SWISS-MODEL | Workspace | Model Results

SWISS-MODEL Homology Modelling Report

Model Building Report

This document lists the results for the homology modelling project "Q838A4-MurE-E-faecalis" submitted to SWISS-MODEL workspace on Oct. 17, 2017, 6:22 p.m..The submitted primary amino acid sequence is given in Table T1.

If you use any results in your research, please cite the relevant publications:

Marco Biasini; Stefan Bienert; Andrew Waterhouse; Konstantin Arnold; Gabriel Studer; Tobias Schmidt; Florian Kiefer; Tiziano Gallo Cassarino; Martino Bertoni; Lorenza Bordoli; Torsten Schwede. (2014). SWISS-MODEL: modelling protein tertiary and quaternary structure using evolutionary information. Nucleic Acids Research (1 July 2014) 42 (W1): W252-W258; doi: 10.1093/nar/gku340.
Arnold, K., Bordoli, L., Kopp, J. and Schwede, T. (2006) The SWISS-MODEL workspace: a web-based environment for protein structure homology modelling. Bioinformatics, 22, 195-201.
Benkert, P., Biasini, M. and Schwede, T. (2011) Toward the estimation of the absolute quality of individual protein structure models. Bioinformatics, 27, 343-350

Results

The SWISS-MODEL template library (SMTL version 2017-10-11, PDB release 2017-10-06) was searched with Blast (Altschul et al., 1997) and HHBlits (Remmert, et al., 2011) for evolutionary related structures matching the target sequence in Table T1. For details on the template search, see Materials and Methods. Overall 384 templates were found (Table T2).

Models

The following models were built (see Materials and Methods "Model Building"):

Model #01	File	Built with	Oligo-State	Ligands	GMQE	QMEAN
	PDB	ProMod3 Version 1.0.2.	MONOMER	1 x MG: MAGNESIUM ION;	0.64	-4.54

QMEAN	-4.54
Cβ	-2.58
All Atom	-2.27
Solvation	-1.02
Torsion	-3.81

Template	Seq Identity	Oligo-state	Found by	Method	Resolution	Seq Similarity	Range	Coverage	Description
2wtz.1.A	30.17	monomer	HHblits	X-ray	3.00Å	0.35	1 - 506	0.93	UDP-N-ACETYLMURAMOYL-L-ALANYL-D-GLUTAMATE--2,6-DIAMINOPIMELATE LIGASE

Ligand	Added to Model	Description
MG	✓	MAGNESIUM ION
UAG	✕ - Binding site not conserved.	URIDINE-5'-DIPHOSPHATE-N-ACETYLMURAMOYL-L-ALANINE-D-GLUTAMATE

Target    MTISLFAIRDCLE----KEDLLKEFISPEGWHLTLSDTLGQREVTALSYDSRDVTAETLFFC-KGLNFK-EIYLENAVKD
2wtz.1.A  VGVRLAALADQVGAALAEG-PAQRA-V-------TE----DRTVTGVTLRAQDVSPGDLFAALTGSTTHGARHVGDAIAR

Target    GLEIYVSEVPY-EV----PAQLGIIVTDIKKAMAVLSMAFYDYPQNKLKLIGFTGTKGKTTAAYFTKYILDVATQQKTAL
2wtz.1.A  GAVAVLTDPAGVAEIAGRAAVPVLVHPAPRGVLGGLAATVYGHPSERLTVIGITGTSGKTTTTYLVEAGLRA-AGRVAGL

Target    LSTMNSTLDGKTFFKSALTTPESLDLYRMMATAVANGMTHFIMEVSSQAYKTNRVYKLFFDVGIFLNITPDHISPIEHPT
2wtz.1.A  IGTIGIRVGGADL-PSALTTPEAPTLQAMLAAMVERGVDTVVMEVSSHALALGRVDGTRFAVGAFTNLSRDHLD--FHPS

Target    FDDYFYCKRQLITHS-----KVIVLNHEADYFPLLKETAQQQKVPAIVYGS-QPAPEVDYSFAV---SSEDSLRFIVESP
2wtz.1.A  MADYFEAKASLFDPDSALRARTAVVCIDDDAGRAMAARA----ADAITVSAADR--PAHWRATDVAPTDAGGQQFTAIDP

Target    ADALGLAG-SYHLRLGGDFNKGNALSAAIASVLVGASKEECQQGIAATT-VPGRMESLTNTNGATVYVDYAHNYDSLKNL
2wtz.1.A  AG----VGHHIGIRLPGRYNVANCLVALAILDTVGVSPEQAVPGLRE-IRVPGRLEQIDRGQGFLALVDYAHKPEALRSV

Target    LTFVREEHPDGRLIVLVGSTGDKAISRRKDFGRVLSELADVAVLTTDDPASEDPAKICQEIQAHITKEM---PVYTVLDR
2wtz.1.A  LTTLAH--PDRRLAVVFGAGGDRDPGKRAPMGRIAAQLADLVVVTDDNPRDEDPTAIRREILAGAAEVGGDAQVVEIADR

Target    GEAIAHALSLSTTADDAIVLAGKGADLYQKVNGVDEPYAGDFALAEAFINKKN
2wtz.1.A  RDAIRHAVAW-ARPGDVVLIAGKGHETGQRGGGRVRPF-DDRVELAAALEA--

Model #02	File	Built with	Oligo-State	Ligands	GMQE	QMEAN
	PDB	ProMod3 Version 1.0.2.	MONOMER	1 x MG: MAGNESIUM ION;	0.63	-3.68

QMEAN	-3.68
Cβ	-2.13
All Atom	-1.33
Solvation	-0.50
Torsion	-3.22

Template	Seq Identity	Oligo-state	Found by	Method	Resolution	Seq Similarity	Range	Coverage	Description
4bub.2.A	32.00	monomer	HHblits	X-ray	2.90Å	0.35	37 - 507	0.89	UDP-N-ACETYLMURAMOYL-L-ALANYL-D-GLUTAMATE--LD-LYSINE LIGASE

Ligand	Added to Model	Description
MG	✓	MAGNESIUM ION
ADP	✕ - Binding site not conserved.	ADENOSINE-5'-DIPHOSPHATE

Target    MTISLFAIRDCLEKEDLLKEFISPEGWHLTLSDTLGQREVTALSYDSRDVTAETLFFC-KGLNFK-EIYLENAVKDGLEI
4bub.2.A  ------------------------------------DLEITGVSNHSSKVKKGDLFICRRGEKFDSHEIIPEVMEKGAVA

Target    YVSEVPYEVPAQLGIIVTDIKKAMAVLSMAFYDYPQNKLKLIGFTGTKGKTTAAYFTKYILDVATQQKTALLSTMNSTLD
4bub.2.A  VVVEREID-LDFPYIQVFDSRYFEAKVASLFFEDPWKDVLTFGVTGTNGKTTTTMMIYHMLTS-LGERGSVLTTAVKRIL

Target    GKTFFKSALTTPESLDLYRMMATAVANGMTHFIMEVSSQAYKTNRVYKLFFDVGIFLNITPDHISPIEHPTFDDYFYCKR
4bub.2.A  GNSY-YDDITTPDAITILSAMKENREGGGKFFALEVSSHALVQQRVEGVRFDVGIFTNISRDHLD--FHGTFENYLKAKL

Target    QLITH---SKVIVLNHEADYFPLLKETAQQQKVPAIVYGSQPAPEVDYSFAV--SSEDSLRFIVESPADALGLAGSYHLR
4bub.2.A  HLFDLLKDDGVAVLNES--LADAFNR--K---SRKITFGTSK--NADYRLGNIEVSWEGTQFVLETPDG----LLKVFTR

Target    LGGDFNKGNALSAAIASVLVGASKEECQQGIAATT-VPGRMESLTN--TNGATVYVDYAHNYDSLKNLLTFVREEHPDGR
4bub.2.A  AIGDFNAYNAAAAIAALHQLGYDPKDLASSLETFTGVEGRFEVVRGAKKIGLNVVVDFAHSPDALEKLLKNVR-KISQGR

Target    LIVLVGSTGDKAISRRKDFGRVLSELADVAVLTTDDPASEDPAKICQEIQAHITKEMPVYTVLDRGEAIAHALSLSTTAD
4bub.2.A  VIVVFGAGGNSDRGKRPMMSEVASKLADVVILTTDDPRGEDPEQIMEDLIKGIDKRKPYLVLFDRREAIETALTI-ANRG

Target    DAIVLAGKGADLYQKVNG-VDEPYAGDFALAEAFINKKN
4bub.2.A  DSVVIAGRGHERYQIIDEEKKVPF-QDREVVEEIIRDK-

Model #03	File	Built with	Oligo-State	Ligands	GMQE	QMEAN
	PDB	ProMod3 Version 1.0.2.	MONOMER	None	0.52	-6.84

QMEAN	-6.84
Cβ	-4.98
All Atom	-3.53
Solvation	-2.20
Torsion	-5.42

Template	Seq Identity	Oligo-state	Found by	Method	Resolution	Seq Similarity	Range	Coverage	Description
2am2.1.A	18.08	monomer	HHblits	X-ray	2.80Å	0.30	1 - 486	0.84	UDP-N-acetylmuramoylalanine-D-glutamyl-lysine-D-alanyl-D-alanine ligase, MurF protein

Ligand	Added to Model	Description
2LG	✕ - Binding site not conserved.	2-CHLORO-N-(3-CYANO-5,6-DIHYDRO-4H-CYCLOPENTA[B]THIOPHEN-2-YL)-5-DIETHYLSULFAMOYL-BENZAMIDE

Target    MTISLFAIRDCLEKEDLLKEFISPEGWHLTLSDTLGQREVTALSYDSRDVTAETLFFC-KGLNFK-EIYLENAVKDGLEI
2am2.1.A  MKLTIHEIAQVVGAKNDI-S--I-------FE----DTQLEKAEFDSRLIGTGDLFVPLKGA-RDGHDFIETAFENGAAV

Target    YVSEVPYEVPAQLGIIVTDIKKAMAVLSMAFYDYPQNKLKLIGFTGTKGKTTAAYFTKYILDVATQQKTALLSTMNSTLD
2am2.1.A  TLSEKEVS--NHPYILVDDVLTAFQSLASYYLEKT--TVDVFAVTGSNGKTTTKDMLAHLLST-RYKT---YKTQGNY--

Target    GKTFFKSALTTPESLDLYRMMATAVANGMTHFIMEVSSQA-YKTN-RVYKLFFDVGIFLNITPDHISPIEHPTFDDYFYC
2am2.1.A  -----NNEIGLPYT--VLH-----MPEGTEKLVLEMGQDHLGDIHLLSELARPKTAIVTLVGEAHLA--FFKDRSEIAKG

Target    KRQLIT---HSKVIVLNHEADYFPLLKETAQQQKVPAIVYGSQPAPEVDY-SFAVSSEDSLRFIVESPADALGLAGSYHL
2am2.1.A  KMQIADGMASGSLLLAPADPIVE-DYLP-I---DKKVVRFGQGA--ELEITDLVERK-DSLTFKANFL-E----Q-ALDL

Target    RLGGDFNKGNALSAAIASVLVGASKEECQQGIAATT-VPGRMESLTNTNGATVYVD-YAHNYDSLKNLLTFVREEH--PD
2am2.1.A  PVTGKYNATNAMIASYVALQEGVSEEQIRLAFQHLELTRNRTEWKKAANGADILSDVYNANPTAMKLILETFSAIPANEG

Target    GRLIVLVGST---GDKAISRRKDFGRVLSEL-ADVAVLTTDDPASEDPAKICQEIQAHITKEMPVYTVLD------RGEA
2am2.1.A  GKKIAVLADMKELGDQSVQLHNQMILSLSPDVLDIVIFYGED-----IAQLAQLASQMFP-IGHVYYFKKTEDQDQFEDL

Target    IAHALSLSTTADDAIVLAGKGADLYQKVNGVDEPYAGDFALAEAFINKKN
2am2.1.A  VKQVKES-LGAHDQILLKGSNSMNLAKL----------------------

Model #04	File	Built with	Oligo-State	Ligands	GMQE	QMEAN
	PDB	ProMod3 Version 1.0.2.	MONOMER	None	0.43	-8.38

QMEAN	-8.38
Cβ	-4.72
All Atom	-4.24
Solvation	-3.08
Torsion	-7.05

Template	Seq Identity	Oligo-state	Found by	Method	Resolution	Seq Similarity	Range	Coverage	Description
1eeh.1.A	17.41	monomer	HHblits	X-ray	1.90Å	0.29	43 - 484	0.75	UDP-N-ACETYLMURAMOYL-L-ALANINE:D-GLUTAMATE LIGASE

Ligand	Added to Model	Description
UMA	✕ - Binding site not conserved.	URIDINE-5'-DIPHOSPHATE-N-ACETYLMURAMOYL-L-ALANINE

Target    MTISLFAIRDCLEKEDLLKEFISPEGWHLTLSDTLGQREVTALSYDSRDVTAETLFFCKGLNF--K-EIYLENAVKDGLE
1eeh.1.A  ------------------------------------------RVMDTRMTPPGLDKLPEAVERHTGSLN--DE-WLMAAD

Target    IYVSEVPYEVPAQLGIIVTD--IKKAMAVLSMAFYDYPQNKLKLIGFTGTKGKTTAAYFTKYILDVATQQKTALLSTMNS
1eeh.1.A  LIVASPGIA-LAHPSLSAAADAGIEIVGDIELFCR---EAQAPIVAITGSNGKSTVTTLVGEMAKA-AGVNVGVGGN---

Target    TLDGKTFFKSALTTPESLDLYRMMATAVANGMTHFIMEVSSQAYKTNRVYKLFFDVGIFLNITPDHISPIEHP-TFDDYF
1eeh.1.A  -----------IGLPAL-M-------LLDDECELYVLELSSFQ--LETTSSLQAVAATILNVTEDHMD--RYPFGLQQYR

Target    YCKRQLITHSKVIVLNHEADYFPLLKETAQQQKVPAIVYGSQPAPEVDYSFAVSSEDSLRFIVESPADALGLAGSYHLRL
1eeh.1.A  AAKLRIYENAKVCVVNADDALTMPIRG----ADERCVSFGVNM---GDYHLNHQQGETW-LRV--KGEK--VLNVKEMKL

Target    GGDFNKGNALSAAIASVLVGASKEECQQGIAATT-VPGRMESLTNTNGATVYVDY-AHNYDSLKNLLTFVREEHPDGRLI
1eeh.1.A  SGQHNYTNALAALALADAAGLPRASSLKALTTFTGLPHRFEVVLEHNGVRWINDSKATNVGSTEAALNGLH--V-DGTLH

Target    VLVGSTGDKAISRRKDFGRVLSELADVAVLTTDDPASEDPAKICQEIQAHITKEMPVYTVLDRGEAIAHALSLSTTADDA
1eeh.1.A  LLLGGDG-KSAD-FSPLARYLNGDNVRLYCFGRD-----GAQLAALRPE------VAEQTETMEQAMRLLAPR-VQPGDM

Target    IVLAGKGADLYQKVNGVDEPYAGDFALAEAFINKKN
1eeh.1.A  VLLSPACASLDQ------------------------

Materials and Methods

Template Search

Template search with Blast and HHBlits has been performed against the SWISS-MODEL template library (SMTL, last update: 2017-10-11, last included PDB release: 2017-10-06).

The target sequence was searched with BLAST (Altschul et al., 1997) against the primary amino acid sequence contained in the SMTL. A total of 6 templates were found.

An initial HHblits profile has been built using the procedure outlined in (Remmert, et al., 2011), followed by 1 iteration of HHblits against NR20. The obtained profile has then be searched against all profiles of the SMTL. A total of 380 templates were found.

Template Selection

For each identified template, the template's quality has been predicted from features of the target-template alignment. The templates with the highest quality have then been selected for model building.

Model Building

Models are built based on the target-template alignment using ProMod3. Coordinates which are conserved between the target and the template are copied from the template to the model. Insertions and deletions are remodelled using a fragment library. Side chains are then rebuilt. Finally, the geometry of the resulting model is regularized by using a force field. In case loop modelling with ProMod3 fails, an alternative model is built with PROMOD-II (Guex, et al., 1997).

Model Quality Estimation

The global and per-residue model quality has been assessed using the QMEAN scoring function (Benkert, et al., 2011) . For improved performance, weights of the individual QMEAN terms have been trained specifically for SWISS-MODEL.

Ligand Modelling

Ligands present in the template structure are transferred by homology to the model when the following criteria are met (Gallo -Casserino, to be published): (a) The ligands are annotated as biologically relevant in the template library, (b) the ligand is in contact with the model, (c) the ligand is not clashing with the protein, (d) the residues in contact with the ligand are conserved between the target and the template. If any of these four criteria is not satisfied, a certain ligand will not be included in the model. The model summary includes information on why and which ligand has not been included.

Oligomeric State Conservation

Homo-oligomeric structure of the target protein is predicted based on the analysis of pairwise interfaces of the identified template structures. For each relevant interface between polypeptide chains (interfaces with more than 10 residue-residue interactions), the QscoreOligomer (Mariani et al., 2011) is predicted from features such as similarity to target and frequency of observing this interface in the identified templates (Kiefer, Bertoni, Biasini, to be published). The prediction is performed with a random forest regressor using these features as input parameters to predict the probability of conservation for each interface. The QscoreOligomer of the whole complex is then calculated as the weight-averaged QscoreOligomer of the interfaces. The oligomeric state of the target is predicted to be the same as in the template when QscoreOligomer is predicted to be higher or equal to 0.5.

References

Altschul, S.F., Madden, T.L., Schaffer, A.A., Zhang, J., Zhang, Z., Miller, W. and Lipman, D.J. (1997) Gapped BLAST and PSI-BLAST: a new generation of protein database search programs. Nucleic Acids Res, 25, 3389-3402.
Remmert, M., Biegert, A., Hauser, A. and Soding, J. (2012) HHblits: lightning-fast iterative protein sequence searching by HMM-HMM alignment. Nat Methods, 9, 173-175.
Guex, N. and Peitsch, M.C. (1997) SWISS-MODEL and the Swiss-PdbViewer: an environment for comparative protein modeling. Electrophoresis, 18, 2714-2723.
Sali, A. and Blundell, T.L. (1993) Comparative protein modelling by satisfaction of spatial restraints. J Mol Biol, 234, 779-815.
Benkert, P., Biasini, M. and Schwede, T. (2011) Toward the estimation of the absolute quality of individual protein structure models. Bioinformatics, 27, 343-350.
Mariani, V., Kiefer, F., Schmidt, T., Haas, J. and Schwede, T. (2011) Assessment of template based protein structure predictions in CASP9. Proteins, 79 Suppl 10, 37-58.

Table T1:

Primary amino acid sequence for which templates were searched and models were built.

MTISLFAIRDCLEKEDLLKEFISPEGWHLTLSDTLGQREVTALSYDSRDVTAETLFFCKGLNFKEIYLENAVKDGLEIYVSEVPYEVPAQLGIIVTDIKK
AMAVLSMAFYDYPQNKLKLIGFTGTKGKTTAAYFTKYILDVATQQKTALLSTMNSTLDGKTFFKSALTTPESLDLYRMMATAVANGMTHFIMEVSSQAYK
TNRVYKLFFDVGIFLNITPDHISPIEHPTFDDYFYCKRQLITHSKVIVLNHEADYFPLLKETAQQQKVPAIVYGSQPAPEVDYSFAVSSEDSLRFIVESP
ADALGLAGSYHLRLGGDFNKGNALSAAIASVLVGASKEECQQGIAATTVPGRMESLTNTNGATVYVDYAHNYDSLKNLLTFVREEHPDGRLIVLVGSTGD
KAISRRKDFGRVLSELADVAVLTTDDPASEDPAKICQEIQAHITKEMPVYTVLDRGEAIAHALSLSTTADDAIVLAGKGADLYQKVNGVDEPYAGDFALA
EAFINKKN

Table T2:

Template	Seq Identity	Oligo-state	Found by	Method	Resolution	Seq Similarity	Coverage	Description
2xja.1.A	30.17	monomer	HHblits	X-ray	3.00Å	0.35	0.93	UDP-N-ACETYLMURAMOYL-L-ALANYL-D-GLUTAMATE--2,6-DIAMINOPIMELATE LIGASE
2wtz.1.A	30.17	monomer	HHblits	X-ray	3.00Å	0.35	0.93	UDP-N-ACETYLMURAMOYL-L-ALANYL-D-GLUTAMATE--2,6-DIAMINOPIMELATE LIGASE
4bub.1.A	32.00	monomer	HHblits	X-ray	2.90Å	0.35	0.89	UDP-N-ACETYLMURAMOYL-L-ALANYL-D-GLUTAMATE--LD-LYSINE LIGASE
4bub.2.A	32.00	monomer	HHblits	X-ray	2.90Å	0.35	0.89	UDP-N-ACETYLMURAMOYL-L-ALANYL-D-GLUTAMATE--LD-LYSINE LIGASE
4c12.1.A	28.95	homo-dimer	BLAST	X-ray	1.80Å	0.35	0.88	UDP-N-ACETYLMURAMOYL-L-ALANYL-D-GLUTAMATE--L-LYSINE LIGASE
4c12.1.A	28.19	homo-dimer	HHblits	X-ray	1.80Å	0.34	0.89	UDP-N-ACETYLMURAMOYL-L-ALANYL-D-GLUTAMATE--L-LYSINE LIGASE
2xja.1.A	31.97	monomer	BLAST	X-ray	3.00Å	0.36	0.87	UDP-N-ACETYLMURAMOYL-L-ALANYL-D-GLUTAMATE--2,6-DIAMINOPIMELATE LIGASE
2wtz.1.A	31.97	monomer	BLAST	X-ray	3.00Å	0.36	0.87	UDP-N-ACETYLMURAMOYL-L-ALANYL-D-GLUTAMATE--2,6-DIAMINOPIMELATE LIGASE
1e8c.1.A	26.54	monomer	HHblits	X-ray	2.00Å	0.33	0.90	UDP-N-ACETYLMURAMOYLALANYL-D-GLUTAMATE--2,6-DIAMINOPIMELATE LIGASE
4bub.1.A	34.11	monomer	BLAST	X-ray	2.90Å	0.37	0.84	UDP-N-ACETYLMURAMOYL-L-ALANYL-D-GLUTAMATE--LD-LYSINE LIGASE
4bub.2.A	34.11	monomer	BLAST	X-ray	2.90Å	0.37	0.84	UDP-N-ACETYLMURAMOYL-L-ALANYL-D-GLUTAMATE--LD-LYSINE LIGASE
1e8c.1.A	31.24	monomer	BLAST	X-ray	2.00Å	0.35	0.84	UDP-N-ACETYLMURAMOYLALANYL-D-GLUTAMATE--2,6-DIAMINOPIMELATE LIGASE
2am2.1.A	18.08	monomer	HHblits	X-ray	2.80Å	0.30	0.84	UDP-N-acetylmuramoylalanine-D-glutamyl-lysine-D-alanyl-D-alanine ligase, MurF protein
3zm5.1.A	18.20	monomer	HHblits	X-ray	2.94Å	0.30	0.83	UDP-N-ACETYLMURAMOYL-TRIPEPTIDE--D-ALANYL-D-ALANINE LIGASE
4cvl.1.A	21.04	monomer	HHblits	X-ray	2.98Å	0.30	0.83	UDP-N-ACETYLMURAMOYL-TRIPEPTIDE--D-ALANYL-D-ALANINE LIGASE
4cvm.1.A	21.04	monomer	HHblits	X-ray	2.06Å	0.30	0.83	UDP-N-ACETYLMURAMOYL-TRIPEPTIDE--D-ALANYL-D- ALANINE LIGASE
4ziy.1.A	19.71	monomer	HHblits	X-ray	1.85Å	0.30	0.83	UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase
4qf5.1.A	19.62	monomer	HHblits	X-ray	2.80Å	0.30	0.82	UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase
4qdi.1.A	19.62	monomer	HHblits	X-ray	1.80Å	0.30	0.82	UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase
1gg4.1.A	18.85	monomer	HHblits	X-ray	2.30Å	0.30	0.82	UDP-N-ACETYLMURAMOYLALANYL-D-GLUTAMYL-2,6-DIAMINOPIMELATE-D-ALANYL-D-ALANYL LIGASE
3zl8.1.A	17.13	monomer	HHblits	X-ray	1.65Å	0.29	0.78	UDP-N-ACETYLMURAMOYL-TRIPEPTIDE--D-ALANYL-D-ALANINE LIGASE
3lk7.1.A	18.32	monomer	HHblits	X-ray	1.50Å	0.30	0.75	UDP-N-acetylmuramoylalanine--D-glutamate ligase
2xpc.1.A	17.41	monomer	HHblits	X-ray	1.49Å	0.29	0.75	UDP-N-ACETYLMURAMOYLALANINE--D-GLUTAMATE LIGASE
1uag.1.A	17.41	monomer	HHblits	X-ray	1.95Å	0.29	0.75	UDP-N-ACETYLMURAMOYL-L-ALANINE/:D-GLUTAMATE LIGASE
1eeh.1.A	17.41	monomer	HHblits	X-ray	1.90Å	0.29	0.75	UDP-N-ACETYLMURAMOYL-L-ALANINE:D-GLUTAMATE LIGASE
2uag.1.A	17.41	monomer	HHblits	X-ray	1.70Å	0.29	0.75	PROTEIN (UDP-N-ACETYLMURAMOYL-L-ALANINE:D-GLUTAMATE LIGASE)
1e0d.1.A	17.41	monomer	HHblits	X-ray	2.40Å	0.29	0.75	UDP-N-ACETYLMURAMOYLALANINE--D-GLUTAMATE LIGASE
5a5e.1.A	17.41	monomer	HHblits	X-ray	1.84Å	0.29	0.75	UDP-N-ACETYLMURAMOYLALANINE--D-GLUTAMATE LIGASE
5a5f.1.A	17.20	monomer	HHblits	X-ray	1.90Å	0.29	0.74	UDP-N-ACETYLMURAMOYLALANINE--D-GLUTAMATE LIGASE
2y67.1.A	17.02	monomer	HHblits	X-ray	1.85Å	0.28	0.74	UDP-N-ACETYLMURAMOYLALANINE--D-GLUTAMATE LIGASE
4buc.1.A	18.63	monomer	HHblits	X-ray	2.17Å	0.29	0.72	UDP-N-ACETYLMURAMOYLALANINE--D-GLUTAMATE LIGASE
4buc.2.A	18.63	monomer	HHblits	X-ray	2.17Å	0.29	0.72	UDP-N-ACETYLMURAMOYLALANINE--D-GLUTAMATE LIGASE
2vor.1.A	19.39	monomer	HHblits	X-ray	2.30Å	0.30	0.71	FOLYLPOLYGLUTAMATE SYNTHASE PROTEIN FOLC
2gcb.1.A	19.03	monomer	HHblits	X-ray	2.30Å	0.29	0.69	Folylpolyglutamate synthase
2gc6.1.A	18.75	monomer	HHblits	X-ray	1.90Å	0.29	0.69	Folylpolyglutamate synthase
2gca.1.A	18.75	monomer	HHblits	X-ray	2.40Å	0.29	0.69	Folylpolyglutamate synthase
1fgs.1.A	19.09	monomer	HHblits	X-ray	2.40Å	0.29	0.69	FOLYLPOLYGLUTAMATE SYNTHETASE
1jbw.1.A	19.09	monomer	HHblits	X-ray	1.85Å	0.29	0.69	FOLYLPOLYGLUTAMATE SYNTHASE
1jbv.1.A	19.09	monomer	HHblits	X-ray	1.95Å	0.29	0.69	FOLYLPOLYGLUTAMATE SYNTHASE
1w7k.1.A	18.52	monomer	HHblits	X-ray	2.10Å	0.29	0.69	FOLC BIFUNCTIONAL PROTEIN
1w78.1.A	18.52	monomer	HHblits	X-ray	1.82Å	0.29	0.69	FOLC BIFUNCTIONAL PROTEIN
2gc5.1.A	18.80	monomer	HHblits	X-ray	1.85Å	0.29	0.69	Folylpolyglutamate synthase
1o5z.1.A	18.47	monomer	HHblits	X-ray	2.10Å	0.29	0.69	folylpolyglutamate synthase/dihydrofolate synthase
3nrs.1.A	17.38	monomer	HHblits	X-ray	1.80Å	0.29	0.69	Dihydrofolate:folylpolyglutamate synthetase
3pyz.1.A	17.38	monomer	HHblits	X-ray	2.10Å	0.29	0.69	Bifunctional folylpolyglutamate synthase/dihydrofolate synthase
3hn7.1.A	18.73	monomer	HHblits	X-ray	1.65Å	0.29	0.68	UDP-N-acetylmuramate-L-alanine ligase
4hv4.1.A	20.12	monomer	HHblits	X-ray	2.25Å	0.29	0.65	UDP-N-acetylmuramate--L-alanine ligase
4hv4.2.A	20.12	monomer	HHblits	X-ray	2.25Å	0.29	0.65	UDP-N-acetylmuramate--L-alanine ligase
1p3d.1.A	18.65	monomer	HHblits	X-ray	1.70Å	0.29	0.64	UDP-N-acetylmuramate--alanine ligase
1gqq.1.A	18.65	homo-dimer	HHblits	X-ray	3.10Å	0.29	0.64	UDP-N-ACETYLMURAMATE-L-ALANINE LIGASE
1gqq.1.B	18.65	homo-dimer	HHblits	X-ray	3.10Å	0.29	0.64	UDP-N-ACETYLMURAMATE-L-ALANINE LIGASE
1p31.1.A	18.65	monomer	HHblits	X-ray	1.85Å	0.29	0.64	UDP-N-acetylmuramate--alanine ligase
1gqy.1.B	18.65	homo-dimer	HHblits	X-ray	1.80Å	0.29	0.64	UDP-N-ACETYLMURAMATE-L-ALANINE LIGASE
1gqy.1.A	18.65	homo-dimer	HHblits	X-ray	1.80Å	0.29	0.64	UDP-N-ACETYLMURAMATE-L-ALANINE LIGASE
2f00.1.A	18.65	homo-dimer	HHblits	X-ray	2.50Å	0.29	0.64	UDP-N-acetylmuramate--L-alanine ligase
1j6u.1.A	18.93	monomer	HHblits	X-ray	2.30Å	0.29	0.62	UDP-N-acetylmuramate-alanine ligase MurC
3eag.1.A	17.60	homo-dimer	HHblits	X-ray	2.55Å	0.28	0.49	UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-meso-diaminopimelate ligase
3eag.1.B	17.60	homo-dimer	HHblits	X-ray	2.55Å	0.28	0.49	UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-meso-diaminopimelate ligase
5vvw.1.A	17.41	homo-tetramer	HHblits	X-ray	2.30Å	0.28	0.40	UDP-N-acetylmuramate--L-alanine ligase
3mvn.1.A	17.89	monomer	HHblits	X-ray	1.90Å	0.31	0.24	UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-medo-diaminopimelate ligase
2obn.1.A	10.08	homo-dimer	HHblits	X-ray	2.30Å	0.25	0.23	Hypothetical protein
2obn.1.B	10.08	homo-dimer	HHblits	X-ray	2.30Å	0.25	0.23	Hypothetical protein
3md0.1.A	18.99	homo-dimer	HHblits	X-ray	2.45Å	0.28	0.16	Arginine/ornithine transport system ATPase
3cio.1.A	17.65	homo-dimer	HHblits	X-ray	2.50Å	0.32	0.10	Tyrosine-protein kinase etk
3cio.1.B	17.65	homo-dimer	HHblits	X-ray	2.50Å	0.32	0.10	Tyrosine-protein kinase etk
1rz3.1.A	16.98	monomer	HHblits	X-ray	1.90Å	0.27	0.10	hypothetical protein RBSTP0775
4c0b.1.A	9.26	hetero-oligomer	HHblits	X-ray	2.77Å	0.25	0.11	MRNA CLEAVAGE AND POLYADENYLATION FACTOR CLP1
2npi.1.A	10.42	hetero-oligomer	HHblits	X-ray	2.95Å	0.25	0.09	Protein CLP1
3kbq.1.A	25.58	homo-dimer	HHblits	X-ray	2.00Å	0.32	0.08	Protein Ta0487
3kbq.1.B	25.58	homo-dimer	HHblits	X-ray	2.00Å	0.32	0.08	Protein Ta0487
3te6.1.A	6.67	monomer	HHblits	X-ray	2.80Å	0.23	0.09	Regulatory protein SIR3
3te6.2.A	6.67	monomer	HHblits	X-ray	2.80Å	0.23	0.09	Regulatory protein SIR3
4f7w.1.B	23.08	homo-dimer	HHblits	X-ray	2.10Å	0.32	0.08	Pantothenate kinase
4f7w.1.A	23.08	homo-dimer	HHblits	X-ray	2.10Å	0.32	0.08	Pantothenate kinase
4f7w.3.A	23.08	homo-dimer	HHblits	X-ray	2.10Å	0.32	0.08	Pantothenate kinase
4f7w.4.B	23.08	homo-dimer	HHblits	X-ray	2.10Å	0.32	0.08	Pantothenate kinase
4ne2.2.A	23.08	homo-dimer	HHblits	X-ray	1.90Å	0.32	0.08	Pantothenate kinase
5b3f.1.A	19.51	homo-dimer	HHblits	X-ray	2.50Å	0.27	0.08	Phosphoribulokinase/uridine kinase
5b3f.1.B	19.51	homo-dimer	HHblits	X-ray	2.50Å	0.27	0.08	Phosphoribulokinase/uridine kinase
1sq5.1.A	23.68	homo-dimer	HHblits	X-ray	2.20Å	0.32	0.07	Pantothenate kinase
3syn.2.A	29.73	hetero-oligomer	HHblits	X-ray	3.06Å	0.34	0.07	Flagellar biosynthesis protein flhF
2px0.1.B	29.73	homo-dimer	HHblits	X-ray	3.00Å	0.34	0.07	Flagellar biosynthesis protein flhF
2px0.3.B	29.73	homo-dimer	HHblits	X-ray	3.00Å	0.34	0.07	Flagellar biosynthesis protein flhF
2px0.4.A	29.73	homo-dimer	HHblits	X-ray	3.00Å	0.34	0.07	Flagellar biosynthesis protein flhF
2px3.1.A	29.73	homo-dimer	HHblits	X-ray	3.20Å	0.34	0.07	Flagellar biosynthesis protein flhF
2px0.1.A	29.73	homo-dimer	HHblits	X-ray	3.00Å	0.34	0.07	Flagellar biosynthesis protein flhF
2g0t.1.A	29.73	homo-dimer	HHblits	X-ray	2.67Å	0.32	0.07	conserved hypothetical protein
5l3s.1.B	27.03	hetero-oligomer	HHblits	X-ray	1.90Å	0.32	0.07	Signal recognition particle receptor FtsY
5l3s.2.B	27.03	hetero-oligomer	HHblits	X-ray	1.90Å	0.32	0.07	Signal recognition particle receptor FtsY
5l3s.3.B	27.03	hetero-oligomer	HHblits	X-ray	1.90Å	0.32	0.07	Signal recognition particle receptor FtsY
5l3s.4.B	27.03	hetero-oligomer	HHblits	X-ray	1.90Å	0.32	0.07	Signal recognition particle receptor FtsY
5l3w.1.A	27.03	monomer	HHblits	X-ray	2.40Å	0.32	0.07	Signal recognition particle receptor FtsY
2p65.1.A	17.95	monomer	HHblits	X-ray	1.70Å	0.27	0.08	Hypothetical protein PF08_0063
4c7o.1.A	21.62	hetero-oligomer	HHblits	X-ray	2.60Å	0.30	0.07	SIGNAL RECOGNITION PARTICLE PROTEIN
4c7o.2.A	21.62	hetero-oligomer	HHblits	X-ray	2.60Å	0.30	0.07	SIGNAL RECOGNITION PARTICLE PROTEIN
5l3s.1.A	27.78	hetero-oligomer	HHblits	X-ray	1.90Å	0.32	0.07	Signal recognition particle 54 kDa protein
5l3s.4.A	27.78	hetero-oligomer	HHblits	X-ray	1.90Å	0.32	0.07	Signal recognition particle 54 kDa protein
1xjc.1.A	15.79	monomer	HHblits	X-ray	2.10Å	0.27	0.07	MobB protein homolog
1p9n.1.A	21.62	homo-dimer	HHblits	X-ray	2.80Å	0.29	0.07	Molybdopterin-guanine dinucleotide biosynthesis protein B
1p9n.1.B	21.62	homo-dimer	HHblits	X-ray	2.80Å	0.29	0.07	Molybdopterin-guanine dinucleotide biosynthesis protein B
1np6.1.A	21.62	homo-dimer	HHblits	X-ray	1.90Å	0.29	0.07	Molybdopterin-guanine dinucleotide biosynthesis protein B
1np6.1.B	21.62	homo-dimer	HHblits	X-ray	1.90Å	0.29	0.07	Molybdopterin-guanine dinucleotide biosynthesis protein B
4ue5.1.D	31.43	hetero-oligomer	HHblits	EM	9.00Å	0.34	0.07	SIGNAL RECOGNITION PARTICLE 54 KDA PROTEIN
2og2.1.A	21.62	monomer	HHblits	X-ray	2.00Å	0.29	0.07	Putative signal recognition particle receptor
1j8m.1.A	27.78	monomer	HHblits	X-ray	2.00Å	0.31	0.07	SIGNAL RECOGNITION 54 KDA PROTEIN
4pfs.1.A	18.92	monomer	HHblits	X-ray	2.30Å	0.29	0.07	Cobyrinic Acid a,c-diamide synthase
4pfs.2.A	18.92	monomer	HHblits	X-ray	2.30Å	0.29	0.07	Cobyrinic Acid a,c-diamide synthase
4ixn.1.A	19.44	homo-dimer	HHblits	X-ray	2.05Å	0.30	0.07	Uncharacterized GTP-binding protein YjiA
3kl4.1.A	28.57	hetero-oligomer	HHblits	X-ray	3.50Å	0.32	0.07	Signal recognition 54 kDa protein
1zu5.1.A	19.44	monomer	HHblits	X-ray	2.40Å	0.30	0.07	ftsY
1zu4.1.A	19.44	monomer	HHblits	X-ray	1.95Å	0.30	0.07	ftsY
5gad.1.7	22.22	hetero-oligomer	HHblits	EM	NA	0.30	0.07	Signal recognition particle protein Ffh
2xxa.1.A	22.22	hetero-oligomer	HHblits	X-ray	3.94Å	0.30	0.07	SIGNAL RECOGNITION PARTICLE PROTEIN
2xxa.2.A	22.22	hetero-oligomer	HHblits	X-ray	3.94Å	0.30	0.07	SIGNAL RECOGNITION PARTICLE PROTEIN
2j28.1.H	22.22	hetero-oligomer	HHblits	EM	8.00Å	0.30	0.07	SIGNAL RECOGNITION PARTICLE 54
5gaf.1.7	22.22	hetero-oligomer	HHblits	EM	NA	0.30	0.07	Signal recognition particle protein
3jaj.45.A	32.35	monomer	HHblits	EM	NA	0.34	0.07	SRP54
3jan.45.A	32.35	monomer	HHblits	EM	NA	0.34	0.07	SRP54
1rj9.1.B	22.22	hetero-oligomer	HHblits	X-ray	1.90Å	0.30	0.07	Signal recognition particle protein
5bwk.1.A	25.71	hetero-oligomer	HHblits	X-ray	6.00Å	0.32	0.07	ATPase GET3
5bw8.1.B	25.71	hetero-oligomer	HHblits	X-ray	2.80Å	0.32	0.07	ATPase GET3
5bw8.1.A	25.71	hetero-oligomer	HHblits	X-ray	2.80Å	0.32	0.07	ATPase GET3
5l3r.1.B	22.22	hetero-oligomer	HHblits	X-ray	2.50Å	0.29	0.07	Cell division protein FtsY homolog, chloroplastic
3b9q.1.A	22.22	monomer	HHblits	X-ray	1.75Å	0.29	0.07	Chloroplast SRP receptor homolog, alpha subunit CPFTSY
5if9.1.A	19.44	monomer	HHblits	X-ray	1.80Å	0.29	0.07	Cobyrinic Acid a,c-diamide synthase
5l3r.1.A	22.22	hetero-oligomer	HHblits	X-ray	2.50Å	0.29	0.07	Signal recognition particle 54 kDa protein, chloroplastic
3bfv.1.A	22.86	monomer	HHblits	X-ray	1.80Å	0.31	0.07	Membrane protein CapA1, Protein tyrosine kinase
4jmp.1.A	22.86	monomer	HHblits	X-ray	1.30Å	0.31	0.07	C-terminal fragment of CapA, Protein tyrosine kinase
3dm9.1.A	22.22	homo-hexamer	HHblits	X-ray	2.20Å	0.29	0.07	Signal recognition particle receptor
3e70.1.A	22.22	monomer	HHblits	X-ray	1.97Å	0.29	0.07	Signal recognition particle receptor
3dmd.1.F	22.22	homo-hexamer	HHblits	X-ray	2.21Å	0.29	0.07	Signal recognition particle receptor
3dmd.1.E	22.22	homo-hexamer	HHblits	X-ray	2.21Å	0.29	0.07	Signal recognition particle receptor
2bek.1.A	29.41	homo-dimer	HHblits	X-ray	1.80Å	0.33	0.07	SEGREGATION PROTEIN
1wcv.1.A	29.41	homo-dimer	HHblits	X-ray	1.60Å	0.33	0.07	SEGREGATION PROTEIN
2bej.1.A	29.41	homo-dimer	HHblits	X-ray	2.10Å	0.33	0.07	SEGREGATION PROTEIN
4ixm.2.B	29.41	homo-dimer	HHblits	X-ray	2.57Å	0.33	0.07	Uncharacterized GTP-binding protein YjiA
1nij.1.A	29.41	monomer	HHblits	X-ray	2.00Å	0.33	0.07	Hypothetical protein yjiA
1j8y.1.A	25.71	monomer	HHblits	X-ray	2.00Å	0.30	0.07	SIGNAL RECOGNITION 54 KDA PROTEIN
5nco.1.9	22.86	hetero-oligomer	HHblits	EM	4.80Å	0.30	0.07	Signal recognition particle protein,Signal recognition particle protein,Signal recognition particle protein,Signal recognition particle protein,Signal recognition particle protein,Signal recognition particle protein,Signal recognition particle protein,Signal recognition particle protein,Signal recognition particle protein,Signal recognition particle protein
1vma.1.A	19.44	monomer	HHblits	X-ray	1.60Å	0.28	0.07	cell division protein FtsY
2ng1.1.A	22.86	monomer	HHblits	X-ray	2.02Å	0.30	0.07	SIGNAL SEQUENCE RECOGNITION PROTEIN FFH
2ffh.1.A	22.86	monomer	HHblits	X-ray	3.20Å	0.30	0.07	PROTEIN (FFH)
2j7p.1.A	22.86	hetero-oligomer	HHblits	X-ray	1.97Å	0.30	0.07	SIGNAL RECOGNITION PARTICLE PROTEIN
3ng1.1.A	22.86	monomer	HHblits	X-ray	2.30Å	0.30	0.07	SIGNAL SEQUENCE RECOGNITION PROTEIN FFH
2cnw.1.A	22.86	hetero-oligomer	HHblits	X-ray	2.39Å	0.30	0.07	SIGNAL RECOGNITION PARTICLE PROTEIN
2cnw.3.A	22.86	hetero-oligomer	HHblits	X-ray	2.39Å	0.30	0.07	SIGNAL RECOGNITION PARTICLE PROTEIN
2xkv.1.A	22.86	hetero-oligomer	HHblits	EM	13.50Å	0.30	0.07	SIGNAL RECOGNITION PARTICLE PROTEIN
4jlv.1.A	20.00	monomer	HHblits	X-ray	2.20Å	0.30	0.07	C-terminal fragment of Membrane protein CapA1, Putative uncharacterized protein capB1
2ved.1.A	20.00	homo-octamer	HHblits	X-ray	2.60Å	0.30	0.07	MEMBRANE PROTEIN CAPA1, PROTEIN TYROSINE KINASE
3la6.1.F	17.65	homo-octamer	HHblits	X-ray	3.20Å	0.32	0.07	Tyrosine-protein kinase wzc
3la6.1.B	17.65	homo-octamer	HHblits	X-ray	3.20Å	0.32	0.07	Tyrosine-protein kinase wzc
3la6.1.C	17.65	homo-octamer	HHblits	X-ray	3.20Å	0.32	0.07	Tyrosine-protein kinase wzc
3la6.1.D	17.65	homo-octamer	HHblits	X-ray	3.20Å	0.32	0.07	Tyrosine-protein kinase wzc
3la6.1.E	17.65	homo-octamer	HHblits	X-ray	3.20Å	0.32	0.07	Tyrosine-protein kinase wzc
3la6.1.A	17.65	homo-octamer	HHblits	X-ray	3.20Å	0.32	0.07	Tyrosine-protein kinase wzc
3la6.1.G	17.65	homo-octamer	HHblits	X-ray	3.20Å	0.32	0.07	Tyrosine-protein kinase wzc
3la6.1.H	17.65	homo-octamer	HHblits	X-ray	3.20Å	0.32	0.07	Tyrosine-protein kinase wzc
3la6.2.C	17.65	homo-octamer	HHblits	X-ray	3.20Å	0.32	0.07	Tyrosine-protein kinase wzc
5u1g.1.A	33.33	hetero-oligomer	HHblits	X-ray	3.64Å	0.34	0.06	ParA
5u1g.2.B	33.33	hetero-oligomer	HHblits	X-ray	3.64Å	0.34	0.06	ParA
1fts.1.A	19.44	monomer	HHblits	X-ray	2.20Å	0.27	0.07	FTSY
4ak9.1.A	16.67	homo-dimer	HHblits	X-ray	1.80Å	0.27	0.07	CPFTSY
3ez7.1.A	11.43	homo-dimer	HHblits	X-ray	2.92Å	0.29	0.07	Plasmid partition protein A
3ez6.1.A	11.43	homo-dimer	HHblits	X-ray	2.58Å	0.29	0.07	Plasmid partition protein A
3ez6.1.B	11.43	homo-dimer	HHblits	X-ray	2.58Å	0.29	0.07	Plasmid partition protein A
3ez2.1.B	11.43	homo-dimer	HHblits	X-ray	2.05Å	0.29	0.07	Plasmid partition protein A
5j1j.1.A	26.47	homo-dimer	HHblits	X-ray	1.55Å	0.31	0.07	Site-determining protein
5j1j.1.B	26.47	homo-dimer	HHblits	X-ray	1.55Å	0.31	0.07	Site-determining protein
5jvf.1.A	26.47	monomer	HHblits	X-ray	1.66Å	0.31	0.07	Site-determining protein
1a7j.1.A	23.53	monomer	HHblits	X-ray	2.50Å	0.31	0.07	PHOSPHORIBULOKINASE
4nkr.1.A	16.67	homo-dimer	HHblits	X-ray	2.41Å	0.27	0.07	Molybdopterin-guanine dinucleotide biosynthesis protein B
4nkr.2.A	16.67	homo-dimer	HHblits	X-ray	2.41Å	0.27	0.07	Molybdopterin-guanine dinucleotide biosynthesis protein B
4nkr.2.B	16.67	homo-dimer	HHblits	X-ray	2.41Å	0.27	0.07	Molybdopterin-guanine dinucleotide biosynthesis protein B
4nkr.3.A	16.67	homo-dimer	HHblits	X-ray	2.41Å	0.27	0.07	Molybdopterin-guanine dinucleotide biosynthesis protein B
4nkr.3.B	16.67	homo-dimer	HHblits	X-ray	2.41Å	0.27	0.07	Molybdopterin-guanine dinucleotide biosynthesis protein B
2cnw.1.B	17.14	hetero-oligomer	HHblits	X-ray	2.39Å	0.29	0.07	CELL DIVISION PROTEIN FTSY
2iyl.1.A	17.14	monomer	HHblits	X-ray	2.10Å	0.29	0.07	CELL DIVISION PROTEIN FTSY
2cnw.2.B	17.14	hetero-oligomer	HHblits	X-ray	2.39Å	0.29	0.07	CELL DIVISION PROTEIN FTSY
5l3q.1.B	17.14	hetero-oligomer	HHblits	X-ray	3.20Å	0.29	0.07	Signal recognition particle receptor subunit alpha
2c03.1.A	23.53	monomer	HHblits	X-ray	1.24Å	0.31	0.07	SIGNAL RECOGNITION PARTICLE PROTEIN
2c03.2.A	23.53	monomer	HHblits	X-ray	1.24Å	0.31	0.07	SIGNAL RECOGNITION PARTICLE PROTEIN
1ffh.1.A	23.53	monomer	HHblits	X-ray	2.05Å	0.31	0.07	FFH
2j45.1.A	23.53	monomer	HHblits	X-ray	1.14Å	0.31	0.07	SIGNAL RECOGNITION PARTICLE PROTEIN
2j45.2.A	23.53	monomer	HHblits	X-ray	1.14Å	0.31	0.07	SIGNAL RECOGNITION PARTICLE PROTEIN
2j46.1.A	23.53	monomer	HHblits	X-ray	1.14Å	0.31	0.07	SIGNAL RECOGNITION PARTICLE PROTEIN
2j46.2.A	23.53	monomer	HHblits	X-ray	1.14Å	0.31	0.07	SIGNAL RECOGNITION PARTICLE PROTEIN
1o87.1.A	23.53	monomer	HHblits	X-ray	2.10Å	0.31	0.07	SIGNAL RECOGNITION PARTICLE PROTEIN
1o87.2.A	23.53	monomer	HHblits	X-ray	2.10Å	0.31	0.07	SIGNAL RECOGNITION PARTICLE PROTEIN
2c04.1.A	23.53	monomer	HHblits	X-ray	1.15Å	0.31	0.07	SIGNAL RECOGNITION PARTICLE PROTEIN
2c04.2.A	23.53	monomer	HHblits	X-ray	1.15Å	0.31	0.07	SIGNAL RECOGNITION PARTICLE PROTEIN
1ls1.1.A	23.53	monomer	HHblits	X-ray	1.10Å	0.31	0.07	SIGNAL RECOGNITION PARTICLE PROTEIN
1jpj.1.A	23.53	monomer	HHblits	X-ray	2.30Å	0.31	0.07	SIGNAL RECOGNITION PARTICLE PROTEIN
1jpn.1.A	23.53	monomer	HHblits	X-ray	1.90Å	0.31	0.07	SIGNAL RECOGNITION PARTICLE PROTEIN
1jpn.2.A	23.53	monomer	HHblits	X-ray	1.90Å	0.31	0.07	SIGNAL RECOGNITION PARTICLE PROTEIN
3dm5.1.A	17.65	homo-tetramer	HHblits	X-ray	2.51Å	0.31	0.07	Signal recognition 54 kDa protein
3fmi.1.A	20.59	homo-dimer	HHblits	X-ray	2.18Å	0.31	0.07	Dethiobiotin synthetase
3fmi.1.B	20.59	homo-dimer	HHblits	X-ray	2.18Å	0.31	0.07	Dethiobiotin synthetase
3fmf.2.A	20.59	homo-dimer	HHblits	X-ray	2.05Å	0.31	0.07	Dethiobiotin synthetase
3ez9.1.A	17.14	homo-dimer	HHblits	X-ray	2.80Å	0.28	0.07	ParA
3ez9.2.A	17.14	homo-dimer	HHblits	X-ray	2.80Å	0.28	0.07	ParA
3ezf.1.A	17.14	homo-dimer	HHblits	X-ray	2.80Å	0.28	0.07	ParA
1ion.1.A	24.24	monomer	HHblits	X-ray	2.30Å	0.33	0.06	PROBABLE CELL DIVISION INHIBITOR MIND
3of5.1.A	23.53	homo-dimer	HHblits	X-ray	1.52Å	0.30	0.07	Dethiobiotin synthetase
1g3r.1.A	24.24	monomer	HHblits	X-ray	2.70Å	0.33	0.06	CELL DIVISION INHIBITOR
4v02.1.A	30.30	hetero-oligomer	HHblits	X-ray	2.70Å	0.33	0.06	SITE-DETERMINING PROTEIN
5gad.1.9	20.00	hetero-oligomer	HHblits	EM	NA	0.28	0.07	Signal recognition particle receptor FtsY
2yhs.1.A	20.00	monomer	HHblits	X-ray	1.60Å	0.28	0.07	CELL DIVISION PROTEIN FTSY
2xxa.1.B	20.00	hetero-oligomer	HHblits	X-ray	3.94Å	0.28	0.07	SRP RECEPTOR FTSY
2qy9.1.A	20.00	monomer	HHblits	X-ray	1.90Å	0.28	0.07	Cell division protein ftsY
4c7o.1.B	20.00	hetero-oligomer	HHblits	X-ray	2.60Å	0.28	0.07	SIGNAL RECOGNITION PARTICLE RECEPTOR FTSY
3c8u.1.A	17.65	monomer	HHblits	X-ray	1.95Å	0.30	0.07	Fructokinase
4e07.1.A	34.38	monomer	HHblits	X-ray	2.90Å	0.35	0.06	Plasmid partitioning protein ParF
4e09.1.A	34.38	homo-dimer	HHblits	X-ray	2.99Å	0.35	0.06	Plasmid partitioning protein ParF
4e03.1.A	34.38	monomer	HHblits	X-ray	2.45Å	0.35	0.06	Plasmid partitioning protein ParF
4e03.2.A	34.38	monomer	HHblits	X-ray	2.45Å	0.35	0.06	Plasmid partitioning protein ParF
4dzz.1.A	34.38	monomer	HHblits	X-ray	1.80Å	0.35	0.06	Plasmid partitioning protein ParF
4dzz.2.A	34.38	monomer	HHblits	X-ray	1.80Å	0.35	0.06	Plasmid partitioning protein ParF
5aun.1.B	20.59	hetero-oligomer	HHblits	X-ray	1.63Å	0.30	0.07	ATPase involved in chromosome partitioning, ParA/MinD family, Mrp homolog
3vx3.1.A	20.59	homo-dimer	HHblits	X-ray	2.10Å	0.30	0.07	ATPase involved in chromosome partitioning, ParA/MinD family, Mrp homolog
5auq.3.A	20.59	homo-dimer	HHblits	X-ray	2.53Å	0.30	0.07	ATPase involved in chromosome partitioning, ParA/MinD family, Mrp homolog
3vx3.1.B	20.59	homo-dimer	HHblits	X-ray	2.10Å	0.30	0.07	ATPase involved in chromosome partitioning, ParA/MinD family, Mrp homolog
1yr6.1.A	31.25	homo-dimer	HHblits	X-ray	2.15Å	0.34	0.06	ATP(GTP)binding protein
1yr7.1.A	31.25	homo-dimer	HHblits	X-ray	2.08Å	0.34	0.06	ATP(GTP)binding protein
1yr8.1.A	31.25	homo-dimer	HHblits	X-ray	2.40Å	0.34	0.06	ATP(GTP)binding protein
1yr9.1.A	31.25	homo-dimer	HHblits	X-ray	2.80Å	0.34	0.06	ATP(GTP)binding protein
1yra.1.A	31.25	homo-dimer	HHblits	X-ray	2.30Å	0.34	0.06	ATP(GTP)binding protein
1yra.1.B	31.25	homo-dimer	HHblits	X-ray	2.30Å	0.34	0.06	ATP(GTP)binding protein
1yrb.1.A	31.25	homo-dimer	HHblits	X-ray	1.75Å	0.34	0.06	ATP(GTP)binding protein
2oxr.1.A	31.25	homo-dimer	HHblits	X-ray	2.40Å	0.34	0.06	ATP(GTP)binding protein
3r9i.1.B	31.25	hetero-oligomer	HHblits	X-ray	2.60Å	0.34	0.06	Septum site-determining protein minD
3q9l.1.A	31.25	homo-dimer	HHblits	X-ray	2.34Å	0.34	0.06	Septum site-determining protein minD
4rz3.1.A	23.53	homo-dimer	HHblits	X-ray	1.90Å	0.29	0.07	Site-determining protein
4rz3.1.B	23.53	homo-dimer	HHblits	X-ray	1.90Å	0.29	0.07	Site-determining protein
4rz2.1.A	23.53	monomer	HHblits	X-ray	2.80Å	0.29	0.07	Site-determining protein
1dts.1.A	30.30	homo-dimer	HHblits	X-ray	1.65Å	0.32	0.06	DETHIOBIOTIN SYNTHETASE
1dah.1.A	30.30	homo-dimer	HHblits	X-ray	1.64Å	0.32	0.06	DETHIOBIOTIN SYNTHETASE
1byi.1.A	30.30	homo-dimer	HHblits	X-ray	0.97Å	0.32	0.06	DETHIOBIOTIN SYNTHASE
4v03.1.A	27.27	homo-dimer	HHblits	X-ray	1.90Å	0.31	0.06	SITE-DETERMINING PROTEIN
4ohv.1.A	17.14	monomer	HHblits	X-ray	2.30Å	0.27	0.07	Protein clpf-1
4oyh.1.A	17.14	homo-dimer	HHblits	X-ray	2.41Å	0.27	0.07	Molybdopterin-guanine dinucleotide biosynthesis protein B
4oyh.2.A	17.14	homo-dimer	HHblits	X-ray	2.41Å	0.27	0.07	Molybdopterin-guanine dinucleotide biosynthesis protein B
4oyh.2.B	17.14	homo-dimer	HHblits	X-ray	2.41Å	0.27	0.07	Molybdopterin-guanine dinucleotide biosynthesis protein B
4oyh.3.A	17.14	homo-dimer	HHblits	X-ray	2.41Å	0.27	0.07	Molybdopterin-guanine dinucleotide biosynthesis protein B
4oyh.3.B	17.14	homo-dimer	HHblits	X-ray	2.41Å	0.27	0.07	Molybdopterin-guanine dinucleotide biosynthesis protein B
2j7p.1.B	17.65	hetero-oligomer	HHblits	X-ray	1.97Å	0.29	0.07	CELL DIVISION PROTEIN FTSY
1okk.1.B	17.65	hetero-oligomer	HHblits	X-ray	2.05Å	0.29	0.07	CELL DIVISION PROTEIN FTSY
2xkv.1.D	17.65	hetero-oligomer	HHblits	EM	13.50Å	0.29	0.07	CELL DIVISION PROTEIN FTSY
2q9a.1.A	17.65	monomer	HHblits	X-ray	2.24Å	0.29	0.07	Cell division protein ftsY
2q9a.2.A	17.65	monomer	HHblits	X-ray	2.24Å	0.29	0.07	Cell division protein ftsY
3ug7.1.A	23.53	homo-tetramer	HHblits	X-ray	2.90Å	0.29	0.07	arsenical pump-driving ATPase
3ug6.1.A	23.53	homo-tetramer	HHblits	X-ray	3.30Å	0.29	0.07	arsenical pump-driving ATPase
3ea0.1.A	14.71	homo-dimer	HHblits	X-ray	2.20Å	0.29	0.07	ATPase, ParA family
3ea0.1.B	14.71	homo-dimer	HHblits	X-ray	2.20Å	0.29	0.07	ATPase, ParA family
2xj9.1.A	27.27	homo-dimer	HHblits	X-ray	2.80Å	0.31	0.06	MIPZ
2xj9.1.B	27.27	homo-dimer	HHblits	X-ray	2.80Å	0.31	0.06	MIPZ
3fwy.1.A	15.15	homo-dimer	HHblits	X-ray	1.63Å	0.30	0.06	Light-independent protochlorophyllide reductase iron-sulfur ATP-binding protein
3fwy.1.B	15.15	homo-dimer	HHblits	X-ray	1.63Å	0.30	0.06	Light-independent protochlorophyllide reductase iron-sulfur ATP-binding protein
1hyq.1.A	21.21	monomer	HHblits	X-ray	2.60Å	0.30	0.06	CELL DIVISION INHIBITOR (MIND-1)
3ibg.1.A	28.13	homo-dimer	HHblits	X-ray	3.20Å	0.33	0.06	ATPase, subunit of the Get complex
2ph1.1.A	21.21	homo-dimer	HHblits	X-ray	2.70Å	0.30	0.06	Nucleotide-binding protein
2oze.1.A	21.88	homo-dimer	HHblits	X-ray	1.83Å	0.32	0.06	Orf delta'
3mle.1.A	32.26	homo-dimer	HHblits	X-ray	2.80Å	0.34	0.06	Dethiobiotin synthetase
1odf.1.A	20.59	monomer	HHblits	X-ray	2.25Å	0.27	0.07	HYPOTHETICAL 33.3 KDA PROTEIN IN ADE3-SER2 INTERGENIC REGION
3cr7.1.A	28.13	homo-dimer	HHblits	X-ray	2.50Å	0.31	0.06	Adenylyl-sulfate kinase
3cr7.1.B	28.13	homo-dimer	HHblits	X-ray	2.50Å	0.31	0.06	Adenylyl-sulfate kinase
1e2e.1.A	28.13	homo-dimer	HHblits	X-ray	2.00Å	0.30	0.06	THYMIDYLATE KINASE
3kb1.1.A	18.18	homo-dimer	HHblits	X-ray	2.90Å	0.28	0.06	Nucleotide-binding protein
4twg.1.B	21.88	homo-trimer	HHblits	X-ray	1.85Å	0.30	0.06	Molybdopterin biosynthesis Mog protein
4twg.1.A	21.88	homo-trimer	HHblits	X-ray	1.85Å	0.30	0.06	Molybdopterin biosynthesis Mog protein
4twg.1.C	21.88	homo-trimer	HHblits	X-ray	1.85Å	0.30	0.06	Molybdopterin biosynthesis Mog protein
1g20.1.E	18.75	hetero-oligomer	HHblits	X-ray	2.20Å	0.30	0.06	NITROGENASE IRON PROTEIN
1g21.1.H	18.75	hetero-oligomer	HHblits	X-ray	3.00Å	0.30	0.06	NITROGENASE IRON PROTEIN
1g21.1.E	18.75	hetero-oligomer	HHblits	X-ray	3.00Å	0.30	0.06	NITROGENASE IRON PROTEIN
4rfv.1.A	25.81	homo-dimer	HHblits	X-ray	1.69Å	0.32	0.06	Bifunctional enzyme CysN/CysC
3n2i.1.A	25.00	homo-dimer	HHblits	X-ray	2.25Å	0.29	0.06	Thymidylate kinase
3ld9.1.A	26.67	homo-tetramer	HHblits	X-ray	2.15Å	0.33	0.06	Thymidylate kinase
2ax4.1.A	22.58	homo-dimer	HHblits	X-ray	2.50Å	0.30	0.06	Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthetase 2
2hly.1.A	12.90	monomer	HHblits	X-ray	1.60Å	0.29	0.06	Hypothetical protein Atu2299
1m7h.4.B	26.67	homo-tetramer	HHblits	X-ray	2.00Å	0.32	0.06	Adenylylsulfate kinase
1d6j.1.B	26.67	homo-dimer	HHblits	X-ray	2.00Å	0.32	0.06	ADENOSINE-5'PHOSPHOSULFATE KINASE
1d6j.1.A	26.67	homo-dimer	HHblits	X-ray	2.00Å	0.32	0.06	ADENOSINE-5'PHOSPHOSULFATE KINASE
1m7h.4.C	26.67	homo-tetramer	HHblits	X-ray	2.00Å	0.32	0.06	Adenylylsulfate kinase
1m7g.5.A	26.67	homo-tetramer	HHblits	X-ray	1.43Å	0.32	0.06	Adenylylsulfate kinase
3v9p.1.A	30.00	monomer	HHblits	X-ray	1.90Å	0.31	0.06	Thymidylate kinase
4bzq.1.A	26.67	homo-dimer	HHblits	X-ray	2.10Å	0.31	0.06	BIFUNCTIONAL ENZYME CYSN/CYSC
5cb6.3.B	26.67	homo-dimer	HHblits	X-ray	2.79Å	0.31	0.06	Probable adenylyl-sulfate kinase
5cb6.2.B	26.67	homo-dimer	HHblits	X-ray	2.79Å	0.31	0.06	Probable adenylyl-sulfate kinase
5bq5.1.A	30.00	monomer	HHblits	X-ray	2.10Å	0.31	0.06	Insertion sequence IS5376 putative ATP-binding protein
3uxm.1.A	19.35	monomer	HHblits	X-ray	1.95Å	0.28	0.06	Thymidylate kinase
3uxm.2.A	19.35	monomer	HHblits	X-ray	1.95Å	0.28	0.06	Thymidylate kinase
3ecc.1.A	26.67	monomer	HHblits	X-ray	2.70Å	0.30	0.06	DNA replication protein DnaC
2yvu.1.A	27.59	homo-dimer	HHblits	X-ray	2.10Å	0.32	0.06	Probable adenylyl-sulfate kinase
2yvu.1.B	27.59	homo-dimer	HHblits	X-ray	2.10Å	0.32	0.06	Probable adenylyl-sulfate kinase
1de0.1.A	20.00	homo-dimer	HHblits	X-ray	2.40Å	0.29	0.06	NITROGENASE IRON PROTEIN
1xcp.1.A	20.00	homo-dimer	HHblits	X-ray	3.20Å	0.29	0.06	Nitrogenase iron protein 1
1xcp.2.A	20.00	homo-dimer	HHblits	X-ray	3.20Å	0.29	0.06	Nitrogenase iron protein 1
1m34.1.E	20.00	hetero-oligomer	HHblits	X-ray	2.30Å	0.29	0.06	Nitrogenase Iron Protein 1
1m1y.1.E	20.00	hetero-oligomer	HHblits	X-ray	3.20Å	0.29	0.06	nitrogenase IRON protein 1
1m1y.1.F	20.00	hetero-oligomer	HHblits	X-ray	3.20Å	0.29	0.06	nitrogenase IRON protein 1
2afi.1.E	20.00	hetero-oligomer	HHblits	X-ray	3.10Å	0.29	0.06	Nitrogenase iron protein 1
2afh.1.E	20.00	hetero-oligomer	HHblits	X-ray	2.10Å	0.29	0.06	Nitrogenase iron protein 1
2afh.1.F	20.00	hetero-oligomer	HHblits	X-ray	2.10Å	0.29	0.06	Nitrogenase iron protein 1
1g5p.1.A	20.00	homo-dimer	HHblits	X-ray	2.20Å	0.29	0.06	NITROGENASE IRON PROTEIN
1g5p.1.B	20.00	homo-dimer	HHblits	X-ray	2.20Å	0.29	0.06	NITROGENASE IRON PROTEIN
1g1m.1.A	20.00	homo-dimer	HHblits	X-ray	2.25Å	0.29	0.06	NITROGENASE IRON PROTEIN
1g1m.1.B	20.00	homo-dimer	HHblits	X-ray	2.25Å	0.29	0.06	NITROGENASE IRON PROTEIN
1fp6.1.A	20.00	homo-dimer	HHblits	X-ray	2.15Å	0.29	0.06	NITROGENASE IRON PROTEIN
1nip.1.A	20.00	homo-dimer	HHblits	X-ray	2.90Å	0.29	0.06	NITROGENASE IRON PROTEIN
1nip.1.B	20.00	homo-dimer	HHblits	X-ray	2.90Å	0.29	0.06	NITROGENASE IRON PROTEIN
2ofw.1.B	27.59	homo-dimer	HHblits	X-ray	2.05Å	0.30	0.06	APS kinase domain of the PAPS synthetase 1
2ofw.1.A	27.59	homo-dimer	HHblits	X-ray	2.05Å	0.30	0.06	APS kinase domain of the PAPS synthetase 1
3uwo.1.A	16.67	monomer	HHblits	X-ray	1.70Å	0.27	0.06	Thymidylate kinase
1xd9.1.A	20.69	homo-dimer	HHblits	X-ray	2.80Å	0.29	0.06	Nitrogenase iron protein 1
1xdb.1.A	20.69	homo-dimer	HHblits	X-ray	2.80Å	0.29	0.06	Nitrogenase iron protein 1
2pbr.1.B	35.71	homo-dimer	HHblits	X-ray	1.96Å	0.32	0.06	Thymidylate kinase
2pbr.1.A	35.71	homo-dimer	HHblits	X-ray	1.96Å	0.32	0.06	Thymidylate kinase
4s35.1.B	35.71	homo-dimer	HHblits	X-ray	1.55Å	0.32	0.06	Thymidylate kinase
5xb2.1.B	35.71	homo-dimer	HHblits	X-ray	2.16Å	0.32	0.06	Thymidylate kinase
4wzb.1.F	21.43	hetero-oligomer	HHblits	X-ray	2.30Å	0.30	0.06	Nitrogenase iron protein 1
4wzb.1.E	21.43	hetero-oligomer	HHblits	X-ray	2.30Å	0.30	0.06	Nitrogenase iron protein 1
4wza.1.E	21.43	hetero-oligomer	HHblits	X-ray	1.90Å	0.30	0.06	Nitrogenase iron protein 1
4wza.1.F	21.43	hetero-oligomer	HHblits	X-ray	1.90Å	0.30	0.06	Nitrogenase iron protein 1
3tqc.1.A	30.77	homo-dimer	HHblits	X-ray	2.30Å	0.35	0.05	Pantothenate kinase
5he9.1.A	17.24	hetero-oligomer	HHblits	X-ray	1.90Å	0.26	0.06	Helicase loader
5he8.2.B	17.24	homo-dimer	HHblits	X-ray	2.60Å	0.26	0.06	Helicase loader
5he8.2.A	17.24	homo-dimer	HHblits	X-ray	2.60Å	0.26	0.06	Helicase loader
5he8.6.B	17.24	homo-dimer	HHblits	X-ray	2.60Å	0.26	0.06	Helicase loader
5he8.3.B	17.24	homo-dimer	HHblits	X-ray	2.60Å	0.26	0.06	Helicase loader
5he8.3.A	17.24	homo-dimer	HHblits	X-ray	2.60Å	0.26	0.06	Helicase loader
5he8.6.A	17.24	homo-dimer	HHblits	X-ray	2.60Å	0.26	0.06	Helicase loader
5he8.5.A	17.24	homo-dimer	HHblits	X-ray	2.60Å	0.26	0.06	Helicase loader
5he8.5.B	17.24	homo-dimer	HHblits	X-ray	2.60Å	0.26	0.06	Helicase loader
5he8.1.A	17.24	homo-dimer	HHblits	X-ray	2.60Å	0.26	0.06	Helicase loader
5he8.4.A	17.24	homo-dimer	HHblits	X-ray	2.60Å	0.26	0.06	Helicase loader
5he8.4.B	17.24	homo-dimer	HHblits	X-ray	2.60Å	0.26	0.06	Helicase loader
5he8.1.B	17.24	homo-dimer	HHblits	X-ray	2.60Å	0.26	0.06	Helicase loader
3avo.1.A	25.93	homo-dimer	HHblits	X-ray	2.55Å	0.31	0.05	Pantothenate kinase
3avp.1.A	25.93	homo-dimer	HHblits	X-ray	2.60Å	0.31	0.05	Pantothenate kinase
2get.1.A	25.93	homo-dimer	HHblits	X-ray	2.35Å	0.31	0.05	Pantothenate kinase
2geu.1.A	25.93	homo-dimer	HHblits	X-ray	2.90Å	0.31	0.05	Pantothenate kinase
4bft.1.A	25.93	homo-dimer	HHblits	X-ray	2.29Å	0.31	0.05	PANTOTHENATE KINASE
4bfs.1.A	25.93	homo-dimer	HHblits	X-ray	2.90Å	0.31	0.05	PANTOTHENATE KINASE
4bft.1.B	25.93	homo-dimer	HHblits	X-ray	2.29Å	0.31	0.05	PANTOTHENATE KINASE
4bfu.1.B	25.93	homo-dimer	HHblits	X-ray	2.28Å	0.31	0.05	PANTOTHENATE KINASE
4bfw.1.B	25.93	homo-dimer	HHblits	X-ray	2.27Å	0.31	0.05	PANTOTHENATE KINASE
1esm.1.A	26.92	homo-dimer	HHblits	X-ray	2.50Å	0.33	0.05	PANTOTHENATE KINASE
1esm.1.B	26.92	homo-dimer	HHblits	X-ray	2.50Å	0.33	0.05	PANTOTHENATE KINASE
1esn.1.A	26.92	homo-dimer	HHblits	X-ray	2.60Å	0.33	0.05	PANTOTHENATE KINASE
1esn.1.B	26.92	homo-dimer	HHblits	X-ray	2.60Å	0.33	0.05	PANTOTHENATE KINASE
1esn.2.B	26.92	homo-dimer	HHblits	X-ray	2.60Å	0.33	0.05	PANTOTHENATE KINASE
3pzy.1.A	26.92	homo-trimer	HHblits	X-ray	1.80Å	0.33	0.05	Mog
1cp2.1.A	17.86	homo-dimer	HHblits	X-ray	1.93Å	0.27	0.06	NITROGENASE IRON PROTEIN
1cp2.1.B	17.86	homo-dimer	HHblits	X-ray	1.93Å	0.27	0.06	NITROGENASE IRON PROTEIN
4ba6.1.A	19.23	monomer	HHblits	X-ray	1.42Å	0.31	0.05	ENDOGLUCANASE CEL5A
5afe.1.A	19.23	monomer	HHblits	X-ray	2.60Å	0.31	0.05	ENDOGLUCANASE CEL5A
2ypj.1.A	19.23	monomer	HHblits	X-ray	2.35Å	0.31	0.05	ENDOGLUCANASE CEL5A
4bzp.1.A	32.00	homo-dimer	HHblits	X-ray	1.47Å	0.34	0.05	BIFUNCTIONAL ENZYME CYSN/CYSC
2qsy.1.A	41.67	monomer	HHblits	X-ray	1.95Å	0.37	0.05	Nicotinamide riboside kinase 1
2qt0.1.A	41.67	monomer	HHblits	X-ray	1.92Å	0.37	0.05	Nicotinamide riboside kinase 1
1p9r.1.A	33.33	monomer	HHblits	X-ray	2.50Å	0.33	0.05	General secretion pathway protein E
3uie.1.A	33.33	homo-dimer	HHblits	X-ray	1.79Å	0.33	0.05	Adenylyl-sulfate kinase 1, chloroplastic
4aek.1.A	20.83	monomer	HHblits	X-ray	1.75Å	0.32	0.05	ENDOGLUCANASE CEL5A
4aem.1.A	20.83	monomer	HHblits	X-ray	2.10Å	0.32	0.05	ENDOGLUCANASE CEL5A
2eyu.1.A	29.17	monomer	HHblits	X-ray	1.87Å	0.32	0.05	twitching motility protein PilT
2eyu.2.A	29.17	monomer	HHblits	X-ray	1.87Å	0.32	0.05	twitching motility protein PilT
1s96.1.A	11.54	homo-dimer	HHblits	X-ray	2.00Å	0.25	0.05	Guanylate kinase
1in6.1.A	34.78	monomer	HHblits	X-ray	1.80Å	0.34	0.05	HOLLIDAY JUNCTION DNA HELICASE RUVB
4ksr.1.A	34.78	homo-hexamer	HHblits	X-ray	4.20Å	0.34	0.05	Type II secretion system protein E, Hemolysin-coregulated protein
4ksr.1.B	34.78	homo-hexamer	HHblits	X-ray	4.20Å	0.34	0.05	Type II secretion system protein E, Hemolysin-coregulated protein
4ksr.1.C	34.78	homo-hexamer	HHblits	X-ray	4.20Å	0.34	0.05	Type II secretion system protein E, Hemolysin-coregulated protein
3ec2.1.A	34.78	monomer	HHblits	X-ray	2.70Å	0.34	0.05	DNA replication protein DnaC
4ttq.1.A	36.36	monomer	HHblits	X-ray	2.20Å	0.37	0.04	Dephospho-CoA kinase
4ttp.1.A	36.36	monomer	HHblits	X-ray	2.20Å	0.37	0.04	Dephospho-CoA kinase
2qg6.1.A	40.91	monomer	HHblits	X-ray	1.50Å	0.37	0.04	Nicotinamide riboside kinase 1
4gfd.1.A	34.78	homo-dimer	HHblits	X-ray	1.80Å	0.33	0.05	Thymidylate kinase
2cck.1.B	34.78	homo-dimer	HHblits	X-ray	2.21Å	0.33	0.05	THYMIDYLATE KINASE
1jbk.1.A	29.17	monomer	HHblits	X-ray	1.80Å	0.29	0.05	CLPB PROTEIN
5ujm.1.D	20.83	hetero-oligomer	HHblits	EM	NA	0.28	0.05	Origin recognition complex subunit 4
5uj7.2.B	20.83	hetero-oligomer	HHblits	X-ray	3.39Å	0.28	0.05	Origin recognition complex subunit 4
1xex.1.A	17.39	hetero-oligomer	HHblits	X-ray	2.50Å	0.30	0.05	SMC protein
1xew.1.A	17.39	hetero-oligomer	HHblits	X-ray	2.00Å	0.30	0.05	SMC protein
3kta.1.A	17.39	hetero-oligomer	HHblits	X-ray	1.63Å	0.30	0.05	Chromosome segregation protein smc
3kta.2.A	17.39	hetero-oligomer	HHblits	X-ray	1.63Å	0.30	0.05	Chromosome segregation protein smc
1z6g.1.A	16.67	monomer	HHblits	X-ray	2.18Å	0.25	0.05	guanylate kinase