.1.A	36.82	homo-dimer	BLAST	X-ray	2.30Å	0.38	0.70	GLUTAMATE RACEMASE
2jfy.1.B	31.09	homo-dimer	BLAST	X-ray	1.90Å	0.37	0.67	GLUTAMATE RACEMASE
2jfz.1.A	31.09	homo-dimer	BLAST	X-ray	1.86Å	0.37	0.67	GLUTAMATE RACEMASE
2jfx.1.A	31.09	homo-dimer	BLAST	X-ray	2.30Å	0.37	0.67	GLUTAMATE RACEMASE
2jfx.1.B	31.09	homo-dimer	BLAST	X-ray	2.30Å	0.37	0.67	GLUTAMATE RACEMASE
2jfy.1.A	31.09	homo-dimer	BLAST	X-ray	1.90Å	0.37	0.67	GLUTAMATE RACEMASE
4b1f.1.B	31.09	homo-dimer	BLAST	X-ray	2.05Å	0.37	0.67	GLUTAMATE RACEMASE
2w4i.1.A	31.09	homo-tetramer	BLAST	X-ray	1.87Å	0.37	0.67	GLUTAMATE RACEMASE
4fq7.1.A	18.48	homo-tetramer	HHblits	X-ray	3.00Å	0.29	0.73	Maleate cis-trans isomerase
4fq5.1.A	17.45	homo-tetramer	HHblits	X-ray	2.10Å	0.28	0.74	Maleate cis-trans isomerase
4fq5.1.B	17.45	homo-tetramer	HHblits	X-ray	2.10Å	0.28	0.74	Maleate cis-trans isomerase
3s81.1.A	20.10	homo-dimer	HHblits	X-ray	1.80Å	0.31	0.71	Putative aspartate racemase
1jfl.1.A	19.61	homo-dimer	HHblits	X-ray	1.90Å	0.30	0.71	ASPARTATE RACEMASE
2eq5.1.A	17.48	homo-dimer	HHblits	X-ray	2.20Å	0.29	0.72	228aa long hypothetical hydantoin racemase
2eq5.2.B	17.48	homo-dimer	HHblits	X-ray	2.20Å	0.29	0.72	228aa long hypothetical hydantoin racemase
3ojc.1.A	17.96	homo-tetramer	HHblits	X-ray	1.75Å	0.29	0.72	Putative aspartate/glutamate racemase
3ojc.1.B	17.96	homo-tetramer	HHblits	X-ray	1.75Å	0.29	0.72	Putative aspartate/glutamate racemase
3ojc.1.C	17.96	homo-tetramer	HHblits	X-ray	1.75Å	0.29	0.72	Putative aspartate/glutamate racemase
3ojc.1.D	17.96	homo-tetramer	HHblits	X-ray	1.75Å	0.29	0.72	Putative aspartate/glutamate racemase
2zsk.1.A	18.63	homo-dimer	HHblits	X-ray	2.55Å	0.30	0.71	226aa long hypothetical aspartate racemase
5ell.1.A	17.07	homo-dimer	HHblits	X-ray	1.80Å	0.29	0.71	Asp/Glu_racemase family protein
5ell.1.B	17.07	homo-dimer	HHblits	X-ray	1.80Å	0.29	0.71	Asp/Glu_racemase family protein
2dx7.1.A	19.90	homo-dimer	HHblits	X-ray	2.00Å	0.31	0.70	aspartate racemase
2dx7.1.B	19.90	homo-dimer	HHblits	X-ray	2.00Å	0.31	0.70	aspartate racemase
5hqt.1.A	16.59	homo-dimer	HHblits	X-ray	1.60Å	0.29	0.71	aspartate/glutamate racemase
5elm.1.A	16.10	homo-dimer	HHblits	X-ray	2.00Å	0.28	0.71	Asp/Glu_racemase family protein
5elm.1.B	16.10	homo-dimer	HHblits	X-ray	2.00Å	0.28	0.71	Asp/Glu_racemase family protein
5elm.2.A	16.10	homo-dimer	HHblits	X-ray	2.00Å	0.28	0.71	Asp/Glu_racemase family protein
5elm.2.B	16.10	homo-dimer	HHblits	X-ray	2.00Å	0.28	0.71	Asp/Glu_racemase family protein
2xed.1.A	16.43	monomer	HHblits	X-ray	1.95Å	0.28	0.72	PUTATIVE MALEATE ISOMERASE
2xec.1.A	16.99	homo-dimer	HHblits	X-ray	2.20Å	0.28	0.72	PUTATIVE MALEATE ISOMERASE
5lfd.1.A	19.40	homo-hexamer	HHblits	X-ray	2.15Å	0.29	0.70	Allantoin racemase
3qvj.1.A	16.42	homo-hexamer	HHblits	X-ray	2.10Å	0.29	0.70	Putative hydantoin racemase
4ix1.1.A	12.08	homo-dimer	HHblits	X-ray	2.80Å	0.26	0.72	hypothetical protein
4ix1.1.B	12.08	homo-dimer	HHblits	X-ray	2.80Å	0.26	0.72	hypothetical protein
5b19.1.A	18.69	homo-dimer	HHblits	X-ray	1.85Å	0.30	0.69	Aspartate racemase
5b19.1.B	18.69	homo-dimer	HHblits	X-ray	1.85Å	0.30	0.69	Aspartate racemase
4rs3.1.A	17.41	monomer	HHblits	X-ray	1.40Å	0.28	0.70	ABC transporter, carbohydrate uptake transporter-2 (CUT2) family, periplasmic sugar-binding protein
3qvl.1.A	15.92	homo-hexamer	HHblits	X-ray	1.82Å	0.28	0.70	Putative hydantoin racemase
4wt7.1.A	15.69	monomer	HHblits	X-ray	2.00Å	0.27	0.71	ABC transporter substrate binding protein (Ribose)
3bil.1.A	16.08	homo-dimer	HHblits	X-ray	2.50Å	0.28	0.69	Probable LacI-family transcriptional regulator
4wut.1.A	11.82	monomer	HHblits	X-ray	1.50Å	0.27	0.70	ABC transporter substrate binding protein (Ribose)
2dgd.1.A	10.40	homo-octamer	HHblits	X-ray	2.90Å	0.27	0.70	223aa long hypothetical arylmalonate decarboxylase
5kws.1.A	12.81	monomer	HHblits	X-ray	1.32Å	0.26	0.70	Galactose-binding protein
2fep.1.A	15.50	hetero-oligomer	HHblits	X-ray	2.45Å	0.27	0.69	Catabolite control protein A
3l49.1.A	13.30	monomer	HHblits	X-ray	2.30Å	0.26	0.70	ABC sugar (Ribose) transporter, periplasmic substrate-binding subunit
2vk2.1.A	14.93	monomer	HHblits	X-ray	1.20Å	0.27	0.70	ABC TRANSPORTER PERIPLASMIC-BINDING PROTEIN YTFQ
4irx.1.A	12.94	monomer	HHblits	X-ray	1.45Å	0.27	0.70	Sugar ABC transporter, periplasmic sugar-binding protein
2gx6.1.A	15.42	monomer	HHblits	X-ray	1.97Å	0.27	0.70	D-ribose-binding periplasmic protein
3clk.1.A	11.27	homo-dimer	HHblits	X-ray	2.08Å	0.26	0.71	Transcription regulator
3clk.1.B	11.27	homo-dimer	HHblits	X-ray	2.08Å	0.26	0.71	Transcription regulator
1bdh.1.B	13.50	homo-dimer	HHblits	X-ray	2.70Å	0.27	0.69	PROTEIN (PURINE REPRESSOR)
2pug.1.B	13.00	homo-dimer	HHblits	X-ray	2.70Å	0.27	0.69	PROTEIN (PURINE REPRESSOR)
4yv7.1.A	14.36	monomer	HHblits	X-ray	2.30Å	0.26	0.70	Periplasmic binding protein/LacI transcriptional regulator
1jh9.1.B	13.00	homo-dimer	HHblits	X-ray	2.55Å	0.27	0.69	PURINE NUCLEOTIDE SYNTHESIS REPRESSOR
1jyf.1.A	14.85	homo-dimer	HHblits	X-ray	3.00Å	0.26	0.70	Lactose Operon Repressor
4ry9.1.A	10.84	monomer	HHblits	X-ray	1.40Å	0.25	0.70	Periplasmic binding protein/LacI transcriptional regulator
3ixm.1.A	15.23	monomer	HHblits	X-ray	1.90Å	0.27	0.68	Arylmalonate decarboxylase
1lbi.1.A	14.50	homo-tetramer	HHblits	X-ray	2.70Å	0.26	0.69	LAC REPRESSOR
1lbi.1.B	14.50	homo-tetramer	HHblits	X-ray	2.70Å	0.26	0.69	LAC REPRESSOR
1lbi.1.C	14.50	homo-tetramer	HHblits	X-ray	2.70Å	0.26	0.69	LAC REPRESSOR
1lbi.1.D	14.50	homo-tetramer	HHblits	X-ray	2.70Å	0.26	0.69	LAC REPRESSOR
1lbh.1.A	14.50	homo-tetramer	HHblits	X-ray	3.20Å	0.26	0.69	INTACT LACTOSE OPERON REPRESSOR WITH GRATUITOUS INDUCER IPTG
1lbh.1.B	14.50	homo-tetramer	HHblits	X-ray	3.20Å	0.26	0.69	INTACT LACTOSE OPERON REPRESSOR WITH GRATUITOUS INDUCER IPTG
1lbh.1.C	14.50	homo-tetramer	HHblits	X-ray	3.20Å	0.26	0.69	INTACT LACTOSE OPERON REPRESSOR WITH GRATUITOUS INDUCER IPTG
1lbh.1.D	14.50	homo-tetramer	HHblits	X-ray	3.20Å	0.26	0.69	INTACT LACTOSE OPERON REPRESSOR WITH GRATUITOUS INDUCER IPTG
3dtv.3.A	14.72	monomer	HHblits	X-ray	2.10Å	0.27	0.68	Arylmalonate decarboxylase
3dtv.2.A	14.72	monomer	HHblits	X-ray	2.10Å	0.27	0.68	Arylmalonate decarboxylase
3dtv.1.A	14.72	monomer	HHblits	X-ray	2.10Å	0.27	0.68	Arylmalonate decarboxylase
3dtv.4.A	14.72	monomer	HHblits	X-ray	2.10Å	0.27	0.68	Arylmalonate decarboxylase
3eis.1.A	14.72	monomer	HHblits	X-ray	2.10Å	0.27	0.68	Arylmalonate decarboxylase
3eis.2.A	14.72	monomer	HHblits	X-ray	2.10Å	0.27	0.68	Arylmalonate decarboxylase
2vlb.1.A	14.72	monomer	HHblits	X-ray	1.92Å	0.27	0.68	ARYLMALONATE DECARBOXYLASE
2vlb.2.A	14.72	monomer	HHblits	X-ray	1.92Å	0.27	0.68	ARYLMALONATE DECARBOXYLASE
2vlb.3.A	14.72	monomer	HHblits	X-ray	1.92Å	0.27	0.68	ARYLMALONATE DECARBOXYLASE
2vlb.4.A	14.72	monomer	HHblits	X-ray	1.92Å	0.27	0.68	ARYLMALONATE DECARBOXYLASE
3dg9.1.A	14.72	monomer	HHblits	X-ray	1.50Å	0.27	0.68	Arylmalonate decarboxylase
2qu7.1.A	13.27	homo-dimer	HHblits	X-ray	2.30Å	0.27	0.68	Putative transcriptional regulator
3ctp.1.A	13.78	homo-dimer	HHblits	X-ray	1.41Å	0.27	0.68	Periplasmic binding protein/LacI transcriptional regulator
3hzr.1.A	11.68	homo-dimer	HHblits	X-ray	3.00Å	0.26	0.68	Tryptophanyl-tRNA synthetase
3ixl.1.A	14.29	monomer	HHblits	X-ray	1.45Å	0.26	0.68	Arylmalonate decarboxylase
3jvd.1.A	12.44	homo-dimer	HHblits	X-ray	2.30Å	0.26	0.67	Transcriptional regulators
3jvd.1.B	12.44	homo-dimer	HHblits	X-ray	2.30Å	0.26	0.67	Transcriptional regulators
1umy.1.A	16.57	homo-tetramer	HHblits	X-ray	2.50Å	0.27	0.59	BETAINE--HOMOCYSTEINE S-METHYLTRANSFERASE
4m3p.1.A	16.57	homo-tetramer	HHblits	X-ray	1.89Å	0.26	0.59	Betaine--homocysteine S-methyltransferase 1
4m3p.1.D	16.57	homo-tetramer	HHblits	X-ray	1.89Å	0.26	0.59	Betaine--homocysteine S-methyltransferase 1
3qk7.1.A	15.72	homo-dimer	HHblits	X-ray	2.70Å	0.27	0.55	Transcriptional regulators
3qk7.2.A	15.72	homo-dimer	HHblits	X-ray	2.70Å	0.27	0.55	Transcriptional regulators
3qk7.2.B	15.72	homo-dimer	HHblits	X-ray	2.70Å	0.27	0.55	Transcriptional regulators
4wzz.1.A	13.13	monomer	HHblits	X-ray	1.70Å	0.27	0.56	Putative sugar ABC transporter, substrate-binding protein
2fn9.1.A	13.75	monomer	HHblits	X-ray	1.40Å	0.27	0.56	ribose ABC transporter, periplasmic ribose-binding protein
2fn9.2.A	13.75	monomer	HHblits	X-ray	1.40Å	0.27	0.56	ribose ABC transporter, periplasmic ribose-binding protein
1dbp.1.A	15.72	monomer	HHblits	X-ray	2.20Å	0.27	0.55	D-RIBOSE-BINDING PROTEIN
3rot.1.A	13.04	homo-dimer	HHblits	X-ray	1.91Å	0.26	0.56	ABC sugar transporter, periplasmic sugar binding protein
4ry0.1.A	13.21	monomer	HHblits	X-ray	1.40Å	0.27	0.55	Probable ribose ABC transporter, substrate-binding protein
4zjp.1.A	16.35	monomer	HHblits	X-ray	1.63Å	0.27	0.55	Monosaccharide-transporting ATPase
2hj9.1.A	11.88	hetero-oligomer	HHblits	X-ray	2.34Å	0.26	0.56	Autoinducer 2-binding periplasmic protein luxP
2hj9.1.B	11.88	hetero-oligomer	HHblits	X-ray	2.34Å	0.26	0.56	Autoinducer 2-binding periplasmic protein luxP
1gpw.1.A	15.29	hetero-oligomer	HHblits	X-ray	2.40Å	0.27	0.55	HISF PROTEIN
1gpw.3.A	15.29	hetero-oligomer	HHblits	X-ray	2.40Å	0.27	0.55	HISF PROTEIN
1jx6.1.A	11.25	monomer	HHblits	X-ray	1.50Å	0.26	0.56	LUXP PROTEIN
4y9t.1.A	11.25	monomer	HHblits	X-ray	1.80Å	0.26	0.56	ABC transporter, solute binding protein
4pz0.1.A	8.81	monomer	HHblits	X-ray	1.25Å	0.26	0.55	sugar ABC transporter, sugar-binding protein
1jye.1.A	14.47	homo-dimer	HHblits	X-ray	1.70Å	0.25	0.55	Lactose Operon Repressor
4xxh.1.A	16.03	homo-dimer	HHblits	X-ray	2.40Å	0.26	0.54	HTH-type transcriptional regulator TreR
4ccz.1.A	14.89	monomer	HHblits	X-ray	2.70Å	0.27	0.49	METHIONINE SYNTHASE
2zya.1.A	12.50	homo-dimer	HHblits	X-ray	1.60Å	0.26	0.47	6-phosphogluconate dehydrogenase, decarboxylating
2zya.1.B	12.50	homo-dimer	HHblits	X-ray	1.60Å	0.26	0.47	6-phosphogluconate dehydrogenase, decarboxylating
2zyg.1.A	14.07	homo-dimer	HHblits	X-ray	2.10Å	0.27	0.47	6-phosphogluconate dehydrogenase, decarboxylating
3lop.1.A	12.12	monomer	HHblits	X-ray	1.55Å	0.28	0.46	Substrate binding periplasmic protein
4evq.1.A	6.67	monomer	HHblits	X-ray	1.40Å	0.23	0.47	Putative ABC transporter subunit, substrate-binding component
1gr0.1.A	11.81	homo-tetramer	HHblits	X-ray	1.95Å	0.27	0.44	INOSITOL-3-PHOSPHATE SYNTHASE
4fx7.1.A	14.29	monomer	HHblits	X-ray	2.08Å	0.27	0.44	Imidazole glycerol phosphate synthase subunit HisF
3tdn.1.A	15.20	homo-dimer	HHblits	X-ray	1.40Å	0.27	0.43	FLR SYMMETRIC ALPHA-BETA TIM BARREL
1thf.1.A	14.52	homo-dimer	HHblits	X-ray	1.45Å	0.27	0.43	HISF PROTEIN
2a0n.1.A	17.07	monomer	HHblits	X-ray	1.64Å	0.28	0.43	Imidazole glycerol phosphate synthase subunit hisF
4mwa.1.A	11.29	homo-tetramer	HHblits	X-ray	1.85Å	0.27	0.43	4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
4mwa.1.B	11.29	homo-tetramer	HHblits	X-ray	1.85Å	0.27	0.43	4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
4mwa.1.C	11.29	homo-tetramer	HHblits	X-ray	1.85Å	0.27	0.43	4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
4mwa.1.D	11.29	homo-tetramer	HHblits	X-ray	1.85Å	0.27	0.43	4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
4mwa.2.B	11.29	homo-tetramer	HHblits	X-ray	1.85Å	0.27	0.43	4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
4mwa.2.D	11.29	homo-tetramer	HHblits	X-ray	1.85Å	0.27	0.43	4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
5a5w.1.A	15.45	monomer	HHblits	X-ray	1.60Å	0.28	0.43	?
3og3.1.A	14.52	monomer	HHblits	X-ray	2.08Å	0.27	0.43	Imidazole glycerol phosphate synthase subunit hisF
4axk.1.A	16.53	monomer	HHblits	X-ray	2.25Å	0.27	0.42	1-(5-PHOSPHORIBOSYL)-5-((5'-PHOSPHORIBOSYLAMINO) METHYLIDENEAMINO)IMIDAZOLE-4-CARBOXAMIDE ISOMERASE
4axk.2.A	16.53	monomer	HHblits	X-ray	2.25Å	0.27	0.42	1-(5-PHOSPHORIBOSYL)-5-((5'-PHOSPHORIBOSYLAMINO) METHYLIDENEAMINO)IMIDAZOLE-4-CARBOXAMIDE ISOMERASE
4wxe.1.A	15.00	monomer	HHblits	X-ray	1.50Å	0.27	0.42	Transcriptional regulator, LacI family
4wd0.1.A	16.67	homo-hexamer	HHblits	X-ray	1.50Å	0.27	0.42	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase
1j6u.1.A	14.41	monomer	HHblits	X-ray	2.30Å	0.28	0.41	UDP-N-acetylmuramate-alanine ligase MurC
2y85.1.A	17.36	monomer	HHblits	X-ray	2.40Å	0.26	0.42	PHOSPHORIBOSYL ISOMERASE A
3zs4.1.A	17.36	monomer	HHblits	X-ray	1.90Å	0.26	0.42	PHOSPHORIBOSYL ISOMERASE A
1usl.1.A	7.32	homo-dimer	HHblits	X-ray	1.88Å	0.24	0.43	RIBOSE 5-PHOSPHATE ISOMERASE B
3oqo.1.A	15.25	hetero-oligomer	HHblits	X-ray	2.97Å	0.27	0.41	Catabolite control protein A
3oqo.1.C	15.25	hetero-oligomer	HHblits	X-ray	2.97Å	0.27	0.41	Catabolite control protein A
3oqn.1.A	15.25	hetero-oligomer	HHblits	X-ray	3.30Å	0.27	0.41	Catabolite control protein A
3oqn.1.C	15.25	hetero-oligomer	HHblits	X-ray	3.30Å	0.27	0.41	Catabolite control protein A
2y88.1.A	17.36	monomer	HHblits	X-ray	1.33Å	0.25	0.42	PHOSPHORIBOSYL ISOMERASE A
2y89.1.A	17.36	monomer	HHblits	X-ray	2.50Å	0.25	0.42	PHOSPHORIBOSYL ISOMERASE A
1vzw.1.A	15.97	monomer	HHblits	X-ray	1.80Å	0.26	0.41	PHOSPHORIBOSYL ISOMERASE A
2vep.1.A	15.97	monomer	HHblits	X-ray	1.80Å	0.26	0.41	PHOSPHORIBOSYL ISOMERASE A
2x30.1.A	15.97	monomer	HHblits	X-ray	1.95Å	0.26	0.41	PHOSPHORIBOSYL ISOMERASE A
3nnd.1.A	15.97	homo-tetramer	HHblits	X-ray	2.80Å	0.26	0.41	Possible substrate binding protein of ABC transporter system
4u28.1.A	17.80	monomer	HHblits	X-ray	1.33Å	0.26	0.41	Phosphoribosyl isomerase A
2o20.1.A	10.17	homo-dimer	HHblits	X-ray	1.90Å	0.26	0.41	Catabolite control protein A
2o20.1.B	10.17	homo-dimer	HHblits	X-ray	1.90Å	0.26	0.41	Catabolite control protein A
4rk3.1.A	17.24	homo-dimer	HHblits	X-ray	1.80Å	0.27	0.40	Transcriptional regulator, LacI family
2lbp.1.A	11.30	monomer	HHblits	X-ray	2.40Å	0.28	0.40	LEUCINE-BINDING PROTEIN
1z16.1.A	12.17	monomer	HHblits	X-ray	1.72Å	0.28	0.40	Leu/Ile/Val-binding protein
1z15.1.A	12.17	monomer	HHblits	X-ray	1.70Å	0.28	0.40	Leu/Ile/Val-binding protein
4rk5.1.A	16.38	homo-dimer	HHblits	X-ray	1.35Å	0.27	0.40	Transcriptional regulator, LacI family
4evs.1.A	17.54	monomer	HHblits	X-ray	1.45Å	0.28	0.40	PUTATIVE ABC TRANSPORTER SUBUNIT, SUBSTRATE-BINDING COMPONENT
4f06.1.A	15.79	monomer	HHblits	X-ray	1.30Å	0.27	0.40	Extracellular ligand-binding receptor
3i09.1.A	16.67	monomer	HHblits	X-ray	1.80Å	0.27	0.40	Periplasmic branched-chain amino acid-binding protein
3n0w.1.A	12.28	monomer	HHblits	X-ray	1.88Å	0.25	0.40	ABC branched chain amino acid family transporter, periplasmic ligand binding protein
1jfl.1.A	16.04	homo-dimer	HHblits	X-ray	1.90Å	0.29	0.37	ASPARTATE RACEMASE
3s81.1.A	12.38	homo-dimer	HHblits	X-ray	1.80Å	0.29	0.36	Putative aspartate racemase
1iu9.1.A	19.42	monomer	HHblits	X-ray	2.04Å	0.30	0.36	aspartate racemase
2w8z.1.A	12.15	homo-dimer	HHblits	X-ray	2.30Å	0.27	0.37	6-PHOSPHOGLUCONATE DEHYDROGENASE, DECARBOXYLATING
2iyo.1.A	15.89	homo-dimer	HHblits	X-ray	2.40Å	0.27	0.37	6-PHOSPHOGLUCONATE DEHYDROGENASE, DECARBOXYLATING
2iz1.1.B	14.95	homo-dimer	HHblits	X-ray	2.30Å	0.26	0.37	6-PHOSPHOGLUCONATE DEHYDROGENASE, DECARBOXYLATING
2iz1.1.A	14.95	homo-dimer	HHblits	X-ray	2.30Å	0.26	0.37	6-PHOSPHOGLUCONATE DEHYDROGENASE, DECARBOXYLATING
2dx7.1.A	15.53	homo-dimer	HHblits	X-ray	2.00Å	0.29	0.36	aspartate racemase
2dx7.1.B	15.53	homo-dimer	HHblits	X-ray	2.00Å	0.29	0.36	aspartate racemase
5b19.1.A	12.50	homo-dimer	HHblits	X-ray	1.85Å	0.28	0.36	Aspartate racemase
5b19.1.B	12.50	homo-dimer	HHblits	X-ray	1.85Å	0.28	0.36	Aspartate racemase
3ojc.1.A	12.26	homo-tetramer	HHblits	X-ray	1.75Å	0.26	0.37	Putative aspartate/glutamate racemase
3ojc.1.B	12.26	homo-tetramer	HHblits	X-ray	1.75Å	0.26	0.37	Putative aspartate/glutamate racemase
3ojc.1.C	12.26	homo-tetramer	HHblits	X-ray	1.75Å	0.26	0.37	Putative aspartate/glutamate racemase
3ojc.1.D	12.26	homo-tetramer	HHblits	X-ray	1.75Å	0.26	0.37	Putative aspartate/glutamate racemase
2eq5.1.A	11.65	homo-dimer	HHblits	X-ray	2.20Å	0.28	0.36	228aa long hypothetical hydantoin racemase
2eq5.2.B	11.65	homo-dimer	HHblits	X-ray	2.20Å	0.28	0.36	228aa long hypothetical hydantoin racemase
3qvj.1.A	18.81	homo-hexamer	HHblits	X-ray	2.10Å	0.30	0.35	Putative hydantoin racemase
5elm.1.A	14.29	homo-dimer	HHblits	X-ray	2.00Å	0.26	0.36	Asp/Glu_racemase family protein
5elm.1.B	14.29	homo-dimer	HHblits	X-ray	2.00Å	0.26	0.36	Asp/Glu_racemase family protein
5elm.2.A	14.29	homo-dimer	HHblits	X-ray	2.00Å	0.26	0.36	Asp/Glu_racemase family protein
5elm.2.B	14.29	homo-dimer	HHblits	X-ray	2.00Å	0.26	0.36	Asp/Glu_racemase family protein
2jfw.1.A	15.00	homo-dimer	HHblits	X-ray	2.00Å	0.30	0.35	GLUTAMATE RACEMASE
2jfq.1.A	13.73	homo-dimer	HHblits	X-ray	2.15Å	0.28	0.35	GLUTAMATE RACEMASE
2jfq.1.B	13.73	homo-dimer	HHblits	X-ray	2.15Å	0.28	0.35	GLUTAMATE RACEMASE
5hqt.1.A	16.35	homo-dimer	HHblits	X-ray	1.60Å	0.27	0.36	aspartate/glutamate racemase
3qvl.1.A	17.82	homo-hexamer	HHblits	X-ray	1.82Å	0.29	0.35	Putative hydantoin racemase
5ell.1.A	17.48	homo-dimer	HHblits	X-ray	1.80Å	0.27	0.36	Asp/Glu_racemase family protein
5ell.1.B	17.48	homo-dimer	HHblits	X-ray	1.80Å	0.27	0.36	Asp/Glu_racemase family protein
2vvt.1.A	14.85	homo-dimer	HHblits	X-ray	1.65Å	0.29	0.35	GLUTAMATE RACEMASE
2vvt.1.B	14.85	homo-dimer	HHblits	X-ray	1.65Å	0.29	0.35	GLUTAMATE RACEMASE
2jfp.1.A	13.86	homo-dimer	HHblits	X-ray	1.98Å	0.29	0.35	GLUTAMATE RACEMASE
2jfo.1.B	13.86	homo-dimer	HHblits	X-ray	2.50Å	0.29	0.35	GLUTAMATE RACEMASE
2zsk.1.A	7.55	homo-dimer	HHblits	X-ray	2.55Å	0.24	0.37	226aa long hypothetical aspartate racemase
5hj7.1.A	13.86	homo-dimer	HHblits	X-ray	2.30Å	0.28	0.35	Glutamate racemase
2oho.1.A	10.89	homo-dimer	HHblits	X-ray	2.25Å	0.27	0.35	Glutamate Racemase
2oho.1.B	10.89	homo-dimer	HHblits	X-ray	2.25Å	0.27	0.35	Glutamate Racemase
3hfr.1.A	13.86	homo-dimer	HHblits	X-ray	2.30Å	0.27	0.35	Glutamate racemase
3hfr.1.B	13.86	homo-dimer	HHblits	X-ray	2.30Å	0.27	0.35	Glutamate racemase
2dwu.1.A	12.87	homo-dimer	HHblits	X-ray	1.60Å	0.27	0.35	Glutamate racemase
2dwu.2.A	12.87	homo-dimer	HHblits	X-ray	1.60Å	0.27	0.35	Glutamate racemase
5ijw.1.A	10.78	homo-dimer	HHblits	X-ray	1.76Å	0.26	0.35	Glutamate racemase
5ijw.1.B	10.78	homo-dimer	HHblits	X-ray	1.76Å	0.26	0.35	Glutamate racemase
3uho.1.A	14.00	monomer	HHblits	X-ray	2.20Å	0.28	0.35	Glutamate racemase
3uhf.2.A	14.00	monomer	HHblits	X-ray	1.83Å	0.28	0.35	Glutamate racemase
3uhp.1.A	14.00	monomer	HHblits	X-ray	2.79Å	0.28	0.35	Glutamate racemase
2ohv.1.A	11.00	homo-dimer	HHblits	X-ray	2.50Å	0.28	0.35	Glutamate Racemase
2ohg.1.A	11.00	homo-dimer	HHblits	X-ray	2.50Å	0.28	0.35	Glutamate racemase
2gzm.1.A	11.00	homo-dimer	HHblits	X-ray	1.99Å	0.27	0.35	Glutamate racemase
2gzm.1.B	11.00	homo-dimer	HHblits	X-ray	1.99Å	0.27	0.35	Glutamate racemase
2gzm.2.B	11.00	homo-dimer	HHblits	X-ray	1.99Å	0.27	0.35	Glutamate racemase
3out.1.A	10.10	homo-hexamer	HHblits	X-ray	1.65Å	0.27	0.34	Glutamate racemase
5w1q.1.A	14.00	homo-dimer	HHblits	X-ray	1.95Å	0.26	0.35	Glutamate racemase
3lp8.1.A	15.46	monomer	HHblits	X-ray	2.15Å	0.28	0.34	Phosphoribosylamine-glycine ligase
2qxy.1.A	10.10	homo-dimer	HHblits	X-ray	1.95Å	0.27	0.34	Response regulator
2qxy.1.B	10.10	homo-dimer	HHblits	X-ray	1.95Å	0.27	0.34	Response regulator
2dgd.1.A	16.49	homo-octamer	HHblits	X-ray	2.90Å	0.28	0.34	223aa long hypothetical arylmalonate decarboxylase
5mlk.1.A	12.24	homo-dimer	HHblits	X-ray	1.94Å	0.27	0.34	Acetyl-COA carboxylase
5lfd.1.A	12.37	homo-hexamer	HHblits	X-ray	2.15Å	0.27	0.34	Allantoin racemase
2vlb.1.A	11.22	monomer	HHblits	X-ray	1.92Å	0.26	0.34	ARYLMALONATE DECARBOXYLASE
2vlb.2.A	11.22	monomer	HHblits	X-ray	1.92Å	0.26	0.34	ARYLMALONATE DECARBOXYLASE
2vlb.3.A	11.22	monomer	HHblits	X-ray	1.92Å	0.26	0.34	ARYLMALONATE DECARBOXYLASE
2vlb.4.A	11.22	monomer	HHblits	X-ray	1.92Å	0.26	0.34	ARYLMALONATE DECARBOXYLASE
2jfn.1.A	12.63	monomer	HHblits	X-ray	1.90Å	0.27	0.33	GLUTAMATE RACEMASE
2xec.1.A	9.38	homo-dimer	HHblits	X-ray	2.20Å	0.26	0.33	PUTATIVE MALEATE ISOMERASE
2bdq.1.A	18.28	homo-dimer	HHblits	X-ray	2.30Å	0.28	0.32	copper homeostasis protein CutC
3dtv.3.A	8.33	monomer	HHblits	X-ray	2.10Å	0.25	0.33	Arylmalonate decarboxylase
3dtv.2.A	8.33	monomer	HHblits	X-ray	2.10Å	0.25	0.33	Arylmalonate decarboxylase
3dtv.1.A	8.33	monomer	HHblits	X-ray	2.10Å	0.25	0.33	Arylmalonate decarboxylase
3dtv.4.A	8.33	monomer	HHblits	X-ray	2.10Å	0.25	0.33	Arylmalonate decarboxylase
3eis.1.A	8.33	monomer	HHblits	X-ray	2.10Å	0.25	0.33	Arylmalonate decarboxylase
3eis.2.A	8.33	monomer	HHblits	X-ray	2.10Å	0.25	0.33	Arylmalonate decarboxylase
3dg9.1.A	8.33	monomer	HHblits	X-ray	1.50Å	0.25	0.33	Arylmalonate decarboxylase
3ixm.1.A	8.33	monomer	HHblits	X-ray	1.90Å	0.25	0.33	Arylmalonate decarboxylase
4pg4.1.B	18.48	homo-dimer	HHblits	X-ray	2.20Å	0.28	0.32	Homoserine dehydrogenase
4pg4.1.A	18.48	homo-dimer	HHblits	X-ray	2.20Å	0.28	0.32	Homoserine dehydrogenase
4pg7.1.A	18.48	homo-dimer	HHblits	X-ray	2.10Å	0.28	0.32	Homoserine dehydrogenase
4dim.1.A	11.46	monomer	HHblits	X-ray	2.61Å	0.24	0.33	Phosphoribosylglycinamide synthetase
5ocw.1.B	16.30	hetero-oligomer	HHblits	X-ray	4.00Å	0.27	0.32	Tryptophan synthase beta chain
2qk4.1.A	13.98	monomer	HHblits	X-ray	2.45Å	0.26	0.32	Trifunctional purine biosynthetic protein adenosine-3
2gps.1.A	14.13	monomer	HHblits	X-ray	2.80Å	0.26	0.32	Biotin carboxylase
5tcf.1.B	15.38	hetero-oligomer	HHblits	X-ray	2.46Å	0.27	0.32	Tryptophan synthase beta chain
5tcg.1.B	15.38	hetero-oligomer	HHblits	X-ray	2.40Å	0.27	0.32	Tryptophan synthase beta chain
3d4o.1.A	13.33	homo-dimer	HHblits	X-ray	2.10Å	0.27	0.31	Dipicolinate synthase subunit A
3d4o.1.B	13.33	homo-dimer	HHblits	X-ray	2.10Å	0.27	0.31	Dipicolinate synthase subunit A
2gpw.1.A	15.38	monomer	HHblits	X-ray	2.20Å	0.27	0.32	Biotin carboxylase
2gpw.4.A	15.38	monomer	HHblits	X-ray	2.20Å	0.27	0.32	Biotin carboxylase
4mv4.2.A	13.19	monomer	HHblits	X-ray	1.61Å	0.26	0.32	Biotin carboxylase
1v9s.1.B	18.39	homo-tetramer	HHblits	X-ray	2.10Å	0.30	0.30	uracil phosphoribosyltransferase
1v9s.1.A	18.39	homo-tetramer	HHblits	X-ray	2.10Å	0.30	0.30	uracil phosphoribosyltransferase
1v9s.1.D	18.39	homo-tetramer	HHblits	X-ray	2.10Å	0.30	0.30	uracil phosphoribosyltransferase
3wgi.1.B	15.73	homo-dimer	HHblits	X-ray	3.25Å	0.28	0.31	Redox-sensing transcriptional repressor rex
3wg9.2.A	15.73	homo-dimer	HHblits	X-ray	1.97Å	0.28	0.31	Redox-sensing transcriptional repressor rex
3wg9.2.B	15.73	homo-dimer	HHblits	X-ray	1.97Å	0.28	0.31	Redox-sensing transcriptional repressor rex
3wgh.1.B	15.73	homo-dimer	HHblits	X-ray	2.05Å	0.28	0.31	Redox-sensing transcriptional repressor rex
3wgg.1.A	15.73	homo-dimer	HHblits	X-ray	2.10Å	0.28	0.31	Redox-sensing transcriptional repressor rex
3wgg.1.B	15.73	homo-dimer	HHblits	X-ray	2.10Å	0.28	0.31	Redox-sensing transcriptional repressor rex
3gid.1.A	14.29	monomer	HHblits	X-ray	2.30Å	0.26	0.32	Acetyl-CoA carboxylase 2
3gid.2.A	14.29	monomer	HHblits	X-ray	2.30Å	0.26	0.32	Acetyl-CoA carboxylase 2
3glk.1.A	14.29	monomer	HHblits	X-ray	2.10Å	0.26	0.32	Acetyl-CoA carboxylase 2
5kkn.2.A	14.29	monomer	HHblits	X-ray	2.60Å	0.26	0.32	Acetyl-CoA carboxylase 2
5kkn.1.A	14.29	monomer	HHblits	X-ray	2.60Å	0.26	0.32	Acetyl-CoA carboxylase 2
1gso.1.A	10.99	monomer	HHblits	X-ray	1.60Å	0.26	0.32	PROTEIN (GLYCINAMIDE RIBONUCLEOTIDE SYNTHETASE)
1o5o.1.A	18.39	homo-tetramer	HHblits	X-ray	2.30Å	0.29	0.30	Uracil phosphoribosyltransferase
1c30.1.A	11.11	hetero-oligomer	HHblits	X-ray	2.00Å	0.26	0.31	CARBAMOYL PHOSPHATE SYNTHETASE: LARGE SUBUNIT
1bxr.1.A	11.11	hetero-oligomer	HHblits	X-ray	2.10Å	0.26	0.31	CARBAMOYL-PHOSPHATE SYNTHASE
4jn6.1.B	17.05	hetero-oligomer	HHblits	X-ray	1.93Å	0.28	0.31	Acetaldehyde dehydrogenase
2c00.1.A	10.99	monomer	HHblits	X-ray	2.50Å	0.25	0.32	BIOTIN CARBOXYLASE
2c00.2.A	10.99	monomer	HHblits	X-ray	2.50Å	0.25	0.32	BIOTIN CARBOXYLASE
2vqd.1.A	10.99	monomer	HHblits	X-ray	2.41Å	0.25	0.32	BIOTIN CARBOXYLASE
1m6v.1.A	10.00	hetero-oligomer	HHblits	X-ray	2.10Å	0.26	0.31	carbamoyl phosphate synthetase large chain
3mjf.1.A	13.33	monomer	HHblits	X-ray	1.47Å	0.26	0.31	Phosphoribosylamine--glycine ligase
1a9x.1.A	10.00	hetero-oligomer	HHblits	X-ray	1.80Å	0.26	0.31	CARBAMOYL PHOSPHATE SYNTHETASE (LARGE CHAIN)
1ulz.1.A	8.89	homo-dimer	HHblits	X-ray	2.20Å	0.26	0.31	pyruvate carboxylase n-terminal domain
3ouu.1.A	10.00	homo-dimer	HHblits	X-ray	2.25Å	0.25	0.31	Biotin carboxylase
2ip4.1.A	12.50	monomer	HHblits	X-ray	2.80Å	0.27	0.31	Phosphoribosylamine--glycine ligase
2ip4.2.A	12.50	monomer	HHblits	X-ray	2.80Å	0.27	0.31	Phosphoribosylamine--glycine ligase
3lp8.1.A	14.77	monomer	HHblits	X-ray	2.15Å	0.26	0.31	Phosphoribosylamine-glycine ligase
3g8d.1.A	12.36	monomer	HHblits	X-ray	1.90Å	0.25	0.31	Biotin carboxylase
4dim.1.A	11.11	monomer	HHblits	X-ray	2.61Å	0.25	0.31	Phosphoribosylglycinamide synthetase
2yya.1.A	13.95	monomer	HHblits	X-ray	2.40Å	0.28	0.30	Phosphoribosylamine--glycine ligase
1xtu.1.A	10.34	homo-tetramer	HHblits	X-ray	2.80Å	0.27	0.30	Probable uracil phosphoribosyltransferase
3g6w.1.A	10.34	homo-tetramer	HHblits	X-ray	2.90Å	0.27	0.30	Uracil phosphoribosyltransferase
3g6w.1.B	10.34	homo-tetramer	HHblits	X-ray	2.90Å	0.27	0.30	Uracil phosphoribosyltransferase
1xtv.1.B	10.34	homo-tetramer	HHblits	X-ray	2.60Å	0.27	0.30	Probable uracil phosphoribosyltransferase
1xtv.1.C	10.34	homo-tetramer	HHblits	X-ray	2.60Å	0.27	0.30	Probable uracil phosphoribosyltransferase
1xtt.1.A	10.34	homo-tetramer	HHblits	X-ray	1.80Å	0.27	0.30	Probable uracil phosphoribosyltransferase
1xtt.1.B	10.34	homo-tetramer	HHblits	X-ray	1.80Å	0.27	0.30	Probable uracil phosphoribosyltransferase
1vst.1.A	10.34	homo-tetramer	HHblits	X-ray	2.80Å	0.27	0.30	Uracil phosphoribosyltransferase
3u9s.1.A	10.11	hetero-oligomer	HHblits	X-ray	3.50Å	0.25	0.31	Methylcrotonyl-CoA carboxylase, alpha-subunit
3u9t.1.A	10.11	hetero-oligomer	HHblits	X-ray	2.90Å	0.25	0.31	Methylcrotonyl-CoA carboxylase, alpha-subunit
3rv4.1.A	12.36	homo-dimer	HHblits	X-ray	1.98Å	0.25	0.31	Biotin carboxylase
2ys6.1.A	13.48	monomer	HHblits	X-ray	2.21Å	0.25	0.31	Phosphoribosylglycinamide synthetase
1iu9.1.A	19.05	monomer	HHblits	X-ray	2.04Å	0.29	0.29	aspartate racemase
2xcl.1.A	13.64	monomer	HHblits	X-ray	2.10Å	0.26	0.31	PHOSPHORIBOSYLAMINE--GLYCINE LIGASE
2vpq.1.A	8.99	homo-dimer	HHblits	X-ray	2.10Å	0.25	0.31	ACETYL-COA CARBOXYLASE
1dv2.1.A	11.24	monomer	HHblits	X-ray	2.50Å	0.25	0.31	BIOTIN CARBOXYLASE
2ipn.1.A	18.07	monomer	HHblits	X-ray	1.15Å	0.30	0.29	D-galactose-binding periplasmic protein
2ipm.1.A	18.07	monomer	HHblits	X-ray	1.12Å	0.30	0.29	D-galactose-binding periplasmic protein
1b73.1.A	12.94	homo-dimer	HHblits	X-ray	2.30Å	0.28	0.30	GLUTAMATE RACEMASE
2ipl.1.A	18.07	monomer	HHblits	X-ray	1.20Å	0.30	0.29	D-galactose-binding periplasmic protein
2hph.1.A	16.87	monomer	HHblits	X-ray	1.33Å	0.29	0.29	D-galactose-binding periplasmic protein
1zuw.1.A	14.12	homo-dimer	HHblits	X-ray	1.75Å	0.27	0.30	glutamate racemase 1
1zuw.1.B	14.12	homo-dimer	HHblits	X-ray	1.75Å	0.27	0.30	glutamate racemase 1
2w6m.1.A	11.36	monomer	HHblits	X-ray	2.00Å	0.25	0.31	BIOTIN CARBOXYLASE
1bnc.1.B	11.36	homo-dimer	HHblits	X-ray	2.40Å	0.25	0.31	BIOTIN CARBOXYLASE
1bnc.1.A	11.36	homo-dimer	HHblits	X-ray	2.40Å	0.25	0.31	BIOTIN CARBOXYLASE
4hr7.1.A	11.36	hetero-oligomer	HHblits	X-ray	2.50Å	0.25	0.31	Biotin carboxylase
4hr7.1.C	11.36	hetero-oligomer	HHblits	X-ray	2.50Å	0.25	0.31	Biotin carboxylase
4hr7.1.E	11.36	hetero-oligomer	HHblits	X-ray	2.50Å	0.25	0.31	Biotin carboxylase
4hr7.1.F	11.36	hetero-oligomer	HHblits	X-ray	2.50Å	0.25	0.31	Biotin carboxylase
2j9g.2.A	11.36	monomer	HHblits	X-ray	2.05Å	0.25	0.31	BIOTIN CARBOXYLASE
2vr1.2.A	11.36	monomer	HHblits	X-ray	2.60Å	0.25	0.31	BIOTIN CARBOXYLASE
3gfg.1.A	12.94	homo-dimer	HHblits	X-ray	2.59Å	0.27	0.30	Uncharacterized oxidoreductase yvaA
3g8c.1.A	10.23	monomer	HHblits	X-ray	2.00Å	0.24	0.31	Biotin carboxylase
3g8c.2.A	10.23	monomer	HHblits	X-ray	2.00Å	0.24	0.31	Biotin carboxylase
3rv3.1.A	10.34	homo-dimer	HHblits	X-ray	1.91Å	0.25	0.30	Biotin carboxylase
1kji.1.A	14.12	homo-dimer	HHblits	X-ray	1.60Å	0.27	0.30	phosphoribosylglycinamide formyltransferase 2
1kji.1.B	14.12	homo-dimer	HHblits	X-ray	1.60Å	0.27	0.30	phosphoribosylglycinamide formyltransferase 2
5e38.1.B	15.85	homo-tetramer	HHblits	X-ray	3.00Å	0.29	0.28	Uracil phosphoribosyltransferase
5e38.1.A	15.85	homo-tetramer	HHblits	X-ray	3.00Å	0.29	0.28	Uracil phosphoribosyltransferase
5e38.1.D	15.85	homo-tetramer	HHblits	X-ray	3.00Å	0.29	0.28	Uracil phosphoribosyltransferase
2ehj.1.A	17.07	homo-tetramer	HHblits	X-ray	2.80Å	0.29	0.28	Uracil phosphoribosyltransferase
2ehj.1.C	17.07	homo-tetramer	HHblits	X-ray	2.80Å	0.29	0.28	Uracil phosphoribosyltransferase
1ez1.1.A	13.95	homo-dimer	HHblits	X-ray	1.75Å	0.26	0.30	PHOSPHORIBOSYLGLYCINAMIDE FORMYLTRANSFERASE 2
1ez1.1.B	13.95	homo-dimer	HHblits	X-ray	1.75Å	0.26	0.30	PHOSPHORIBOSYLGLYCINAMIDE FORMYLTRANSFERASE 2
3t95.1.A	16.87	monomer	HHblits	X-ray	1.75Å	0.28	0.29	Autoinducer 2-binding protein lsrB
4win.1.A	10.59	monomer	HHblits	X-ray	2.60Å	0.26	0.30	GMP synthetase
5vev.1.A	14.12	monomer	HHblits	X-ray	1.90Å	0.26	0.30	Phosphoribosylamine--glycine ligase
2jfy.1.B	12.94	homo-dimer	HHblits	X-ray	1.90Å	0.26	0.30	GLUTAMATE RACEMASE
2jfz.1.A	12.94	homo-dimer	HHblits	X-ray	1.86Å	0.26	0.30	GLUTAMATE RACEMASE
2jfx.1.A	12.94	homo-dimer	HHblits	X-ray	2.30Å	0.26	0.30	GLUTAMATE RACEMASE
2jfx.1.B	12.94	homo-dimer	HHblits	X-ray	2.30Å	0.26	0.30	GLUTAMATE RACEMASE
2jfy.1.A	12.94	homo-dimer	HHblits	X-ray	1.90Å	0.26	0.30	GLUTAMATE RACEMASE
4b1f.1.B	12.94	homo-dimer	HHblits	X-ray	2.05Å	0.26	0.30	GLUTAMATE RACEMASE
2w4i.1.A	12.94	homo-tetramer	HHblits	X-ray	1.87Å	0.26	0.30	GLUTAMATE RACEMASE
4n54.1.A	13.41	homo-tetramer	HHblits	X-ray	2.05Å	0.28	0.28	Inositol dehydrogenase
4n54.1.C	13.41	homo-tetramer	HHblits	X-ray	2.05Å	0.28	0.28	Inositol dehydrogenase
4n54.1.D	13.41	homo-tetramer	HHblits	X-ray	2.05Å	0.28	0.28	Inositol dehydrogenase
1tm2.1.A	14.46	monomer	HHblits	X-ray	1.90Å	0.27	0.29	sugar transport protein
1tjy.1.A	14.46	monomer	HHblits	X-ray	1.30Å	0.27	0.29	sugar transport protein
4ew6.1.A	13.10	homo-dimer	HHblits	X-ray	2.30Å	0.26	0.29	D-galactose-1-dehydrogenase protein
3q2i.1.A	10.84	homo-octamer	HHblits	X-ray	1.50Å	0.27	0.29	dehydrogenase
3cea.1.A	10.84	homo-tetramer	HHblits	X-ray	2.40Å	0.27	0.29	Myo-inositol 2-dehydrogenase
4iil.1.A	13.10	monomer	HHblits	X-ray	1.30Å	0.25	0.29	Membrane lipoprotein TpN38(b)
3rcb.1.A	9.64	monomer	HHblits	X-ray	2.49Å	0.26	0.29	Sugar 3-ketoreductase
2pud.1.B	13.75	homo-dimer	HHblits	X-ray	2.60Å	0.29	0.28	PROTEIN (PURINE REPRESSOR)
1jfs.1.B	13.75	homo-dimer	HHblits	X-ray	2.90Å	0.29	0.28	PURINE NUCLEOTIDE SYNTHESIS REPRESSOR
1vpw.1.B	13.75	homo-dimer	HHblits	X-ray	2.70Å	0.29	0.28	PURINE REPRESSOR
4iil.1.A	20.00	monomer	HHblits	X-ray	1.30Å	0.29	0.28	Membrane lipoprotein TpN38(b)
1bdi.1.B	13.75	homo-dimer	HHblits	X-ray	3.00Å	0.28	0.28	PROTEIN (PURINE REPRESSOR)
1jft.1.B	13.75	homo-dimer	HHblits	X-ray	2.50Å	0.28	0.28	PURINE NUCLEOTIDE SYNTHESIS REPRESSOR
3rc9.1.A	9.76	monomer	HHblits	X-ray	1.91Å	0.26	0.28	Sugar 3-ketoreductase
5ere.1.A	12.05	monomer	HHblits	X-ray	2.00Å	0.25	0.29	Extracellular ligand-binding receptor
3rc1.1.A	9.76	monomer	HHblits	X-ray	1.71Å	0.26	0.28	Sugar 3-ketoreductase
2fqx.1.A	5.95	monomer	HHblits	X-ray	1.70Å	0.24	0.29	Membrane lipoprotein tmpC
3gbv.1.A	9.76	homo-dimer	HHblits	X-ray	2.20Å	0.26	0.28	Putative LacI-family transcriptional regulator
3gbv.1.B	9.76	homo-dimer	HHblits	X-ray	2.20Å	0.26	0.28	Putative LacI-family transcriptional regulator
3d1l.1.A	24.32	homo-dimer	HHblits	X-ray	2.19Å	0.34	0.26	Putative NADP oxidoreductase BF3122
3d1l.1.B	24.32	homo-dimer	HHblits	X-ray	2.19Å	0.34	0.26	Putative NADP oxidoreductase BF3122
3vot.1.A	9.76	monomer	HHblits	X-ray	1.80Å	0.26	0.28	L-amino acid ligase, BL00235
3vot.2.A	9.76	monomer	HHblits	X-ray	1.80Å	0.26	0.28	L-amino acid ligase, BL00235
2wrz.1.A	15.19	monomer	HHblits	X-ray	2.20Å	0.28	0.27	L-ARABINOSE-BINDING PERIPLASMIC PROTEIN
2wrz.2.A	15.19	monomer	HHblits	X-ray	2.20Å	0.28	0.27	L-ARABINOSE-BINDING PERIPLASMIC PROTEIN
3e9m.1.A	7.32	homo-dimer	HHblits	X-ray	2.70Å	0.25	0.28	Oxidoreductase, Gfo/Idh/MocA family
3e9m.1.B	7.32	homo-dimer	HHblits	X-ray	2.70Å	0.25	0.28	Oxidoreductase, Gfo/Idh/MocA family
3e9m.2.A	7.32	homo-dimer	HHblits	X-ray	2.70Å	0.25	0.28	Oxidoreductase, Gfo/Idh/MocA family
3q2k.1.A	15.19	homo-octamer	HHblits	X-ray	2.13Å	0.28	0.27	oxidoreductase
3q2k.1.B	15.19	homo-octamer	HHblits	X-ray	2.13Å	0.28	0.27	oxidoreductase
1abf.1.A	13.92	monomer	HHblits	X-ray	1.90Å	0.28	0.27	L-ARABINOSE-BINDING PROTEIN
3d02.1.A	7.32	monomer	HHblits	X-ray	1.30Å	0.25	0.28	Putative LACI-type transcriptional regulator
1xea.1.A	12.35	homo-tetramer	HHblits	X-ray	2.65Å	0.26	0.28	Oxidoreductase, Gfo/Idh/MocA family
4wwh.1.A	12.66	monomer	HHblits	X-ray	1.20Å	0.28	0.27	ABC transporter
5bra.1.A	8.54	monomer	HHblits	X-ray	2.97Å	0.24	0.28	Putative periplasmic binding protein with substrate ribose
5ky3.1.A	11.84	hetero-oligomer	HHblits	X-ray	1.53Å	0.30	0.26	GDP-fucose protein O-fucosyltransferase 1
5ky7.1.A	11.84	hetero-oligomer	HHblits	X-ray	1.60Å	0.30	0.26	GDP-fucose protein O-fucosyltransferase 1
3gfg.1.A	8.86	homo-dimer	HHblits	X-ray	2.59Å	0.26	0.27	Uncharacterized oxidoreductase yvaA
2a0n.1.A	16.88	monomer	HHblits	X-ray	1.64Å	0.28	0.27	Imidazole glycerol phosphate synthase subunit hisF
3bbl.1.A	10.00	homo-dimer	HHblits	X-ray	2.35Å	0.25	0.28	Regulatory protein of LacI family
1gub.1.A	10.00	monomer	HHblits	X-ray	3.10Å	0.25	0.28	D-ALLOSE-BINDING PERIPLASMIC PROTEIN
1gud.1.A	10.00	monomer	HHblits	X-ray	1.71Å	0.25	0.28	D-ALLOSE-BINDING PERIPLASMIC PROTEIN
1gud.2.A	10.00	monomer	HHblits	X-ray	1.71Å	0.25	0.28	D-ALLOSE-BINDING PERIPLASMIC PROTEIN
1rpj.1.A	10.00	monomer	HHblits	X-ray	1.80Å	0.25	0.28	PROTEIN (PRECURSOR OF PERIPLASMIC SUGAR RECEPTOR)
3q2i.1.A	17.11	homo-octamer	HHblits	X-ray	1.50Å	0.29	0.26	dehydrogenase
3rcb.1.A	14.47	monomer	HHblits	X-ray	2.49Å	0.29	0.26	Sugar 3-ketoreductase
1qh1.1.B	12.99	hetero-oligomer	HHblits	X-ray	1.60Å	0.28	0.27	PROTEIN (NITROGENASE MOLYBDENUM IRON PROTEIN)
3rc7.1.A	14.47	monomer	HHblits	X-ray	2.00Å	0.29	0.26	Sugar 3-ketoreductase
1gpw.1.A	17.11	hetero-oligomer	HHblits	X-ray	2.40Å	0.29	0.26	HISF PROTEIN
1gpw.3.A	17.11	hetero-oligomer	HHblits	X-ray	2.40Å	0.29	0.26	HISF PROTEIN
3g85.1.A	19.74	monomer	HHblits	X-ray	1.84Å	0.28	0.26	Transcriptional regulator (LacI family)
3og3.1.A	15.58	monomer	HHblits	X-ray	2.08Å	0.27	0.27	Imidazole glycerol phosphate synthase subunit hisF
3lft.1.A	17.11	monomer	HHblits	X-ray	1.35Å	0.28	0.26	uncharacterized protein
2x7x.1.A	11.84	homo-dimer	HHblits	X-ray	2.64Å	0.27	0.26	SENSOR PROTEIN
4rzt.1.A	15.58	homo-tetramer	HHblits	X-ray	3.10Å	0.26	0.27	Lac repressor
4rzs.1.B	15.58	homo-tetramer	HHblits	X-ray	2.71Å	0.26	0.27	Lac repressor
4rzs.1.C	15.58	homo-tetramer	HHblits	X-ray	2.71Å	0.26	0.27	Lac repressor
4rzs.1.D	15.58	homo-tetramer	HHblits	X-ray	2.71Å	0.26	0.27	Lac repressor
4rzs.1.A	15.58	homo-tetramer	HHblits	X-ray	2.71Å	0.26	0.27	Lac repressor
4rzt.1.B	15.58	homo-tetramer	HHblits	X-ray	3.10Å	0.26	0.27	Lac repressor
1efa.1.C	15.58	homo-dimer	HHblits	X-ray	2.60Å	0.25	0.27	LAC REPRESSOR
1jwl.1.D	15.58	homo-dimer	HHblits	X-ray	4.00Å	0.25	0.27	Lactose Operon Repressor
3nvi.2.B	17.57	hetero-oligomer	HHblits	X-ray	2.71Å	0.28	0.26	50S ribosomal protein L7Ae
3nmu.1.D	17.57	hetero-oligomer	HHblits	X-ray	2.73Å	0.28	0.26	50S ribosomal protein L7Ae
3nvk.1.C	17.57	hetero-oligomer	HHblits	X-ray	3.21Å	0.28	0.26	50S ribosomal protein L7Ae
3nvk.1.D	17.57	hetero-oligomer	HHblits	X-ray	3.21Å	0.28	0.26	50S ribosomal protein L7Ae
3nmu.2.B	17.57	hetero-oligomer	HHblits	X-ray	2.73Å	0.28	0.26	50S ribosomal protein L7Ae
4gmg.1.A	9.21	homo-dimer	HHblits	X-ray	2.31Å	0.26	0.26	Yersiniabactin biosynthetic protein YbtU
5kvq.1.B	9.21	homo-dimer	HHblits	X-ray	1.45Å	0.26	0.26	Irp3 protein
2qv0.1.A	9.09	homo-dimer	HHblits	X-ray	2.40Å	0.25	0.27	Protein mrkE
2lle.1.A	6.49	monomer	HHblits	NMR	NA	0.24	0.27	Chemotaxis protein CheY, Imidazole glycerol phosphate synthase subunit HisF chimera
1tlf.1.A	15.79	homo-tetramer	HHblits	X-ray	2.60Å	0.25	0.26	LAC REPRESSOR
1tlf.1.B	15.79	homo-tetramer	HHblits	X-ray	2.60Å	0.25	0.26	LAC REPRESSOR
1tlf.1.C	15.79	homo-tetramer	HHblits	X-ray	2.60Å	0.25	0.26	LAC REPRESSOR
1tlf.1.D	15.79	homo-tetramer	HHblits	X-ray	2.60Å	0.25	0.26	LAC REPRESSOR
3cwo.1.A	6.58	homo-dimer	HHblits	X-ray	3.10Å	0.25	0.26	beta/alpha-barrel protein based on 1THF and 1TMY
4gmf.1.A	10.67	homo-dimer	HHblits	X-ray	1.85Å	0.25	0.26	Yersiniabactin biosynthetic protein YbtU
4by9.1.D	18.06	hetero-oligomer	HHblits	NMR	NA	0.29	0.25	50S RIBOSOMAL PROTEIN L7AE
4by9.1.G	18.06	hetero-oligomer	HHblits	NMR	NA	0.29	0.25	50S RIBOSOMAL PROTEIN L7AE
4by9.1.J	18.06	hetero-oligomer	HHblits	NMR	NA	0.29	0.25	50S RIBOSOMAL PROTEIN L7AE
4by9.1.M	18.06	hetero-oligomer	HHblits	NMR	NA	0.29	0.25	50S RIBOSOMAL PROTEIN L7AE
3iwp.1.B	19.44	homo-tetramer	HHblits	X-ray	2.50Å	0.28	0.25	Copper homeostasis protein cutC homolog
3iwp.1.A	19.44	homo-tetramer	HHblits	X-ray	2.50Å	0.28	0.25	Copper homeostasis protein cutC homolog
3iwp.2.B	19.44	homo-tetramer	HHblits	X-ray	2.50Å	0.28	0.25	Copper homeostasis protein cutC homolog
3iwp.2.C	19.44	homo-tetramer	HHblits	X-ray	2.50Å	0.28	0.25	Copper homeostasis protein cutC homolog
3iwp.2.D	19.44	homo-tetramer	HHblits	X-ray	2.50Å	0.28	0.25	Copper homeostasis protein cutC homolog
3iwp.3.A	19.44	homo-tetramer	HHblits	X-ray	2.50Å	0.28	0.25	Copper homeostasis protein cutC homolog
3iwp.3.B	19.44	homo-tetramer	HHblits	X-ray	2.50Å	0.28	0.25	Copper homeostasis protein cutC homolog
3iwp.3.C	19.44	homo-tetramer	HHblits	X-ray	2.50Å	0.28	0.25	Copper homeostasis protein cutC homolog
3iwp.3.D	19.44	homo-tetramer	HHblits	X-ray	2.50Å	0.28	0.25	Copper homeostasis protein cutC homolog
1x7i.1.A	20.55	homo-dimer	HHblits	X-ray	1.70Å	0.27	0.25	Copper homeostasis protein cutC
1x7i.1.B	20.55	homo-dimer	HHblits	X-ray	1.70Å	0.27	0.25	Copper homeostasis protein cutC
1twd.1.A	20.55	homo-dimer	HHblits	X-ray	1.70Å	0.27	0.25	Copper homeostasis protein cutC
1twd.1.B	20.55	homo-dimer	HHblits	X-ray	1.70Å	0.27	0.25	Copper homeostasis protein cutC
5fj4.1.C	19.18	hetero-oligomer	HHblits	X-ray	2.95Å	0.27	0.25	50S RIBOSOMAL PROTEIN L7AE
5fj4.2.C	19.18	hetero-oligomer	HHblits	X-ray	2.95Å	0.27	0.25	50S RIBOSOMAL PROTEIN L7AE
3gka.1.A	7.89	monomer	HHblits	X-ray	2.30Å	0.23	0.26	N-ethylmaleimide reductase
3i05.1.A	9.72	homo-dimer	HHblits	X-ray	2.80Å	0.27	0.25	Tryptophanyl-tRNA synthetase
3e1k.1.A	14.08	hetero-oligomer	HHblits	X-ray	3.00Å	0.28	0.25	Galactose/lactose metabolism regulatory protein GAL80
4egj.1.A	16.67	monomer	HHblits	X-ray	2.30Å	0.27	0.25	D-alanine--D-alanine ligase
4gmf.1.A	10.96	homo-dimer	HHblits	X-ray	1.85Å	0.26	0.25	Yersiniabactin biosynthetic protein YbtU
2nvw.1.A	14.08	homo-dimer	HHblits	X-ray	2.10Å	0.28	0.25	Galactose/lactose metabolism regulatory protein GAL80
2nvw.1.B	14.08	homo-dimer	HHblits	X-ray	2.10Å	0.28	0.25	Galactose/lactose metabolism regulatory protein GAL80
4fx7.1.A	13.89	monomer	HHblits	X-ray	2.08Å	0.26	0.25	Imidazole glycerol phosphate synthase subunit HisF
2hjp.1.A	11.27	homo-tetramer	HHblits	X-ray	1.90Å	0.26	0.25	Phosphonopyruvate hydrolase
1o5t.1.A	6.94	homo-dimer	HHblits	X-ray	2.50Å	0.25	0.25	Tryptophanyl-tRNA synthetase
1ulh.1.A	6.94	homo-dimer	HHblits	X-ray	2.31Å	0.25	0.25	Tryptophanyl-tRNA synthetase
1ulh.1.B	6.94	homo-dimer	HHblits	X-ray	2.31Å	0.25	0.25	Tryptophanyl-tRNA synthetase
2qui.1.B	6.94	homo-dimer	HHblits	X-ray	2.40Å	0.25	0.25	Tryptophanyl-tRNA synthetase
2quk.1.A	6.94	homo-dimer	HHblits	X-ray	2.80Å	0.25	0.25	Tryptophanyl-tRNA synthetase
2qui.1.A	6.94	homo-dimer	HHblits	X-ray	2.40Å	0.25	0.25	Tryptophanyl-tRNA synthetase
1s2u.1.A	9.86	homo-tetramer	HHblits	X-ray	2.00Å	0.26	0.25	Phosphoenolpyruvate phosphomutase
1m1b.1.A	9.86	homo-tetramer	HHblits	X-ray	2.25Å	0.26	0.25	PHOSPHOENOLPYRUVATE PHOSPHOMUTASE
1s2v.1.A	9.86	homo-tetramer	HHblits	X-ray	2.10Å	0.26	0.25	Phosphoenolpyruvate phosphomutase
1s2w.1.A	9.86	monomer	HHblits	X-ray	1.69Å	0.26	0.25	Phosphoenolpyruvate phosphomutase
4iyj.1.A	16.18	homo-dimer	HHblits	X-ray	1.37Å	0.29	0.24	GDSL-like protein
3nkl.1.A	14.49	homo-dimer	HHblits	X-ray	1.90Å	0.28	0.24	UDP-D-quinovosamine 4-dehydrogenase
3nkl.1.B	14.49	homo-dimer	HHblits	X-ray	1.90Å	0.28	0.24	UDP-D-quinovosamine 4-dehydrogenase
4gmg.1.A	15.71	homo-dimer	HHblits	X-ray	2.31Å	0.27	0.24	Yersiniabactin biosynthetic protein YbtU
5kvq.1.B	15.71	homo-dimer	HHblits	X-ray	1.45Å	0.27	0.24	Irp3 protein
1r6u.1.A	6.94	homo-dimer	HHblits	X-ray	2.00Å	0.25	0.25	Tryptophanyl-tRNA synthetase
1r6u.1.B	6.94	homo-dimer	HHblits	X-ray	2.00Å	0.25	0.25	Tryptophanyl-tRNA synthetase
2ogb.2.A	11.59	monomer	HHblits	X-ray	1.95Å	0.28	0.24	RING finger protein 41
2ogb.1.A	11.59	monomer	HHblits	X-ray	1.95Å	0.28	0.24	RING finger protein 41
3ec7.1.A	14.93	homo-tetramer	HHblits	X-ray	2.15Å	0.30	0.23	Putative Dehydrogenase
5unc.1.A	10.00	homo-tetramer	HHblits	X-ray	1.71Å	0.27	0.24	PHOSPHOENOLPYRUVATE PHOSPHOMUTASE
2fzp.1.A	11.59	monomer	HHblits	X-ray	1.87Å	0.28	0.24	ring finger protein 41 isoform 1
3q2k.1.A	20.90	homo-octamer	HHblits	X-ray	2.13Å	0.30	0.23	oxidoreductase
3q2k.1.B	20.90	homo-octamer	HHblits	X-ray	2.13Å	0.30	0.23	oxidoreductase
3t7c.1.A	14.49	homo-tetramer	HHblits	X-ray	1.95Å	0.27	0.24	Carveol dehydrogenase
4rs3.1.A	10.29	monomer	HHblits	X-ray	1.40Å	0.28	0.24	ABC transporter, carbohydrate uptake transporter-2 (CUT2) family, periplasmic sugar-binding protein
1r6t.1.A	7.04	homo-dimer	HHblits	X-ray	2.10Å	0.25	0.25	Tryptophanyl-tRNA synthetase
1r6t.1.B	7.04	homo-dimer	HHblits	X-ray	2.10Å	0.25	0.25	Tryptophanyl-tRNA synthetase
2azx.1.B	7.04	homo-dimer	HHblits	X-ray	2.80Å	0.25	0.25	Tryptophanyl-tRNA synthetase
3qk7.1.A	8.96	homo-dimer	HHblits	X-ray	2.70Å	0.28	0.23	Transcriptional regulators
3qk7.2.A	8.96	homo-dimer	HHblits	X-ray	2.70Å	0.28	0.23	Transcriptional regulators
3qk7.2.B	8.96	homo-dimer	HHblits	X-ray	2.70Å	0.28	0.23	Transcriptional regulators
4hf7.1.A	11.94	homo-dimer	HHblits	X-ray	1.77Å	0.28	0.23	Putative acylhydrolase
4ppy.1.A	15.15	homo-dimer	HHblits	X-ray	2.00Å	0.29	0.23	Putative acylhydrolase
1drk.1.A	13.43	monomer	HHblits	X-ray	2.00Å	0.27	0.23	D-RIBOSE-BINDING PROTEIN
1v2g.1.A	7.46	monomer	HHblits	X-ray	2.00Å	0.26	0.23	Acyl-CoA thioesterase I
2ipm.1.A	10.61	monomer	HHblits	X-ray	1.12Å	0.26	0.23	D-galactose-binding periplasmic protein
1j00.1.A	7.58	monomer	HHblits	X-ray	2.00Å	0.26	0.23	Thioesterase I
1u8u.1.A	7.58	monomer	HHblits	X-ray	2.08Å	0.26	0.23	Acyl-CoA thioesterase I
5kws.1.A	7.58	monomer	HHblits	X-ray	1.32Å	0.26	0.23	Galactose-binding protein
3rc7.1.A	12.50	monomer	HHblits	X-ray	2.00Å	0.28	0.22	Sugar 3-ketoreductase
3itd.1.A	12.50	homo-dimer	HHblits	X-ray	1.89Å	0.27	0.22	17beta-Hydroxysteroid dehydrogenase
3lft.1.A	12.50	monomer	HHblits	X-ray	1.35Å	0.27	0.22	uncharacterized protein
4wza.1.A	16.39	hetero-oligomer	HHblits	X-ray	1.90Å	0.29	0.21	Nitrogenase molybdenum-iron protein alpha chain
5cx1.1.A	16.39	hetero-oligomer	HHblits	X-ray	1.75Å	0.28	0.21	Nitrogenase molybdenum-iron protein alpha chain
2ake.1.B	7.94	homo-dimer	HHblits	X-ray	3.10Å	0.26	0.22	Tryptophanyl-tRNA synthetase
4u63.1.A	16.39	monomer	HHblits	X-ray	1.67Å	0.28	0.21	DNA photolyase
2p2f.1.A	9.52	monomer	HHblits	X-ray	2.58Å	0.25	0.22	Acetyl-coenzyme A synthetase
1w5n.1.A	12.07	homo-octamer	HHblits	X-ray	1.65Å	0.29	0.20	DELTA-AMINOLEVULINIC ACID DEHYDRATASE
2c13.1.A	12.07	homo-octamer	HHblits	X-ray	2.15Å	0.28	0.20	DELTA-AMINOLEVULINIC ACID DEHYDRATASE
2c16.1.A	12.07	homo-octamer	HHblits	X-ray	2.02Å	0.28	0.20	DELTA-AMINOLEVULINIC ACID DEHYDRATASE
2c19.1.A	12.07	homo-octamer	HHblits	X-ray	2.05Å	0.28	0.20	DELTA-AMINOLEVULINIC ACID DEHYDRATASE
1w54.1.A	12.07	homo-octamer	HHblits	X-ray	2.20Å	0.28	0.20	DELTA-AMINOLEVULINIC ACID DEHYDRATASE
2c15.1.A	12.07	homo-octamer	HHblits	X-ray	1.48Å	0.28	0.20	DELTA-AMINOLEVULINIC ACID DEHYDRATASE
1gzg.1.A	12.07	homo-octamer	HHblits	X-ray	1.66Å	0.28	0.20	DELTA-AMINOLEVULINIC ACID DEHYDRATASE
2woq.1.A	12.07	homo-octamer	HHblits	X-ray	1.75Å	0.28	0.20	DELTA-AMINOLEVULINIC ACID DEHYDRATASE
1b4k.1.B	12.07	homo-octamer	HHblits	X-ray	1.67Å	0.28	0.20	PROTEIN (5-AMINOLEVULINIC ACID DEHYDRATASE)
1b4k.1.A	12.07	homo-octamer	HHblits	X-ray	1.67Å	0.28	0.20	PROTEIN (5-AMINOLEVULINIC ACID DEHYDRATASE)
2hqo.1.A	10.17	homo-dimer	HHblits	NMR	NA	0.27	0.20	Putative TRANSCRIPTIONAL REGULATOR
2hqo.1.B	10.17	homo-dimer	HHblits	NMR	NA	0.27	0.20	Putative TRANSCRIPTIONAL REGULATOR
1w5o.1.A	10.34	homo-octamer	HHblits	X-ray	1.85Å	0.28	0.20	DELTA-AMINOLEVULINIC ACID DEHYDRATASE
1w56.1.A	10.34	homo-octamer	HHblits	X-ray	1.70Å	0.28	0.20	DELTA-AMINOLEVULINIC ACID DEHYDRATASE
1w5m.1.A	10.34	homo-octamer	HHblits	X-ray	1.60Å	0.28	0.20	DELTA-AMINOLEVULINIC ACID DEHYDRATASE
1w5p.1.A	8.62	homo-octamer	HHblits	X-ray	1.55Å	0.27	0.20	DELTA-AMINOLEVULINIC ACID DEHYDRATASE
1w5q.1.A	8.62	homo-octamer	HHblits	X-ray	1.40Å	0.27	0.20	DELTA-AMINOLEVULINIC ACID DEHYDRATASE
2ofw.1.B	21.82	homo-dimer	HHblits	X-ray	2.05Å	0.31	0.19	APS kinase domain of the PAPS synthetase 1
2ofw.1.A	21.82	homo-dimer	HHblits	X-ray	2.05Å	0.31	0.19	APS kinase domain of the PAPS synthetase 1
3ixl.1.A	6.78	monomer	HHblits	X-ray	1.45Å	0.25	0.20	Arylmalonate decarboxylase
3noy.1.A	20.00	homo-dimer	HHblits	X-ray	2.70Å	0.29	0.19	4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
3noy.2.A	20.00	homo-dimer	HHblits	X-ray	2.70Å	0.29	0.19	4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
4mwa.1.A	12.96	homo-tetramer	HHblits	X-ray	1.85Å	0.29	0.19	4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
4mwa.1.B	12.96	homo-tetramer	HHblits	X-ray	1.85Å	0.29	0.19	4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
4mwa.1.C	12.96	homo-tetramer	HHblits	X-ray	1.85Å	0.29	0.19	4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
4mwa.1.D	12.96	homo-tetramer	HHblits	X-ray	1.85Å	0.29	0.19	4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
4mwa.2.B	12.96	homo-tetramer	HHblits	X-ray	1.85Å	0.29	0.19	4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
4mwa.2.D	12.96	homo-tetramer	HHblits	X-ray	1.85Å	0.29	0.19	4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
1yht.1.A	15.09	monomer	HHblits	X-ray	2.00Å	0.29	0.18	DspB
1fui.1.A	17.31	homo-trimer	HHblits	X-ray	2.50Å	0.28	0.18	L-FUCOSE ISOMERASE
4mg4.1.A	20.00	homo-dimer	HHblits	X-ray	1.70Å	0.30	0.17	Phosphonomutase
4mg4.2.B	20.00	homo-dimer	HHblits	X-ray	1.70Å	0.30	0.17	Phosphonomutase
4fq5.1.A	9.43	homo-tetramer	HHblits	X-ray	2.10Å	0.25	0.18	Maleate cis-trans isomerase
4fq5.1.B	9.43	homo-tetramer	HHblits	X-ray	2.10Å	0.25	0.18	Maleate cis-trans isomerase
4fq7.1.A	9.62	homo-tetramer	HHblits	X-ray	3.00Å	0.26	0.18	Maleate cis-trans isomerase
1fwr.1.A	18.00	homo-trimer	HHblits	X-ray	2.70Å	0.28	0.17	KDPG ALDOLASE
2xed.1.A	7.84	monomer	HHblits	X-ray	1.95Å	0.26	0.18	PUTATIVE MALEATE ISOMERASE
2ip4.1.A	16.67	monomer	HHblits	X-ray	2.80Å	0.30	0.17	Phosphoribosylamine--glycine ligase
2ip4.2.A	16.67	monomer	HHblits	X-ray	2.80Å	0.30	0.17	Phosphoribosylamine--glycine ligase
4c20.1.A	8.00	monomer	HHblits	X-ray	2.41Å	0.26	0.17	L-FUCOSE ISOMERASE
4c21.1.A	8.00	homo-hexamer	HHblits	X-ray	2.55Å	0.26	0.17	L-FUCOSE ISOMERASE
1umy.1.A	10.42	homo-tetramer	HHblits	X-ray	2.50Å	0.29	0.17	BETAINE--HOMOCYSTEINE S-METHYLTRANSFERASE
3a9t.1.A	12.24	homo-hexamer	HHblits	X-ray	2.61Å	0.27	0.17	D-arabinose isomerase
4m3p.1.A	8.33	homo-tetramer	HHblits	X-ray	1.89Å	0.28	0.17	Betaine--homocysteine S-methyltransferase 1
4m3p.1.D	8.33	homo-tetramer	HHblits	X-ray	1.89Å	0.28	0.17	Betaine--homocysteine S-methyltransferase 1
2ys6.1.A	14.89	monomer	HHblits	X-ray	2.21Å	0.29	0.16	Phosphoribosylglycinamide synthetase
1eo1.1.A	12.77	monomer	HHblits	NMR	NA	0.29	0.16	HYPOTHETICAL PROTEIN MTH1175
2xcl.1.A	10.20	monomer	HHblits	X-ray	2.10Å	0.24	0.17	PHOSPHORIBOSYLAMINE--GLYCINE LIGASE
4ix1.1.A	4.08	homo-dimer	HHblits	X-ray	2.80Å	0.24	0.17	hypothetical protein
4ix1.1.B	4.08	homo-dimer	HHblits	X-ray	2.80Å	0.24	0.17	hypothetical protein
1rdu.1.A	10.87	monomer	HHblits	NMR	NA	0.27	0.16	conserved hypothetical protein
2oek.1.A	15.56	homo-dimer	HHblits	X-ray	1.80Å	0.28	0.16	2,3-diketo-5-methylthiopentyl-1-phosphate enolase
4h4x.1.A	26.83	homo-dimer	HHblits	X-ray	1.50Å	0.34	0.14	Biphenyl dioxygenase ferredoxin reductase subunit
4kzk.1.A	11.36	monomer	HHblits	X-ray	1.50Å	0.28	0.15	L-arabinose ABC transporter, periplasmic L-arabinose-binding protein
4h4v.1.A	27.50	homo-dimer	HHblits	X-ray	1.40Å	0.34	0.14	Biphenyl dioxygenase ferredoxin reductase subunit
2yvg.1.A	27.50	homo-dimer	HHblits	X-ray	1.60Å	0.34	0.14	Ferredoxin reductase
2yvj.1.A	27.50	hetero-oligomer	HHblits	X-ray	1.90Å	0.34	0.14	Ferredoxin reductase
2yvj.1.C	27.50	hetero-oligomer	HHblits	X-ray	1.90Å	0.34	0.14	Ferredoxin reductase
1d7y.1.A	27.50	homo-dimer	HHblits	X-ray	2.10Å	0.34	0.14	FERREDOXIN REDUCTASE
2gr3.1.A	27.50	homo-dimer	HHblits	X-ray	1.50Å	0.34	0.14	ferredoxin reductase
4h4t.1.A	27.50	homo-dimer	HHblits	X-ray	1.50Å	0.34	0.14	Biphenyl dioxygenase ferredoxin reductase subunit
4h4r.1.A	27.50	homo-dimer	HHblits	X-ray	1.40Å	0.34	0.14	Biphenyl dioxygenase ferredoxin reductase subunit
4h4z.1.A	27.50	homo-dimer	HHblits	X-ray	1.95Å	0.34	0.14	Biphenyl dioxygenase ferredoxin reductase subunit
4h4p.1.A	27.50	homo-dimer	HHblits	X-ray	1.50Å	0.34	0.14	Biphenyl dioxygenase ferredoxin reductase subunit
2o2j.1.A	15.56	homo-dimer	HHblits	X-ray	2.56Å	0.25	0.16	Tryptophan synthase beta chain
2o2j.1.B	15.56	homo-dimer	HHblits	X-ray	2.56Å	0.25	0.16	Tryptophan synthase beta chain
2o2e.1.B	15.56	homo-dimer	HHblits	X-ray	2.20Å	0.25	0.16	Tryptophan synthase beta chain
4bur.1.A	19.51	monomer	HHblits	X-ray	2.88Å	0.32	0.14	APOPTOSIS INDUCING FACTOR 1, MITOCHONDRIAL
4bur.3.A	19.51	monomer	HHblits	X-ray	2.88Å	0.32	0.14	APOPTOSIS INDUCING FACTOR 1, MITOCHONDRIAL
1m6i.1.A	19.51	monomer	HHblits	X-ray	1.80Å	0.32	0.14	Programmed cell death protein 8
3fg2.1.A	24.39	monomer	HHblits	X-ray	2.20Å	0.32	0.14	Putative rubredoxin reductase
5fmh.1.A	19.51	monomer	HHblits	X-ray	1.80Å	0.32	0.14	APOPTOSIS-INDUCING FACTOR 1, MITOCHONDRIAL
5fs9.1.A	19.51	monomer	HHblits	X-ray	1.75Å	0.32	0.14	APOPTOSIS-INDUCING FACTOR 1, MITOCHONDRIAL
5fs8.1.A	19.51	monomer	HHblits	X-ray	1.40Å	0.32	0.14	APOPTOSIS-INDUCING FACTOR 1, MITOCHONDRIAL
4fdc.1.A	19.51	monomer	HHblits	X-ray	2.40Å	0.32	0.14	Apoptosis-inducing factor 1, mitochondrial
5jcl.1.A	21.43	monomer	HHblits	X-ray	1.80Å	0.30	0.15	Os09g0567300 protein
4fx9.1.A	22.50	homo-dimer	HHblits	X-ray	2.70Å	0.33	0.14	Coenzyme A disulfide reductase
3lxd.1.A	21.95	monomer	HHblits	X-ray	2.50Å	0.31	0.14	FAD-dependent pyridine nucleotide-disulphide oxidoreductase
3ics.1.A	22.50	homo-dimer	HHblits	X-ray	1.94Å	0.33	0.14	Coenzyme A-Disulfide Reductase
4qwv.1.A	9.30	monomer	HHblits	X-ray	2.45Å	0.27	0.15	High-affinity leucine-specific transport system periplasmic binding protein, Chemotaxis protein CheY
4lii.1.A	20.00	monomer	HHblits	X-ray	1.88Å	0.32	0.14	Apoptosis-inducing factor 1, mitochondrial
3gd4.1.A	20.00	homo-dimer	HHblits	X-ray	2.24Å	0.32	0.14	Apoptosis-inducing factor 1, mitochondrial
3gd4.1.B	20.00	homo-dimer	HHblits	X-ray	2.24Å	0.32	0.14	Apoptosis-inducing factor 1, mitochondrial
1gv4.1.A	20.00	monomer	HHblits	X-ray	2.00Å	0.32	0.14	PROGRAMED CELL DEATH PROTEIN 8
5kvi.1.A	20.00	monomer	HHblits	X-ray	2.00Å	0.32	0.14	Apoptosis-inducing factor 1, mitochondrial
5fs6.1.A	20.00	monomer	HHblits	X-ray	1.90Å	0.32	0.14	APOPTOSIS-INDUCING FACTOR 1, MITOCHONDRIAL
3gd3.1.A	20.00	monomer	HHblits	X-ray	2.95Å	0.32	0.14	Apoptosis-inducing factor 1, mitochondrial
3gd3.2.A	20.00	monomer	HHblits	X-ray	2.95Å	0.32	0.14	Apoptosis-inducing factor 1, mitochondrial
3gd3.4.A	20.00	monomer	HHblits	X-ray	2.95Å	0.32	0.14	Apoptosis-inducing factor 1, mitochondrial
5miu.1.A	20.00	monomer	HHblits	X-ray	3.50Å	0.32	0.14	Apoptosis-inducing factor 1, mitochondrial
5miv.1.A	20.00	homo-dimer	HHblits	X-ray	3.10Å	0.32	0.14	Apoptosis-inducing factor 1, mitochondrial
5miv.1.B	20.00	homo-dimer	HHblits	X-ray	3.10Å	0.32	0.14	Apoptosis-inducing factor 1, mitochondrial
5fs7.1.A	20.00	monomer	HHblits	X-ray	1.85Å	0.32	0.14	APOPTOSIS-INDUCING FACTOR 1, MITOCHONDRIAL
5kvh.1.A	20.00	homo-dimer	HHblits	X-ray	2.27Å	0.32	0.14	Apoptosis-inducing factor 1, mitochondrial
3hyv.1.A	21.05	homo-trimer	HHblits	X-ray	2.30Å	0.36	0.13	Sulfide-quinone reductase
3ef6.1.A	25.64	monomer	HHblits	X-ray	1.80Å	0.34	0.14	Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase
4emi.1.A	25.64	monomer	HHblits	X-ray	1.81Å	0.34	0.14	TodA
4emj.1.A	25.64	hetero-oligomer	HHblits	X-ray	2.40Å	0.34	0.14	TodA
5jci.1.A	21.95	monomer	HHblits	X-ray	1.70Å	0.30	0.14	Os09g0567300 protein
5jcm.1.A	21.95	monomer	HHblits	X-ray	1.90Å	0.30	0.14	Os09g0567300 protein
2gps.1.A	13.95	monomer	HHblits	X-ray	2.80Å	0.26	0.15	Biotin carboxylase
2y85.1.A	19.51	monomer	HHblits	X-ray	2.40Å	0.29	0.14	PHOSPHORIBOSYL ISOMERASE A
3zs4.1.A	19.51	monomer	HHblits	X-ray	1.90Å	0.29	0.14	PHOSPHORIBOSYL ISOMERASE A
4v7h.1.4	14.29	hetero-oligomer	HHblits	EM	8.90Å	0.27	0.15	60S ribosomal protein L8(A)
2c7g.1.A	22.50	homo-dimer	HHblits	X-ray	1.80Å	0.31	0.14	NADPH-FERREDOXIN REDUCTASE FPRA
1lqu.1.A	22.50	monomer	HHblits	X-ray	1.25Å	0.31	0.14	FprA
2v3a.1.A	22.50	monomer	HHblits	X-ray	2.40Å	0.31	0.14	RUBREDOXIN REDUCTASE
2v3b.1.A	22.50	hetero-oligomer	HHblits	X-ray	2.45Å	0.31	0.14	RUBREDOXIN REDUCTASE
4ycs.1.A	9.52	monomer	HHblits	X-ray	1.98Å	0.27	0.15	Uncharacterized protein
4ycs.2.A	9.52	monomer	HHblits	X-ray	1.98Å	0.27	0.15	Uncharacterized protein
3cge.1.A	22.50	homo-dimer	HHblits	X-ray	2.26Å	0.30	0.14	Pyridine nucleotide-disulfide oxidoreductase, class I
1e1m.1.A	23.08	monomer	HHblits	X-ray	1.85Å	0.32	0.14	ADRENODOXIN REDUCTASE
1e1l.1.A	23.08	monomer	HHblits	X-ray	2.30Å	0.32	0.14	ADRENODOXIN REDUCTASE
1e6e.2.A	23.08	hetero-oligomer	HHblits	X-ray	2.30Å	0.32	0.14	NADPH\:ADRENODOXIN OXIDOREDUCTASE
1e6e.1.A	23.08	hetero-oligomer	HHblits	X-ray	2.30Å	0.32	0.14	NADPH\:ADRENODOXIN OXIDOREDUCTASE
2o14.1.A	12.20	monomer	HHblits	X-ray	2.10Å	0.28	0.14	Hypothetical protein yxiM
3lb8.1.A	20.00	hetero-oligomer	HHblits	X-ray	2.60Å	0.30	0.14	Putidaredoxin reductase
3lb8.2.A	20.00	hetero-oligomer	HHblits	X-ray	2.60Å	0.30	0.14	Putidaredoxin reductase
5l1n.1.A	23.68	homo-dimer	HHblits	X-ray	3.60Å	0.34	0.13	Coenzyme A disulfide reductase
3kd9.1.A	23.68	homo-dimer	HHblits	X-ray	2.75Å	0.34	0.13	Coenzyme A disulfide reductase
1q1r.1.A	20.00	monomer	HHblits	X-ray	1.91Å	0.30	0.14	Putidaredoxin reductase
1q1w.2.A	20.00	monomer	HHblits	X-ray	2.60Å	0.30	0.14	Putidaredoxin reductase
3jah.57.A	17.50	monomer	HHblits	EM	NA	0.29	0.14	eS12
5k0y.1.d	17.50	hetero-oligomer	HHblits	EM	NA	0.29	0.14	40S ribosomal protein S12
3noy.1.A	23.68	homo-dimer	HHblits	X-ray	2.70Å	0.33	0.13	4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
3noy.2.A	23.68	homo-dimer	HHblits	X-ray	2.70Å	0.33	0.13	4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
7abp.1.A	17.95	monomer	HHblits	X-ray	1.67Å	0.31	0.14	L-ARABINOSE-BINDING PROTEIN
1bap.1.A	17.95	monomer	HHblits	X-ray	1.75Å	0.31	0.14	L-ARABINOSE-BINDING PROTEIN
3cgb.1.A	23.08	homo-dimer	HHblits	X-ray	1.90Å	0.30	0.14	Pyridine nucleotide-disulfide oxidoreductase, class I
3j7a.1.R	12.50	hetero-oligomer	HHblits	EM	NA	0.28	0.14	40S ribosomal protein eS12
1thf.1.A	12.20	homo-dimer	HHblits	X-ray	1.45Å	0.26	0.14	HISF PROTEIN
1w3e.1.A	12.82	monomer	HHblits	X-ray	1.77Å	0.29	0.14	50S RIBOSOMAL PROTEIN L30E
1glg.1.A	21.05	monomer	HHblits	X-ray	2.00Å	0.31	0.13	GALACTOSE/GLUCOSE-BINDING PROTEIN
2qw1.1.A	21.05	monomer	HHblits	X-ray	1.70Å	0.31	0.13	D-galactose-binding periplasmic protein
2fvy.1.A	21.05	monomer	HHblits	X-ray	0.92Å	0.31	0.13	D-galactose-binding periplasmic protein
2bc1.1.A	10.00	homo-dimer	HHblits	X-ray	2.15Å	0.27	0.14	NADH Oxidase
2ozb.1.B	25.64	hetero-oligomer	HHblits	X-ray	2.60Å	0.29	0.14	U4/U6.U5 tri-snRNP 15.5 kDa protein
2ozb.2.B	25.64	hetero-oligomer	HHblits	X-ray	2.60Å	0.29	0.14	U4/U6.U5 tri-snRNP 15.5 kDa protein
3siu.1.A	25.64	hetero-oligomer	HHblits	X-ray	2.63Å	0.29	0.14	NHP2-like protein 1
3siu.2.A	25.64	hetero-oligomer	HHblits	X-ray	2.63Å	0.29	0.14	NHP2-like protein 1
3siv.1.A	25.64	hetero-oligomer	HHblits	X-ray	3.30Å	0.29	0.14	NHP2-like protein 1
3siv.1.D	25.64	hetero-oligomer	HHblits	X-ray	3.30Å	0.29	0.14	NHP2-like protein 1
3siv.2.A	25.64	hetero-oligomer	HHblits	X-ray	3.30Å	0.29	0.14	NHP2-like protein 1
3siv.2.D	25.64	hetero-oligomer	HHblits	X-ray	3.30Å	0.29	0.14	NHP2-like protein 1
5ere.1.A	20.00	monomer	HHblits	X-ray	2.00Å	0.27	0.14	Extracellular ligand-binding receptor
4v8m.14.A	15.38	monomer	HHblits	EM	5.57Å	0.29	0.14	40S RIBOSOMAL PROTEIN S12
4n0q.1.A	23.08	monomer	HHblits	X-ray	2.30Å	0.28	0.14	Leu/Ile/Val-binding protein homolog 3
4lck.1.A	20.51	monomer	HHblits	X-ray	3.20Å	0.28	0.14	Ribosomal protein YbxF
4lck.2.A	20.51	monomer	HHblits	X-ray	3.20Å	0.28	0.14	Ribosomal protein YbxF
3v7e.1.A	20.51	monomer	HHblits	X-ray	2.80Å	0.28	0.14	Ribosome-associated protein L7Ae-like
4tzz.2.A	20.51	monomer	HHblits	X-ray	3.64Å	0.28	0.14	Ribosome-associated protein L7Ae-like
4tzp.2.A	20.51	monomer	HHblits	X-ray	8.50Å	0.28	0.14	Ribosome-associated protein L7Ae-like
4tzw.1.A	20.51	monomer	HHblits	X-ray	4.67Å	0.28	0.14	Ribosome-associated protein L7Ae-like
4v6w.7.A	12.82	monomer	HHblits	EM	NA	0.28	0.14	40S ribosomal protein S12
3ipc.1.A	10.00	monomer	HHblits	X-ray	1.30Å	0.26	0.14	ABC transporter, substrate binding protein (Amino acid)
4m88.1.A	17.95	monomer	HHblits	X-ray	1.76Å	0.27	0.14	Extracellular ligand-binding receptor
2czw.1.A	18.42	monomer	HHblits	X-ray	1.90Å	0.29	0.13	50S ribosomal protein L7Ae
1usi.1.A	10.26	monomer	HHblits	X-ray	1.80Å	0.27	0.14	LEUCINE-SPECIFIC BINDING PROTEIN
1usg.1.A	10.26	homo-dimer	HHblits	X-ray	1.53Å	0.27	0.14	LEUCINE-SPECIFIC BINDING PROTEIN
5eqj.1.A	17.50	hetero-oligomer	HHblits	X-ray	2.20Å	0.25	0.14	tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit TRM6
2jnb.1.A	23.68	monomer	HHblits	NMR	NA	0.29	0.13	NHP2-like protein 1
3i45.1.A	15.38	monomer	HHblits	X-ray	1.36Å	0.26	0.14	Twin-arginine translocation pathway signal protein
2liv.1.A	10.26	monomer	HHblits	X-ray	2.40Å	0.26	0.14	LEUCINE
1f0k.1.A	9.76	homo-dimer	HHblits	X-ray	1.90Å	0.22	0.14	UDP-N-ACETYLGLUCOSAMINE-N-ACETYLMURAMYL-(PENTAPEPTIDE) PYROPHOSPHORYL-UNDECAPRENOL N-ACETYLGLUCOSAMINE TRANSFERASE
1f0k.1.B	9.76	homo-dimer	HHblits	X-ray	1.90Å	0.22	0.14	UDP-N-ACETYLGLUCOSAMINE-N-ACETYLMURAMYL-(PENTAPEPTIDE) PYROPHOSPHORYL-UNDECAPRENOL N-ACETYLGLUCOSAMINE TRANSFERASE
1nlm.1.A	9.76	homo-dimer	HHblits	X-ray	2.50Å	0.22	0.14	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase
1nlm.1.B	9.76	homo-dimer	HHblits	X-ray	2.50Å	0.22	0.14	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase
3cpq.1.A	13.16	homo-dimer	HHblits	X-ray	1.90Å	0.28	0.13	50S ribosomal protein L30e
5odc.1.D	22.22	hetero-oligomer	HHblits	X-ray	2.30Å	0.32	0.13	Methyl-viologen reducing hydrogenase subunit D
5it7.28.A	18.42	monomer	HHblits	EM	NA	0.28	0.13	60S ribosomal protein L30
3ukj.1.A	23.68	monomer	HHblits	X-ray	1.60Å	0.28	0.13	Extracellular ligand-binding receptor
3ipa.1.A	10.26	monomer	HHblits	X-ray	1.55Å	0.26	0.14	ABC transporter, substrate binding protein (Amino acid)
4nut.1.A	21.05	hetero-oligomer	HHblits	X-ray	1.55Å	0.28	0.13	13 kDa ribonucleoprotein-associated protein
3jcm.1.G	21.05	hetero-oligomer	HHblits	EM	NA	0.28	0.13	13 kDa ribonucleoprotein-associated protein
1zwz.1.A	21.05	monomer	HHblits	X-ray	1.90Å	0.28	0.13	Snu13p
5wyk.1.G	21.05	hetero-oligomer	HHblits	EM	NA	0.28	0.13	13 kDa ribonucleoprotein-associated protein
5wyj.7.A	21.05	monomer	HHblits	EM	NA	0.28	0.13	13 kDa ribonucleoprotein-associated protein
5nrl.1.R	21.05	hetero-oligomer	HHblits	EM	NA	0.28	0.13	13 kDa ribonucleoprotein-associated protein
5wlc.48.A	21.05	monomer	HHblits	EM	NA	0.28	0.13	Snu13
5wlc.47.A	21.05	monomer	HHblits	EM	NA	0.28	0.13	Snu13
4zpj.1.A	12.82	monomer	HHblits	X-ray	2.24Å	0.26	0.14	Extracellular ligand-binding receptor
4m88.1.A	12.82	monomer	HHblits	X-ray	1.76Å	0.25	0.14	Extracellular ligand-binding receptor
4kv7.1.A	15.79	monomer	HHblits	X-ray	1.20Å	0.27	0.13	Probable leucine/isoleucine/valine-binding protein
3ukj.1.A	7.69	monomer	HHblits	X-ray	1.60Å	0.25	0.14	Extracellular ligand-binding receptor
3i45.1.A	12.50	monomer	HHblits	X-ray	1.36Å	0.23	0.14	Twin-arginine translocation pathway signal protein
4v8m.75.A	10.53	monomer	HHblits	EM	5.57Å	0.27	0.13	60S RIBOSOMAL PROTEIN L7A, PUTATIVE
3q94.1.A	13.51	homo-dimer	HHblits	X-ray	2.30Å	0.29	0.13	Fructose-bisphosphate aldolase, class II
4nas.1.A	16.22	homo-dimer	HHblits	X-ray	1.92Å	0.28	0.13	Ribulose-bisphosphate carboxylase
2lbp.1.A	10.26	monomer	HHblits	X-ray	2.40Å	0.23	0.14	LEUCINE-BINDING PROTEIN
4evq.1.A	7.69	monomer	HHblits	X-ray	1.40Å	0.23	0.14	Putative ABC transporter subunit, substrate-binding component
2zvi.1.A	13.51	homo-dimer	HHblits	X-ray	2.30Å	0.27	0.13	2,3-diketo-5-methylthiopentyl-1-phosphate enolase
2zvi.1.B	13.51	homo-dimer	HHblits	X-ray	2.30Å	0.27	0.13	2,3-diketo-5-methylthiopentyl-1-phosphate enolase
2zvi.2.A	13.51	homo-dimer	HHblits	X-ray	2.30Å	0.27	0.13	2,3-diketo-5-methylthiopentyl-1-phosphate enolase
3ipa.1.A	10.53	monomer	HHblits	X-ray	1.55Å	0.25	0.13	ABC transporter, substrate binding protein (Amino acid)
4f06.1.A	2.63	monomer	HHblits	X-ray	1.30Å	0.24	0.13	Extracellular ligand-binding receptor
4nwz.1.A	25.71	homo-dimer	HHblits	X-ray	2.50Å	0.30	0.12	FAD-dependent pyridine nucleotide-disulfide oxidoreductase
3lop.1.A	16.67	monomer	HHblits	X-ray	1.55Å	0.28	0.13	Substrate binding periplasmic protein
3lkv.1.A	13.51	homo-dimer	HHblits	X-ray	2.20Å	0.26	0.13	uncharacterized CONSERVED DOMAIN PROTEIN
5kmq.1.A	25.71	homo-dimer	HHblits	X-ray	2.70Å	0.30	0.12	FAD-dependent pyridine nucleotide-disulfide oxidoreductase
3vrd.1.B	17.14	hetero-oligomer	HHblits	X-ray	1.50Å	0.30	0.12	Flavocytochrome c flavin subunit
4d67.1.1	8.33	hetero-oligomer	HHblits	EM	9.00Å	0.26	0.13	60S RIBOSOMAL PROTEIN L30
3j92.1.1	8.33	hetero-oligomer	HHblits	EM	NA	0.26	0.13	eL30
3j7o.1.4	8.33	hetero-oligomer	HHblits	EM	3.50Å	0.26	0.13	Ribosomal protein eL30
5t2c.43.A	8.33	monomer	HHblits	EM	NA	0.26	0.13	60S ribosomal protein L30
4ug0.28.A	8.33	monomer	HHblits	EM	NA	0.26	0.13	60S RIBOSOMAL PROTEIN L30
4v6x.63.A	8.33	monomer	HHblits	EM	NA	0.26	0.13	60S ribosomal protein L30
4v5z.48.A	8.33	monomer	HHblits	EM	NA	0.26	0.13	60S Ribosomal protein L30e
5lks.28.A	8.33	monomer	HHblits	EM	NA	0.26	0.13	60S ribosomal protein L30
5aj0.29.A	8.33	monomer	HHblits	EM	3.50Å	0.26	0.13	60S ribosomal protein L30
5lzz.28.A	8.33	monomer	HHblits	EM	3.47Å	0.26	0.13	eL30
4mg4.1.A	14.29	homo-dimer	HHblits	X-ray	1.70Å	0.25	0.12	Phosphonomutase
4mg4.2.B	14.29	homo-dimer	HHblits	X-ray	1.70Å	0.25	0.12	Phosphonomutase
1nvm.1.B	12.12	hetero-oligomer	HHblits	X-ray	1.70Å	0.29	0.11	acetaldehyde dehydrogenase (acylating)
1nvm.2.B	12.12	hetero-oligomer	HHblits	X-ray	1.70Å	0.29	0.11	acetaldehyde dehydrogenase (acylating)
4pg4.1.B	15.63	homo-dimer	HHblits	X-ray	2.20Å	0.30	0.11	Homoserine dehydrogenase
4pg4.1.A	15.63	homo-dimer	HHblits	X-ray	2.20Å	0.30	0.11	Homoserine dehydrogenase
4pg7.1.A	15.63	homo-dimer	HHblits	X-ray	2.10Å	0.30	0.11	Homoserine dehydrogenase
5kmp.1.A	29.03	homo-dimer	HHblits	X-ray	3.20Å	0.32	0.11	FAD-dependent pyridine nucleotide-disulfide oxidoreductase
2e4z.1.A	6.25	homo-dimer	HHblits	X-ray	3.30Å	0.27	0.11	Metabotropic glutamate receptor 7
1fcd.1.A	20.00	hetero-oligomer	HHblits	X-ray	2.53Å	0.32	0.10	FLAVOCYTOCHROME C SULFIDE DEHYDROGENASE (FLAVIN-BINDING SUBUNIT)
1fcd.2.A	20.00	hetero-oligomer	HHblits	X-ray	2.53Å	0.32	0.10	FLAVOCYTOCHROME C SULFIDE DEHYDROGENASE (FLAVIN-BINDING SUBUNIT)
2vdc.1.G	20.69	hetero-oligomer	HHblits	EM	9.50Å	0.34	0.10	GLUTAMATE SYNTHASE [NADPH] SMALL CHAIN
5u1o.1.A	31.03	homo-dimer	HHblits	X-ray	2.31Å	0.34	0.10	Glutathione reductase
1glg.1.A	9.68	monomer	HHblits	X-ray	2.00Å	0.28	0.11	GALACTOSE/GLUCOSE-BINDING PROTEIN
2qw1.1.A	9.68	monomer	HHblits	X-ray	1.70Å	0.28	0.11	D-galactose-binding periplasmic protein
2fvy.1.A	9.68	monomer	HHblits	X-ray	0.92Å	0.28	0.11	D-galactose-binding periplasmic protein
3tjx.1.A	6.25	homo-dimer	HHblits	X-ray	1.64Å	0.24	0.11	Dihydroorotate dehydrogenase
5kzn.1.A	6.45	monomer	HHblits	X-ray	2.80Å	0.26	0.11	Metabotropic glutamate receptor 2
5kzq.1.A	6.45	monomer	HHblits	X-ray	2.80Å	0.26	0.11	Metabotropic glutamate receptor 2
1gub.1.A	3.23	monomer	HHblits	X-ray	3.10Å	0.23	0.11	D-ALLOSE-BINDING PERIPLASMIC PROTEIN
1gud.1.A	3.23	monomer	HHblits	X-ray	1.71Å	0.23	0.11	D-ALLOSE-BINDING PERIPLASMIC PROTEIN
1gud.2.A	3.23	monomer	HHblits	X-ray	1.71Å	0.23	0.11	D-ALLOSE-BINDING PERIPLASMIC PROTEIN
1rpj.1.A	3.23	monomer	HHblits	X-ray	1.80Å	0.23	0.11	PROTEIN (PRECURSOR OF PERIPLASMIC SUGAR RECEPTOR)
5u63.1.A	26.92	homo-dimer	HHblits	X-ray	1.99Å	0.32	0.09	Thioredoxin reductase
5bra.1.A	11.54	monomer	HHblits	X-ray	2.97Å	0.30	0.09	Putative periplasmic binding protein with substrate ribose
2whd.1.A	23.08	homo-dimer	HHblits	X-ray	2.60Å	0.30	0.09	THIOREDOXIN REDUCTASE
3p94.1.A	7.41	monomer	HHblits	X-ray	1.93Å	0.25	0.09	GDSL-like Lipase
2iz1.1.B	26.09	homo-dimer	HHblits	X-ray	2.30Å	0.37	0.08	6-PHOSPHOGLUCONATE DEHYDROGENASE, DECARBOXYLATING
2iz1.1.A	26.09	homo-dimer	HHblits	X-ray	2.30Å	0.37	0.08	6-PHOSPHOGLUCONATE DEHYDROGENASE, DECARBOXYLATING
3fwn.1.A	26.09	homo-dimer	HHblits	X-ray	1.50Å	0.36	0.08	6-phosphogluconate dehydrogenase, decarboxylating
3fwn.1.B	26.09	homo-dimer	HHblits	X-ray	1.50Å	0.36	0.08	6-phosphogluconate dehydrogenase, decarboxylating
2zya.1.A	26.09	homo-dimer	HHblits	X-ray	1.60Å	0.36	0.08	6-phosphogluconate dehydrogenase, decarboxylating
2zya.1.B	26.09	homo-dimer	HHblits	X-ray	1.60Å	0.36	0.08	6-phosphogluconate dehydrogenase, decarboxylating
1tm2.1.A	16.67	monomer	HHblits	X-ray	1.90Å	0.32	0.08	sugar transport protein
1tjy.1.A	16.67	monomer	HHblits	X-ray	1.30Å	0.32	0.08	sugar transport protein
2jkv.1.A	21.74	homo-dimer	HHblits	X-ray	2.53Å	0.35	0.08	6-PHOSPHOGLUCONATE DEHYDROGENASE, DECARBOXYLATING
4y9t.1.A	8.00	monomer	HHblits	X-ray	1.80Å	0.29	0.09	ABC transporter, solute binding protein
3d02.1.A	4.00	monomer	HHblits	X-ray	1.30Å	0.28	0.09	Putative LACI-type transcriptional regulator
3itj.1.A	20.83	homo-dimer	HHblits	X-ray	2.40Å	0.31	0.08	Thioredoxin reductase 1
3itj.1.B	20.83	homo-dimer	HHblits	X-ray	2.40Å	0.31	0.08	Thioredoxin reductase 1
3itj.2.B	20.83	homo-dimer	HHblits	X-ray	2.40Å	0.31	0.08	Thioredoxin reductase 1
4evs.1.A	3.85	monomer	HHblits	X-ray	1.45Å	0.23	0.09	PUTATIVE ABC TRANSPORTER SUBUNIT, SUBSTRATE-BINDING COMPONENT
3lkv.1.A	20.83	homo-dimer	HHblits	X-ray	2.20Å	0.28	0.08	uncharacterized CONSERVED DOMAIN PROTEIN
2fn9.1.A	13.04	monomer	HHblits	X-ray	1.40Å	0.32	0.08	ribose ABC transporter, periplasmic ribose-binding protein
2fn9.2.A	13.04	monomer	HHblits	X-ray	1.40Å	0.32	0.08	ribose ABC transporter, periplasmic ribose-binding protein
4zjp.1.A	16.67	monomer	HHblits	X-ray	1.63Å	0.28	0.08	Monosaccharide-transporting ATPase
2ipn.1.A	8.33	monomer	HHblits	X-ray	1.15Å	0.28	0.08	D-galactose-binding periplasmic protein
4b63.1.A	12.50	homo-tetramer	HHblits	X-ray	1.90Å	0.28	0.08	L-ORNITHINE N5 MONOOXYGENASE
5vt3.1.A	27.27	homo-dimer	HHblits	X-ray	1.98Å	0.34	0.08	Thioredoxin reductase
2gx6.1.A	12.50	monomer	HHblits	X-ray	1.97Å	0.26	0.08	D-ribose-binding periplasmic protein
2hph.1.A	8.70	monomer	HHblits	X-ray	1.33Å	0.28	0.08	D-galactose-binding periplasmic protein
2ipl.1.A	8.70	monomer	HHblits	X-ray	1.20Å	0.28	0.08	D-galactose-binding periplasmic protein
1dbp.1.A	17.39	monomer	HHblits	X-ray	2.20Å	0.28	0.08	D-RIBOSE-BINDING PROTEIN
4ry9.1.A	13.04	monomer	HHblits	X-ray	1.40Å	0.28	0.08	Periplasmic binding protein/LacI transcriptional regulator
2vk2.1.A	18.18	monomer	HHblits	X-ray	1.20Å	0.31	0.08	ABC TRANSPORTER PERIPLASMIC-BINDING PROTEIN YTFQ
2w8z.1.A	30.00	homo-dimer	HHblits	X-ray	2.30Å	0.36	0.07	6-PHOSPHOGLUCONATE DEHYDROGENASE, DECARBOXYLATING
2iyo.1.A	25.00	homo-dimer	HHblits	X-ray	2.40Å	0.36	0.07	6-PHOSPHOGLUCONATE DEHYDROGENASE, DECARBOXYLATING
4zpj.1.A	18.18	monomer	HHblits	X-ray	2.24Å	0.28	0.08	Extracellular ligand-binding receptor
4n0q.1.A	14.29	monomer	HHblits	X-ray	2.30Å	0.31	0.07	Leu/Ile/Val-binding protein homolog 3
1usi.1.A	23.81	monomer	HHblits	X-ray	1.80Å	0.31	0.07	LEUCINE-SPECIFIC BINDING PROTEIN
1usg.1.A	23.81	homo-dimer	HHblits	X-ray	1.53Å	0.31	0.07	LEUCINE-SPECIFIC BINDING PROTEIN
3tq0.1.A	8.70	homo-dimer	HHblits	X-ray	1.90Å	0.23	0.08	Dihydroorotate dehydrogenase
3l49.1.A	14.29	monomer	HHblits	X-ray	2.30Å	0.30	0.07	ABC sugar (Ribose) transporter, periplasmic substrate-binding subunit
4wt7.1.A	30.00	monomer	HHblits	X-ray	2.00Å	0.31	0.07	ABC transporter substrate binding protein (Ribose)
2liv.1.A	25.00	monomer	HHblits	X-ray	2.40Å	0.31	0.07	LEUCINE
3tri.1.A	15.00	homo-dimer	HHblits	X-ray	2.50Å	0.29	0.07	Pyrroline-5-carboxylate reductase
3tri.1.B	15.00	homo-dimer	HHblits	X-ray	2.50Å	0.29	0.07	Pyrroline-5-carboxylate reductase
4ry0.1.A	10.00	monomer	HHblits	X-ray	1.40Å	0.29	0.07	Probable ribose ABC transporter, substrate-binding protein
1z16.1.A	26.32	monomer	HHblits	X-ray	1.72Å	0.31	0.07	Leu/Ile/Val-binding protein
1z15.1.A	26.32	monomer	HHblits	X-ray	1.70Å	0.31	0.07	Leu/Ile/Val-binding protein
3bbl.1.A	15.00	homo-dimer	HHblits	X-ray	2.35Å	0.24	0.07	Regulatory protein of LacI family
2x7x.1.A	23.53	homo-dimer	HHblits	X-ray	2.64Å	0.35	0.06	SENSOR PROTEIN
3ipc.1.A	11.11	monomer	HHblits	X-ray	1.30Å	0.30	0.06	ABC transporter, substrate binding protein (Amino acid)
3cr7.1.A	29.41	homo-dimer	HHblits	X-ray	2.50Å	0.33	0.06	Adenylyl-sulfate kinase
3cr7.1.B	29.41	homo-dimer	HHblits	X-ray	2.50Å	0.33	0.06	Adenylyl-sulfate kinase
1me9.1.A	11.76	homo-tetramer	HHblits	X-ray	2.20Å	0.29	0.06	INOSINE-5'-MONOPHOSPHATE DEHYDROGENASE
1meh.1.A	11.76	homo-tetramer	HHblits	X-ray	1.95Å	0.29	0.06	INOSINE-5'-MONOPHOSPHATE DEHYDROGENASE
4irx.1.A	12.50	monomer	HHblits	X-ray	1.45Å	0.24	0.06	Sugar ABC transporter, periplasmic sugar-binding protein