SWISS-MODEL | Workspace | Model Results

SWISS-MODEL Homology Modelling Report

Model Building Report

This document lists the results for the homology modelling project "Q6GHT5" submitted to SWISS-MODEL workspace on Oct. 17, 2017, 7:10 p.m..The submitted primary amino acid sequence is given in Table T1.

If you use any results in your research, please cite the relevant publications:

Marco Biasini; Stefan Bienert; Andrew Waterhouse; Konstantin Arnold; Gabriel Studer; Tobias Schmidt; Florian Kiefer; Tiziano Gallo Cassarino; Martino Bertoni; Lorenza Bordoli; Torsten Schwede. (2014). SWISS-MODEL: modelling protein tertiary and quaternary structure using evolutionary information. Nucleic Acids Research (1 July 2014) 42 (W1): W252-W258; doi: 10.1093/nar/gku340.
Arnold, K., Bordoli, L., Kopp, J. and Schwede, T. (2006) The SWISS-MODEL workspace: a web-based environment for protein structure homology modelling. Bioinformatics, 22, 195-201.
Benkert, P., Biasini, M. and Schwede, T. (2011) Toward the estimation of the absolute quality of individual protein structure models. Bioinformatics, 27, 343-350

Results

The SWISS-MODEL template library (SMTL version 2017-10-11, PDB release 2017-10-06) was searched with Blast (Altschul et al., 1997) and HHBlits (Remmert, et al., 2011) for evolutionary related structures matching the target sequence in Table T1. For details on the template search, see Materials and Methods. Overall 1088 templates were found (Table T2).

Models

The following model was built (see Materials and Methods "Model Building"):

Model #01	File	Built with	Oligo-State	Ligands	GMQE	QMEAN
	PDB	ProMod3 Version 1.0.2.	homo-dimer (matching prediction)	2 x DGL: D-GLUTAMIC ACID;	0.99	-0.23

QMEAN	-0.23
Cβ	1.05
All Atom	1.82
Solvation	0.62
Torsion	-0.60

Template	Seq Identity	Oligo-state	Found by	Method	Resolution	Seq Similarity	Range	Coverage	Description
2jfq.1.A	99.62	homo-dimer	HHblits	X-ray	2.15Å	0.61	1 - 265	1.00	GLUTAMATE RACEMASE

Ligand	Added to Model	Description
DGL	✓	D-GLUTAMIC ACID
DGL	✓	D-GLUTAMIC ACID

Target    MNKPIGVIDSGVGGLTVAKEIMRQLPNETIYYLGDIGRCPYGPRPGEQVKQYTVEIARKLMEFDIKMLVIACNTATAVAL
2jfq.1.A  MNKPIGVIDSGVGGLTVAKEIMRQLPNETIYYLGDIGRCPYGPRPGEQVKQYTVEIARKLMEFDIKMLVIACNTATAVAL

Target    EYLQKTLSIPVIGVIEPGARTAIMTTRNQNVLVLGTEGTIKSEAYRTHIKRINPHVEVHGVACPGFVPLVEQMRYSDPTI
2jfq.1.A  EYLQKTLSISVIGVIEPGARTAIMTTRNQNVLVLGTEGTIKSEAYRTHIKRINPHVEVHGVACPGFVPLVEQMRYSDPTI

Target    TSIVIHQTLKRWRNSESDTVILGCTHYPLLYKPIYDYFGGKKTVISSGLETAREVSALLTFSNEHASYTEHPDHRFFATG
2jfq.1.A  TSIVIHQTLKRWRNSESDTVILGCTHYPLLYKPIYDYFGGKKTVISSGLETAREVSALLTFSNEHASYTEHPDHRFFATG

Target    DTTHITNIIKEWLNLSVNVERISVND
2jfq.1.A  DTTHITNIIKEWLNLSVNVERISVND

Materials and Methods

Template Search

Template search with Blast and HHBlits has been performed against the SWISS-MODEL template library (SMTL, last update: 2017-10-11, last included PDB release: 2017-10-06).

The target sequence was searched with BLAST (Altschul et al., 1997) against the primary amino acid sequence contained in the SMTL. A total of 38 templates were found.

An initial HHblits profile has been built using the procedure outlined in (Remmert, et al., 2011), followed by 1 iteration of HHblits against NR20. The obtained profile has then be searched against all profiles of the SMTL. A total of 1063 templates were found.

Template Selection

For each identified template, the template's quality has been predicted from features of the target-template alignment. The templates with the highest quality have then been selected for model building.

Model Building

Models are built based on the target-template alignment using ProMod3. Coordinates which are conserved between the target and the template are copied from the template to the model. Insertions and deletions are remodelled using a fragment library. Side chains are then rebuilt. Finally, the geometry of the resulting model is regularized by using a force field. In case loop modelling with ProMod3 fails, an alternative model is built with PROMOD-II (Guex, et al., 1997).

Model Quality Estimation

The global and per-residue model quality has been assessed using the QMEAN scoring function (Benkert, et al., 2011) . For improved performance, weights of the individual QMEAN terms have been trained specifically for SWISS-MODEL.

Ligand Modelling

Ligands present in the template structure are transferred by homology to the model when the following criteria are met (Gallo -Casserino, to be published): (a) The ligands are annotated as biologically relevant in the template library, (b) the ligand is in contact with the model, (c) the ligand is not clashing with the protein, (d) the residues in contact with the ligand are conserved between the target and the template. If any of these four criteria is not satisfied, a certain ligand will not be included in the model. The model summary includes information on why and which ligand has not been included.

Oligomeric State Conservation

Homo-oligomeric structure of the target protein is predicted based on the analysis of pairwise interfaces of the identified template structures. For each relevant interface between polypeptide chains (interfaces with more than 10 residue-residue interactions), the QscoreOligomer (Mariani et al., 2011) is predicted from features such as similarity to target and frequency of observing this interface in the identified templates (Kiefer, Bertoni, Biasini, to be published). The prediction is performed with a random forest regressor using these features as input parameters to predict the probability of conservation for each interface. The QscoreOligomer of the whole complex is then calculated as the weight-averaged QscoreOligomer of the interfaces. The oligomeric state of the target is predicted to be the same as in the template when QscoreOligomer is predicted to be higher or equal to 0.5.

References

Altschul, S.F., Madden, T.L., Schaffer, A.A., Zhang, J., Zhang, Z., Miller, W. and Lipman, D.J. (1997) Gapped BLAST and PSI-BLAST: a new generation of protein database search programs. Nucleic Acids Res, 25, 3389-3402.
Remmert, M., Biegert, A., Hauser, A. and Soding, J. (2012) HHblits: lightning-fast iterative protein sequence searching by HMM-HMM alignment. Nat Methods, 9, 173-175.
Guex, N. and Peitsch, M.C. (1997) SWISS-MODEL and the Swiss-PdbViewer: an environment for comparative protein modeling. Electrophoresis, 18, 2714-2723.
Sali, A. and Blundell, T.L. (1993) Comparative protein modelling by satisfaction of spatial restraints. J Mol Biol, 234, 779-815.
Benkert, P., Biasini, M. and Schwede, T. (2011) Toward the estimation of the absolute quality of individual protein structure models. Bioinformatics, 27, 343-350.
Mariani, V., Kiefer, F., Schmidt, T., Haas, J. and Schwede, T. (2011) Assessment of template based protein structure predictions in CASP9. Proteins, 79 Suppl 10, 37-58.

Table T1:

Primary amino acid sequence for which templates were searched and models were built.

MNKPIGVIDSGVGGLTVAKEIMRQLPNETIYYLGDIGRCPYGPRPGEQVKQYTVEIARKLMEFDIKMLVIACNTATAVALEYLQKTLSIPVIGVIEPGAR
TAIMTTRNQNVLVLGTEGTIKSEAYRTHIKRINPHVEVHGVACPGFVPLVEQMRYSDPTITSIVIHQTLKRWRNSESDTVILGCTHYPLLYKPIYDYFGG
KKTVISSGLETAREVSALLTFSNEHASYTEHPDHRFFATGDTTHITNIIKEWLNLSVNVERISVND

Table T2:

Template	Seq Identity	Oligo-state	Found by	Method	Resolution	Seq Similarity	Coverage	Description
2jfq.1.A	99.62	homo-dimer	HHblits	X-ray	2.15Å	0.61	1.00	GLUTAMATE RACEMASE
2jfq.1.B	99.62	homo-dimer	HHblits	X-ray	2.15Å	0.61	1.00	GLUTAMATE RACEMASE
1zuw.1.A	52.08	homo-dimer	BLAST	X-ray	1.75Å	0.44	1.00	glutamate racemase 1
1zuw.1.B	52.08	homo-dimer	BLAST	X-ray	1.75Å	0.44	1.00	glutamate racemase 1
1zuw.1.A	52.67	homo-dimer	HHblits	X-ray	1.75Å	0.44	0.98	glutamate racemase 1
1zuw.1.B	52.67	homo-dimer	HHblits	X-ray	1.75Å	0.44	0.98	glutamate racemase 1
3hfr.1.A	51.71	homo-dimer	BLAST	X-ray	2.30Å	0.43	0.99	Glutamate racemase
3hfr.1.B	51.71	homo-dimer	BLAST	X-ray	2.30Å	0.43	0.99	Glutamate racemase
2gzm.1.A	50.76	homo-dimer	HHblits	X-ray	1.99Å	0.43	0.98	Glutamate racemase
2gzm.1.B	50.76	homo-dimer	HHblits	X-ray	1.99Å	0.43	0.98	Glutamate racemase
2gzm.2.B	50.76	homo-dimer	HHblits	X-ray	1.99Å	0.43	0.98	Glutamate racemase
3hfr.1.A	50.76	homo-dimer	HHblits	X-ray	2.30Å	0.43	0.98	Glutamate racemase
3hfr.1.B	50.76	homo-dimer	HHblits	X-ray	2.30Å	0.43	0.98	Glutamate racemase
2gzm.1.A	51.72	homo-dimer	BLAST	X-ray	1.99Å	0.43	0.98	Glutamate racemase
2gzm.1.B	51.72	homo-dimer	BLAST	X-ray	1.99Å	0.43	0.98	Glutamate racemase
2gzm.2.B	51.72	homo-dimer	BLAST	X-ray	1.99Å	0.43	0.98	Glutamate racemase
2jfw.1.A	49.62	homo-dimer	BLAST	X-ray	2.00Å	0.43	0.98	GLUTAMATE RACEMASE
2jfw.1.A	49.62	homo-dimer	HHblits	X-ray	2.00Å	0.42	0.98	GLUTAMATE RACEMASE
2jfp.1.A	49.62	homo-dimer	HHblits	X-ray	1.98Å	0.42	0.98	GLUTAMATE RACEMASE
2jfo.1.B	49.62	homo-dimer	HHblits	X-ray	2.50Å	0.42	0.98	GLUTAMATE RACEMASE
2vvt.1.A	49.62	homo-dimer	HHblits	X-ray	1.65Å	0.42	0.98	GLUTAMATE RACEMASE
2vvt.1.B	49.62	homo-dimer	HHblits	X-ray	1.65Å	0.42	0.98	GLUTAMATE RACEMASE
2ohv.1.A	43.85	homo-dimer	BLAST	X-ray	2.50Å	0.42	0.98	Glutamate Racemase
2ohg.1.A	43.85	homo-dimer	BLAST	X-ray	2.50Å	0.42	0.98	Glutamate racemase
2oho.1.A	43.85	homo-dimer	BLAST	X-ray	2.25Å	0.42	0.98	Glutamate Racemase
2oho.1.B	43.85	homo-dimer	BLAST	X-ray	2.25Å	0.42	0.98	Glutamate Racemase
2ohv.1.A	44.79	homo-dimer	HHblits	X-ray	2.50Å	0.42	0.97	Glutamate Racemase
2ohg.1.A	44.79	homo-dimer	HHblits	X-ray	2.50Å	0.42	0.97	Glutamate racemase
2dwu.1.A	46.12	homo-dimer	BLAST	X-ray	1.60Å	0.42	0.97	Glutamate racemase
2dwu.2.A	46.12	homo-dimer	BLAST	X-ray	1.60Å	0.42	0.97	Glutamate racemase
2oho.1.A	44.75	homo-dimer	HHblits	X-ray	2.25Å	0.42	0.97	Glutamate Racemase
2oho.1.B	44.75	homo-dimer	HHblits	X-ray	2.25Å	0.42	0.97	Glutamate Racemase
2dwu.1.A	45.35	homo-dimer	HHblits	X-ray	1.60Å	0.41	0.97	Glutamate racemase
2dwu.2.A	45.35	homo-dimer	HHblits	X-ray	1.60Å	0.41	0.97	Glutamate racemase
2vvt.1.A	51.60	homo-dimer	BLAST	X-ray	1.65Å	0.43	0.94	GLUTAMATE RACEMASE
2vvt.1.B	51.60	homo-dimer	BLAST	X-ray	1.65Å	0.43	0.94	GLUTAMATE RACEMASE
2jfp.1.A	51.60	homo-dimer	BLAST	X-ray	1.98Å	0.43	0.94	GLUTAMATE RACEMASE
2jfo.1.B	51.60	homo-dimer	BLAST	X-ray	2.50Å	0.43	0.94	GLUTAMATE RACEMASE
5ijw.1.A	39.30	homo-dimer	HHblits	X-ray	1.76Å	0.38	0.97	Glutamate racemase
5ijw.1.B	39.30	homo-dimer	HHblits	X-ray	1.76Å	0.38	0.97	Glutamate racemase
5hj7.1.A	38.37	homo-dimer	HHblits	X-ray	2.30Å	0.38	0.97	Glutamate racemase
5ijw.1.A	41.60	homo-dimer	BLAST	X-ray	1.76Å	0.39	0.94	Glutamate racemase
5ijw.1.B	41.60	homo-dimer	BLAST	X-ray	1.76Å	0.39	0.94	Glutamate racemase
5hj7.1.A	40.16	homo-dimer	BLAST	X-ray	2.30Å	0.39	0.94	Glutamate racemase
2jfy.1.B	38.33	homo-dimer	BLAST	X-ray	1.90Å	0.39	0.90	GLUTAMATE RACEMASE
2jfz.1.A	38.33	homo-dimer	BLAST	X-ray	1.86Å	0.39	0.90	GLUTAMATE RACEMASE
2jfx.1.A	38.33	homo-dimer	BLAST	X-ray	2.30Å	0.39	0.90	GLUTAMATE RACEMASE
2jfx.1.B	38.33	homo-dimer	BLAST	X-ray	2.30Å	0.39	0.90	GLUTAMATE RACEMASE
2jfy.1.A	38.33	homo-dimer	BLAST	X-ray	1.90Å	0.39	0.90	GLUTAMATE RACEMASE
4b1f.1.B	38.33	homo-dimer	BLAST	X-ray	2.05Å	0.39	0.90	GLUTAMATE RACEMASE
2w4i.1.A	38.33	homo-tetramer	BLAST	X-ray	1.87Å	0.39	0.90	GLUTAMATE RACEMASE
2jfy.1.B	34.15	homo-dimer	HHblits	X-ray	1.90Å	0.37	0.92	GLUTAMATE RACEMASE
2jfz.1.A	34.15	homo-dimer	HHblits	X-ray	1.86Å	0.37	0.92	GLUTAMATE RACEMASE
2jfx.1.A	34.15	homo-dimer	HHblits	X-ray	2.30Å	0.37	0.92	GLUTAMATE RACEMASE
2jfx.1.B	34.15	homo-dimer	HHblits	X-ray	2.30Å	0.37	0.92	GLUTAMATE RACEMASE
2jfy.1.A	34.15	homo-dimer	HHblits	X-ray	1.90Å	0.37	0.92	GLUTAMATE RACEMASE
4b1f.1.B	34.15	homo-dimer	HHblits	X-ray	2.05Å	0.37	0.92	GLUTAMATE RACEMASE
2w4i.1.A	34.15	homo-tetramer	HHblits	X-ray	1.87Å	0.37	0.92	GLUTAMATE RACEMASE
3uho.1.A	39.83	monomer	BLAST	X-ray	2.20Å	0.40	0.89	Glutamate racemase
3uhf.2.A	39.83	monomer	BLAST	X-ray	1.83Å	0.40	0.89	Glutamate racemase
3uhp.1.A	39.83	monomer	BLAST	X-ray	2.79Å	0.40	0.89	Glutamate racemase
5w1q.1.A	34.96	homo-dimer	HHblits	X-ray	1.95Å	0.37	0.92	Glutamate racemase
5w1q.1.A	37.34	homo-dimer	BLAST	X-ray	1.95Å	0.38	0.91	Glutamate racemase
1b73.1.A	37.04	homo-dimer	HHblits	X-ray	2.30Å	0.38	0.91	GLUTAMATE RACEMASE
3out.1.A	31.84	homo-hexamer	HHblits	X-ray	1.65Å	0.37	0.92	Glutamate racemase
3uho.1.A	34.57	monomer	HHblits	X-ray	2.20Å	0.37	0.91	Glutamate racemase
3uhf.2.A	34.57	monomer	HHblits	X-ray	1.83Å	0.37	0.91	Glutamate racemase
3uhp.1.A	34.57	monomer	HHblits	X-ray	2.79Å	0.37	0.91	Glutamate racemase
3out.1.A	37.23	homo-hexamer	BLAST	X-ray	1.65Å	0.40	0.87	Glutamate racemase
2jfn.1.A	28.74	monomer	HHblits	X-ray	1.90Å	0.34	0.93	GLUTAMATE RACEMASE
2jfn.1.A	34.25	monomer	BLAST	X-ray	1.90Å	0.37	0.82	GLUTAMATE RACEMASE
1b73.1.A	44.72	homo-dimer	BLAST	X-ray	2.30Å	0.41	0.75	GLUTAMATE RACEMASE
2zsk.1.A	23.53	homo-dimer	HHblits	X-ray	2.55Å	0.31	0.77	226aa long hypothetical aspartate racemase
1jfl.1.A	20.87	homo-dimer	HHblits	X-ray	1.90Å	0.30	0.77	ASPARTATE RACEMASE
2dx7.1.A	20.39	homo-dimer	HHblits	X-ray	2.00Å	0.30	0.77	aspartate racemase
2dx7.1.B	20.39	homo-dimer	HHblits	X-ray	2.00Å	0.30	0.77	aspartate racemase
5ell.1.A	15.87	homo-dimer	HHblits	X-ray	1.80Å	0.28	0.78	Asp/Glu_racemase family protein
5ell.1.B	15.87	homo-dimer	HHblits	X-ray	1.80Å	0.28	0.78	Asp/Glu_racemase family protein
5hqt.1.A	15.87	homo-dimer	HHblits	X-ray	1.60Å	0.28	0.78	aspartate/glutamate racemase
3s81.1.A	15.53	homo-dimer	HHblits	X-ray	1.80Å	0.28	0.77	Putative aspartate racemase
4fq7.1.A	18.14	homo-tetramer	HHblits	X-ray	3.00Å	0.29	0.77	Maleate cis-trans isomerase
5elm.1.A	15.53	homo-dimer	HHblits	X-ray	2.00Å	0.28	0.77	Asp/Glu_racemase family protein
5elm.1.B	15.53	homo-dimer	HHblits	X-ray	2.00Å	0.28	0.77	Asp/Glu_racemase family protein
5elm.2.A	15.53	homo-dimer	HHblits	X-ray	2.00Å	0.28	0.77	Asp/Glu_racemase family protein
5elm.2.B	15.53	homo-dimer	HHblits	X-ray	2.00Å	0.28	0.77	Asp/Glu_racemase family protein
4fq5.1.A	17.65	homo-tetramer	HHblits	X-ray	2.10Å	0.28	0.77	Maleate cis-trans isomerase
4fq5.1.B	17.65	homo-tetramer	HHblits	X-ray	2.10Å	0.28	0.77	Maleate cis-trans isomerase
5b19.1.A	19.00	homo-dimer	HHblits	X-ray	1.85Å	0.29	0.75	Aspartate racemase
5b19.1.B	19.00	homo-dimer	HHblits	X-ray	1.85Å	0.29	0.75	Aspartate racemase
2eq5.1.A	19.90	homo-dimer	HHblits	X-ray	2.20Å	0.29	0.76	228aa long hypothetical hydantoin racemase
2eq5.2.B	19.90	homo-dimer	HHblits	X-ray	2.20Å	0.29	0.76	228aa long hypothetical hydantoin racemase
2ioy.1.A	14.93	monomer	HHblits	X-ray	1.90Å	0.28	0.76	Periplasmic sugar-binding protein
4ix1.1.A	15.53	homo-dimer	HHblits	X-ray	2.80Å	0.26	0.77	hypothetical protein
4ix1.1.B	15.53	homo-dimer	HHblits	X-ray	2.80Å	0.26	0.77	hypothetical protein
2dgd.1.A	15.35	homo-octamer	HHblits	X-ray	2.90Å	0.27	0.76	223aa long hypothetical arylmalonate decarboxylase
2xed.1.A	13.73	monomer	HHblits	X-ray	1.95Å	0.27	0.77	PUTATIVE MALEATE ISOMERASE
2xec.1.A	14.22	homo-dimer	HHblits	X-ray	2.20Å	0.27	0.77	PUTATIVE MALEATE ISOMERASE
4yv7.1.A	12.50	monomer	HHblits	X-ray	2.30Å	0.27	0.75	Periplasmic binding protein/LacI transcriptional regulator
1u6k.1.A	14.07	homo-hexamer	HHblits	X-ray	1.55Å	0.28	0.75	F420-dependent methylenetetrahydromethanopterin dehydrogenase
5bq3.1.A	14.36	monomer	HHblits	X-ray	2.60Å	0.26	0.76	Rhamnose ABC transporter, rhamnose-binding protein
5bq3.4.A	14.36	monomer	HHblits	X-ray	2.60Å	0.26	0.76	Rhamnose ABC transporter, rhamnose-binding protein
3rot.1.A	12.75	homo-dimer	HHblits	X-ray	1.91Å	0.25	0.77	ABC sugar transporter, periplasmic sugar binding protein
3ojc.1.A	18.97	homo-tetramer	HHblits	X-ray	1.75Å	0.29	0.73	Putative aspartate/glutamate racemase
3ojc.1.B	18.97	homo-tetramer	HHblits	X-ray	1.75Å	0.29	0.73	Putative aspartate/glutamate racemase
3ojc.1.C	18.97	homo-tetramer	HHblits	X-ray	1.75Å	0.29	0.73	Putative aspartate/glutamate racemase
3ojc.1.D	18.97	homo-tetramer	HHblits	X-ray	1.75Å	0.29	0.73	Putative aspartate/glutamate racemase
3ma0.1.A	10.89	monomer	HHblits	X-ray	2.20Å	0.26	0.76	D-xylose-binding periplasmic protein
3m9w.1.A	10.89	monomer	HHblits	X-ray	2.15Å	0.26	0.76	D-xylose-binding periplasmic protein
4wzz.1.A	10.84	monomer	HHblits	X-ray	1.70Å	0.25	0.76	Putative sugar ABC transporter, substrate-binding protein
3ixm.1.A	15.82	monomer	HHblits	X-ray	1.90Å	0.28	0.74	Arylmalonate decarboxylase
4y9t.1.A	10.95	monomer	HHblits	X-ray	1.80Å	0.26	0.76	ABC transporter, solute binding protein
1jhz.1.A	12.44	homo-dimer	HHblits	X-ray	2.40Å	0.26	0.76	PURINE NUCLEOTIDE SYNTHESIS REPRESSOR
1jhz.1.B	12.44	homo-dimer	HHblits	X-ray	2.40Å	0.26	0.76	PURINE NUCLEOTIDE SYNTHESIS REPRESSOR
5dkv.1.A	12.44	monomer	HHblits	X-ray	1.68Å	0.26	0.76	ABC transporter substrate binding protein (Ribose)
5dkv.4.A	12.44	monomer	HHblits	X-ray	1.68Å	0.26	0.76	ABC transporter substrate binding protein (Ribose)
4ry9.1.A	11.33	monomer	HHblits	X-ray	1.40Å	0.25	0.76	Periplasmic binding protein/LacI transcriptional regulator
3dtv.3.A	15.31	monomer	HHblits	X-ray	2.10Å	0.27	0.74	Arylmalonate decarboxylase
3dtv.2.A	15.31	monomer	HHblits	X-ray	2.10Å	0.27	0.74	Arylmalonate decarboxylase
3dtv.1.A	15.31	monomer	HHblits	X-ray	2.10Å	0.27	0.74	Arylmalonate decarboxylase
3dtv.4.A	15.31	monomer	HHblits	X-ray	2.10Å	0.27	0.74	Arylmalonate decarboxylase
3eis.1.A	15.31	monomer	HHblits	X-ray	2.10Å	0.27	0.74	Arylmalonate decarboxylase
3eis.2.A	15.31	monomer	HHblits	X-ray	2.10Å	0.27	0.74	Arylmalonate decarboxylase
2vlb.1.A	15.31	monomer	HHblits	X-ray	1.92Å	0.27	0.74	ARYLMALONATE DECARBOXYLASE
2vlb.2.A	15.31	monomer	HHblits	X-ray	1.92Å	0.27	0.74	ARYLMALONATE DECARBOXYLASE
2vlb.3.A	15.31	monomer	HHblits	X-ray	1.92Å	0.27	0.74	ARYLMALONATE DECARBOXYLASE
2vlb.4.A	15.31	monomer	HHblits	X-ray	1.92Å	0.27	0.74	ARYLMALONATE DECARBOXYLASE
4zjp.1.A	12.00	monomer	HHblits	X-ray	1.63Å	0.26	0.75	Monosaccharide-transporting ATPase
3dg9.1.A	14.80	monomer	HHblits	X-ray	1.50Å	0.27	0.74	Arylmalonate decarboxylase
3ixl.1.A	14.80	monomer	HHblits	X-ray	1.45Å	0.27	0.74	Arylmalonate decarboxylase
1bdh.1.B	12.56	homo-dimer	HHblits	X-ray	2.70Å	0.26	0.75	PROTEIN (PURINE REPRESSOR)
4rs3.1.A	10.00	monomer	HHblits	X-ray	1.40Å	0.25	0.75	ABC transporter, carbohydrate uptake transporter-2 (CUT2) family, periplasmic sugar-binding protein
1vpw.1.B	12.56	homo-dimer	HHblits	X-ray	2.70Å	0.26	0.75	PURINE REPRESSOR
2pug.1.B	12.06	homo-dimer	HHblits	X-ray	2.70Å	0.26	0.75	PROTEIN (PURINE REPRESSOR)
1jft.1.B	11.56	homo-dimer	HHblits	X-ray	2.50Å	0.26	0.75	PURINE NUCLEOTIDE SYNTHESIS REPRESSOR
1jye.1.A	10.50	homo-dimer	HHblits	X-ray	1.70Å	0.25	0.75	Lactose Operon Repressor
1jfs.1.B	11.00	homo-dimer	HHblits	X-ray	2.90Å	0.25	0.75	PURINE NUCLEOTIDE SYNTHESIS REPRESSOR
4ru1.1.A	12.63	monomer	HHblits	X-ray	1.50Å	0.26	0.74	Monosaccharide ABC transporter substrate-binding protein, CUT2 family
1jh9.1.B	12.12	homo-dimer	HHblits	X-ray	2.55Å	0.26	0.74	PURINE NUCLEOTIDE SYNTHESIS REPRESSOR
3qvj.1.A	16.32	homo-hexamer	HHblits	X-ray	2.10Å	0.28	0.71	Putative hydantoin racemase
5lfd.1.A	16.32	homo-hexamer	HHblits	X-ray	2.15Å	0.27	0.71	Allantoin racemase
3qvl.1.A	15.34	homo-hexamer	HHblits	X-ray	1.82Å	0.27	0.71	Putative hydantoin racemase
1jfl.1.A	26.62	homo-dimer	BLAST	X-ray	1.90Å	0.35	0.58	ASPARTATE RACEMASE
2q5c.1.A	13.02	monomer	HHblits	X-ray	1.49Å	0.26	0.64	NtrC family transcriptional regulator
4j9j.1.A	8.28	monomer	HHblits	X-ray	2.30Å	0.26	0.64	Imidazole glycerol phosphate synthase subunit HisF
2wjz.1.A	13.75	hetero-oligomer	HHblits	X-ray	2.60Å	0.27	0.60	IMIDAZOLE GLYCEROL PHOSPHATE SYNTHASE HISF
3zr4.2.A	13.75	hetero-oligomer	HHblits	X-ray	2.41Å	0.27	0.60	IMIDAZOLE GLYCEROL PHOSPHATE SYNTHASE SUBUNIT HISF
5tql.1.A	14.38	monomer	HHblits	X-ray	1.90Å	0.27	0.60	Imidazole glycerol phosphate synthase subunit HisF
2a0n.1.A	14.38	monomer	HHblits	X-ray	1.64Å	0.27	0.60	Imidazole glycerol phosphate synthase subunit hisF
2rkx.1.A	14.47	monomer	HHblits	X-ray	2.25Å	0.27	0.60	Cyclase subunit of imidazoleglycerol_evolvedcerolphosphate synthase
3iip.1.A	13.84	monomer	HHblits	X-ray	2.30Å	0.27	0.60	KE7 R6 3/7F
4ewn.1.A	13.84	monomer	HHblits	X-ray	1.90Å	0.27	0.60	Imidazole glycerol phosphate synthase subunit HisF
5ix8.1.A	10.56	monomer	HHblits	X-ray	1.60Å	0.26	0.61	Putative sugar ABC transport system, substrate-binding protein
1vh7.1.A	13.21	monomer	HHblits	X-ray	1.90Å	0.27	0.60	Imidazole glycerol phosphate synthase subunit hisF
5d33.1.A	12.66	homo-dimer	HHblits	X-ray	1.59Å	0.27	0.59	de novo kemp eliminase KE07 round 7
5d33.1.B	12.66	homo-dimer	HHblits	X-ray	1.59Å	0.27	0.59	de novo kemp eliminase KE07 round 7
3iiv.1.A	13.29	monomer	HHblits	X-ray	1.80Å	0.27	0.59	KE7 KE7_R7_1/3H
3iiv.2.A	13.29	monomer	HHblits	X-ray	1.80Å	0.27	0.59	KE7 KE7_R7_1/3H
1gpw.1.A	13.29	hetero-oligomer	HHblits	X-ray	2.40Å	0.27	0.59	HISF PROTEIN
1gpw.3.A	13.29	hetero-oligomer	HHblits	X-ray	2.40Å	0.27	0.59	HISF PROTEIN
4pz0.1.A	8.70	monomer	HHblits	X-ray	1.25Å	0.25	0.61	sugar ABC transporter, sugar-binding protein
5d37.1.A	13.29	homo-dimer	HHblits	X-ray	2.04Å	0.27	0.59	De novo kemp eliminase KE07 round 7
5d37.1.B	13.29	homo-dimer	HHblits	X-ray	2.04Å	0.27	0.59	De novo kemp eliminase KE07 round 7
5d32.1.A	13.29	homo-dimer	HHblits	X-ray	2.10Å	0.27	0.59	De novo kemp eliminase KE07 round 6
5d2y.1.A	13.29	monomer	HHblits	X-ray	1.98Å	0.27	0.59	De novo designed kemp eliminase KE07
1dbq.1.A	11.80	homo-dimer	HHblits	X-ray	2.20Å	0.25	0.61	PURINE REPRESSOR
1dbq.1.B	11.80	homo-dimer	HHblits	X-ray	2.20Å	0.25	0.61	PURINE REPRESSOR
1jx6.1.A	11.25	monomer	HHblits	X-ray	1.50Å	0.26	0.60	LUXP PROTEIN
4evz.1.A	13.21	monomer	HHblits	X-ray	1.46Å	0.26	0.60	HisF-LUCA
3g1w.1.A	9.94	homo-dimer	HHblits	X-ray	2.02Å	0.25	0.61	Sugar ABC transporter
1zhh.1.A	10.56	hetero-oligomer	HHblits	X-ray	1.94Å	0.25	0.61	Autoinducer 2-binding periplasmic protein luxP
4z08.1.A	13.38	monomer	HHblits	X-ray	1.80Å	0.27	0.59	de novo designed kemp eliminase KE07
5d38.1.A	12.74	homo-dimer	HHblits	X-ray	1.43Å	0.27	0.59	De novo kemp eliminase KE07 round 7-2
5d38.1.B	12.74	homo-dimer	HHblits	X-ray	1.43Å	0.27	0.59	De novo kemp eliminase KE07 round 7-2
4fx7.1.A	6.29	monomer	HHblits	X-ray	2.08Å	0.25	0.60	Imidazole glycerol phosphate synthase subunit HisF
3k9c.1.A	13.29	homo-dimer	HHblits	X-ray	2.14Å	0.25	0.59	Transcriptional regulator, LacI family protein
5g5i.1.A	13.29	monomer	HHblits	X-ray	2.00Å	0.25	0.59	?
5l6u.1.A	12.66	monomer	HHblits	X-ray	1.60Å	0.25	0.59	HisA
5ahe.1.A	13.29	monomer	HHblits	X-ray	1.70Å	0.25	0.59	?
5ac6.1.A	12.03	monomer	HHblits	X-ray	1.99Å	0.25	0.59	?
5ahf.1.A	13.38	monomer	HHblits	X-ray	2.20Å	0.26	0.59	?
5ab3.1.A	12.10	monomer	HHblits	X-ray	1.80Å	0.25	0.59	1-(5-PHOSPHORIBOSYL)-5-[(5-PHOSPHORIBOSYLAMINO)METHYLIDEN AMINO]IMIDAZOLE-4-CARBOXAMIDE ISOMERASE
4uqq.1.A	15.44	homo-tetramer	HHblits	EM	7.60Å	0.27	0.56	GLUTAMATE RECEPTOR IONOTROPIC, KAINATE 2
4uqq.1.B	15.44	homo-tetramer	HHblits	EM	7.60Å	0.27	0.56	GLUTAMATE RECEPTOR IONOTROPIC, KAINATE 2
3qlt.1.A	15.44	homo-dimer	HHblits	X-ray	2.99Å	0.27	0.56	Glutamate receptor, ionotropic kainate 2
3qlu.1.B	15.44	hetero-oligomer	HHblits	X-ray	2.91Å	0.27	0.56	Glutamate receptor, ionotropic kainate 2
4ccz.1.A	18.57	monomer	HHblits	X-ray	2.70Å	0.29	0.53	METHIONINE SYNTHASE
3qlv.1.C	14.69	hetero-oligomer	HHblits	X-ray	3.94Å	0.26	0.54	Glutamate receptor, ionotropic kainate 2
3h6g.1.A	14.69	homo-dimer	HHblits	X-ray	2.70Å	0.26	0.54	Glutamate receptor, ionotropic kainate 2
3h6h.1.A	14.69	homo-dimer	HHblits	X-ray	2.90Å	0.26	0.54	Glutamate receptor, ionotropic kainate 2
5dmm.1.A	12.23	monomer	HHblits	X-ray	1.78Å	0.26	0.52	Homocysteine S-methyltransferase
5dmn.1.A	12.23	homo-dimer	HHblits	X-ray	2.89Å	0.26	0.52	Homocysteine S-methyltransferase
1qo0.1.A	13.97	hetero-oligomer	HHblits	X-ray	2.25Å	0.27	0.51	AMIC
1pea.1.A	13.97	homo-dimer	HHblits	X-ray	2.10Å	0.27	0.51	AMIDASE OPERON
1qnl.1.A	13.14	homo-tetramer	HHblits	X-ray	2.70Å	0.26	0.52	ALIPHATIC AMIDASE EXPRESSION-REGULATING PROTEIN
4f06.1.A	17.56	monomer	HHblits	X-ray	1.30Å	0.28	0.49	Extracellular ligand-binding receptor
4mlc.1.A	10.45	monomer	HHblits	X-ray	2.71Å	0.27	0.50	Extracellular ligand-binding receptor
4q6b.1.A	10.45	monomer	HHblits	X-ray	1.67Å	0.27	0.50	Extracellular ligand-binding receptor
4evq.1.A	11.19	monomer	HHblits	X-ray	1.40Å	0.25	0.50	Putative ABC transporter subunit, substrate-binding component
3pef.1.A	10.61	homo-tetramer	HHblits	X-ray	2.07Å	0.26	0.50	6-phosphogluconate dehydrogenase, NAD-binding
3pef.2.C	10.61	homo-tetramer	HHblits	X-ray	2.07Å	0.26	0.50	6-phosphogluconate dehydrogenase, NAD-binding
2gf2.1.A	10.85	homo-dimer	HHblits	X-ray	2.38Å	0.26	0.48	3-hydroxyisobutyrate dehydrogenase
3d02.1.A	15.08	monomer	HHblits	X-ray	1.30Å	0.27	0.47	Putative LACI-type transcriptional regulator
3olz.1.A	11.63	homo-tetramer	HHblits	X-ray	2.75Å	0.25	0.48	Glutamate receptor, ionotropic kainate 3
3olz.1.B	11.63	homo-tetramer	HHblits	X-ray	2.75Å	0.25	0.48	Glutamate receptor, ionotropic kainate 3
3iio.1.A	16.00	monomer	HHblits	X-ray	2.25Å	0.27	0.47	KE07
4mwa.1.A	13.60	homo-tetramer	HHblits	X-ray	1.85Å	0.27	0.47	4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
4mwa.1.B	13.60	homo-tetramer	HHblits	X-ray	1.85Å	0.27	0.47	4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
4mwa.1.C	13.60	homo-tetramer	HHblits	X-ray	1.85Å	0.27	0.47	4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
4mwa.1.D	13.60	homo-tetramer	HHblits	X-ray	1.85Å	0.27	0.47	4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
4mwa.2.B	13.60	homo-tetramer	HHblits	X-ray	1.85Å	0.27	0.47	4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
4mwa.2.D	13.60	homo-tetramer	HHblits	X-ray	1.85Å	0.27	0.47	4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
1h5y.1.A	13.39	monomer	HHblits	X-ray	2.00Å	0.26	0.48	HISF
3t95.1.A	14.40	monomer	HHblits	X-ray	1.75Å	0.27	0.47	Autoinducer 2-binding protein lsrB
3gbv.1.A	11.29	homo-dimer	HHblits	X-ray	2.20Å	0.28	0.47	Putative LacI-family transcriptional regulator
3gbv.1.B	11.29	homo-dimer	HHblits	X-ray	2.20Å	0.28	0.47	Putative LacI-family transcriptional regulator
1thf.1.A	13.60	homo-dimer	HHblits	X-ray	1.45Å	0.27	0.47	HISF PROTEIN
4gj1.1.A	11.90	monomer	HHblits	X-ray	2.15Å	0.26	0.47	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase
3ks9.1.A	14.52	homo-dimer	HHblits	X-ray	1.90Å	0.27	0.47	Metabotropic glutamate receptor 1
4x2r.1.A	18.70	monomer	HHblits	X-ray	1.05Å	0.27	0.46	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase
4x9s.1.A	17.89	monomer	HHblits	X-ray	1.60Å	0.27	0.46	Phosphoribosyl isomerase A
3tdn.1.A	6.35	homo-dimer	HHblits	X-ray	1.40Å	0.25	0.47	FLR SYMMETRIC ALPHA-BETA TIM BARREL
5bra.1.A	11.20	monomer	HHblits	X-ray	2.97Å	0.26	0.47	Putative periplasmic binding protein with substrate ribose
1tlf.1.A	13.11	homo-tetramer	HHblits	X-ray	2.60Å	0.27	0.46	LAC REPRESSOR
1tlf.1.B	13.11	homo-tetramer	HHblits	X-ray	2.60Å	0.27	0.46	LAC REPRESSOR
1tlf.1.C	13.11	homo-tetramer	HHblits	X-ray	2.60Å	0.27	0.46	LAC REPRESSOR
1tlf.1.D	13.11	homo-tetramer	HHblits	X-ray	2.60Å	0.27	0.46	LAC REPRESSOR
4o5a.1.A	8.94	homo-dimer	HHblits	X-ray	1.78Å	0.26	0.46	LacI family transcription regulator
3og3.1.A	5.60	monomer	HHblits	X-ray	2.08Å	0.25	0.47	Imidazole glycerol phosphate synthase subunit hisF
4wd0.1.A	17.36	homo-hexamer	HHblits	X-ray	1.50Å	0.27	0.45	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase
4axk.1.A	16.39	monomer	HHblits	X-ray	2.25Å	0.26	0.46	1-(5-PHOSPHORIBOSYL)-5-((5'-PHOSPHORIBOSYLAMINO) METHYLIDENEAMINO)IMIDAZOLE-4-CARBOXAMIDE ISOMERASE
4axk.2.A	16.39	monomer	HHblits	X-ray	2.25Å	0.26	0.46	1-(5-PHOSPHORIBOSYL)-5-((5'-PHOSPHORIBOSYLAMINO) METHYLIDENEAMINO)IMIDAZOLE-4-CARBOXAMIDE ISOMERASE
2x30.1.A	17.50	monomer	HHblits	X-ray	1.95Å	0.27	0.45	PHOSPHORIBOSYL ISOMERASE A
3lft.1.A	15.13	monomer	HHblits	X-ray	1.35Å	0.28	0.45	uncharacterized protein
4rk5.1.A	14.29	homo-dimer	HHblits	X-ray	1.35Å	0.28	0.45	Transcriptional regulator, LacI family
1vzw.1.A	16.67	monomer	HHblits	X-ray	1.80Å	0.27	0.45	PHOSPHORIBOSYL ISOMERASE A
2vep.1.A	16.67	monomer	HHblits	X-ray	1.80Å	0.27	0.45	PHOSPHORIBOSYL ISOMERASE A
4u28.1.A	16.95	monomer	HHblits	X-ray	1.33Å	0.28	0.44	Phosphoribosyl isomerase A
2y85.1.A	13.93	monomer	HHblits	X-ray	2.40Å	0.25	0.46	PHOSPHORIBOSYL ISOMERASE A
3zs4.1.A	13.93	monomer	HHblits	X-ray	1.90Å	0.25	0.46	PHOSPHORIBOSYL ISOMERASE A
4tx9.1.A	16.10	monomer	HHblits	X-ray	1.60Å	0.28	0.44	Phosphoribosyl isomerase A
4wxe.1.A	14.41	monomer	HHblits	X-ray	1.50Å	0.27	0.44	Transcriptional regulator, LacI family
5dn1.1.A	16.81	monomer	HHblits	X-ray	1.95Å	0.27	0.45	Phosphoribosyl isomerase A
2y88.1.A	13.93	monomer	HHblits	X-ray	1.33Å	0.24	0.46	PHOSPHORIBOSYL ISOMERASE A
2y89.1.A	13.93	monomer	HHblits	X-ray	2.50Å	0.24	0.46	PHOSPHORIBOSYL ISOMERASE A
5ufh.1.A	10.08	homo-dimer	HHblits	X-ray	1.45Å	0.26	0.45	LacI-type transcriptional regulator
4evs.1.A	14.78	monomer	HHblits	X-ray	1.45Å	0.28	0.43	PUTATIVE ABC TRANSPORTER SUBUNIT, SUBSTRATE-BINDING COMPONENT
4obb.1.A	13.91	monomer	HHblits	X-ray	1.53Å	0.28	0.43	Amino acid/amide ABC transporter substrate-binding protein, HAAT family
1z16.1.A	13.91	monomer	HHblits	X-ray	1.72Å	0.27	0.43	Leu/Ile/Val-binding protein
1z15.1.A	13.91	monomer	HHblits	X-ray	1.70Å	0.27	0.43	Leu/Ile/Val-binding protein
3uk0.1.A	11.30	monomer	HHblits	X-ray	1.49Å	0.27	0.43	Extracellular ligand-binding receptor
3n0w.1.A	13.04	monomer	HHblits	X-ray	1.88Å	0.27	0.43	ABC branched chain amino acid family transporter, periplasmic ligand binding protein
3o21.2.A	6.72	homo-dimer	HHblits	X-ray	2.20Å	0.24	0.45	Glutamate receptor 3
3o21.1.B	6.72	homo-dimer	HHblits	X-ray	2.20Å	0.24	0.45	Glutamate receptor 3
3o21.1.A	6.72	homo-dimer	HHblits	X-ray	2.20Å	0.24	0.45	Glutamate receptor 3
3p3w.1.A	6.72	homo-dimer	HHblits	X-ray	4.20Å	0.24	0.45	Glutamate receptor 3
3p3w.1.B	6.72	homo-dimer	HHblits	X-ray	4.20Å	0.24	0.45	Glutamate receptor 3
3i09.1.A	16.67	monomer	HHblits	X-ray	1.80Å	0.27	0.43	Periplasmic branched-chain amino acid-binding protein
3tx6.1.A	8.77	monomer	HHblits	X-ray	1.50Å	0.26	0.43	Putative branched-chain amino acid transport system substrate-binding protein
4eyk.1.A	12.39	monomer	HHblits	X-ray	1.90Å	0.26	0.42	Twin-arginine translocation pathway signal
5bn3.1.B	19.63	hetero-oligomer	HHblits	X-ray	2.00Å	0.30	0.40	NEQ263
5bo5.1.A	19.63	monomer	HHblits	X-ray	2.81Å	0.30	0.40	NEQ263
3g1u.1.A	11.82	homo-tetramer	HHblits	X-ray	2.20Å	0.27	0.41	Adenosylhomocysteinase
1jfl.1.A	21.15	homo-dimer	HHblits	X-ray	1.90Å	0.31	0.39	ASPARTATE RACEMASE
1v8b.1.A	14.81	homo-tetramer	HHblits	X-ray	2.40Å	0.27	0.41	adenosylhomocysteinase
1iu9.1.A	18.87	monomer	HHblits	X-ray	2.04Å	0.29	0.40	aspartate racemase
4rk0.1.A	22.12	homo-dimer	HHblits	X-ray	1.80Å	0.29	0.39	LacI family sugar-binding transcriptional regulator
4rk0.1.B	22.12	homo-dimer	HHblits	X-ray	1.80Å	0.29	0.39	LacI family sugar-binding transcriptional regulator
2dx7.1.A	20.79	homo-dimer	HHblits	X-ray	2.00Å	0.30	0.38	aspartate racemase
2dx7.1.B	20.79	homo-dimer	HHblits	X-ray	2.00Å	0.30	0.38	aspartate racemase
1zuw.1.A	18.00	homo-dimer	HHblits	X-ray	1.75Å	0.30	0.38	glutamate racemase 1
1zuw.1.B	18.00	homo-dimer	HHblits	X-ray	1.75Å	0.30	0.38	glutamate racemase 1
3s81.1.A	11.76	homo-dimer	HHblits	X-ray	1.80Å	0.28	0.38	Putative aspartate racemase
5b19.1.A	15.69	homo-dimer	HHblits	X-ray	1.85Å	0.28	0.38	Aspartate racemase
5b19.1.B	15.69	homo-dimer	HHblits	X-ray	1.85Å	0.28	0.38	Aspartate racemase
5ijw.1.A	14.85	homo-dimer	HHblits	X-ray	1.76Å	0.29	0.38	Glutamate racemase
5ijw.1.B	14.85	homo-dimer	HHblits	X-ray	1.76Å	0.29	0.38	Glutamate racemase
2jfq.1.A	12.75	homo-dimer	HHblits	X-ray	2.15Å	0.28	0.38	GLUTAMATE RACEMASE
2jfq.1.B	12.75	homo-dimer	HHblits	X-ray	2.15Å	0.28	0.38	GLUTAMATE RACEMASE
3ojc.1.A	9.62	homo-tetramer	HHblits	X-ray	1.75Å	0.26	0.39	Putative aspartate/glutamate racemase
3ojc.1.B	9.62	homo-tetramer	HHblits	X-ray	1.75Å	0.26	0.39	Putative aspartate/glutamate racemase
3ojc.1.C	9.62	homo-tetramer	HHblits	X-ray	1.75Å	0.26	0.39	Putative aspartate/glutamate racemase
3ojc.1.D	9.62	homo-tetramer	HHblits	X-ray	1.75Å	0.26	0.39	Putative aspartate/glutamate racemase
3out.1.A	18.00	homo-hexamer	HHblits	X-ray	1.65Å	0.29	0.38	Glutamate racemase
5ell.1.A	12.62	homo-dimer	HHblits	X-ray	1.80Å	0.26	0.39	Asp/Glu_racemase family protein
5ell.1.B	12.62	homo-dimer	HHblits	X-ray	1.80Å	0.26	0.39	Asp/Glu_racemase family protein
2jfp.1.A	15.84	homo-dimer	HHblits	X-ray	1.98Å	0.28	0.38	GLUTAMATE RACEMASE
2jfo.1.B	15.84	homo-dimer	HHblits	X-ray	2.50Å	0.28	0.38	GLUTAMATE RACEMASE
5hqt.1.A	11.65	homo-dimer	HHblits	X-ray	1.60Å	0.26	0.39	aspartate/glutamate racemase
3g0o.1.A	11.88	homo-dimer	HHblits	X-ray	1.80Å	0.27	0.38	3-hydroxyisobutyrate dehydrogenase
2zsk.1.A	10.78	homo-dimer	HHblits	X-ray	2.55Å	0.26	0.38	226aa long hypothetical aspartate racemase
2ohv.1.A	17.17	homo-dimer	HHblits	X-ray	2.50Å	0.29	0.37	Glutamate Racemase
2ohg.1.A	17.17	homo-dimer	HHblits	X-ray	2.50Å	0.29	0.37	Glutamate racemase
5hj7.1.A	15.84	homo-dimer	HHblits	X-ray	2.30Å	0.27	0.38	Glutamate racemase
3hfr.1.A	10.89	homo-dimer	HHblits	X-ray	2.30Å	0.27	0.38	Glutamate racemase
3hfr.1.B	10.89	homo-dimer	HHblits	X-ray	2.30Å	0.27	0.38	Glutamate racemase
2oho.1.A	10.89	homo-dimer	HHblits	X-ray	2.25Å	0.26	0.38	Glutamate Racemase
2oho.1.B	10.89	homo-dimer	HHblits	X-ray	2.25Å	0.26	0.38	Glutamate Racemase
3qvl.1.A	14.00	homo-hexamer	HHblits	X-ray	1.82Å	0.27	0.38	Putative hydantoin racemase
5lfd.1.A	8.91	homo-hexamer	HHblits	X-ray	2.15Å	0.26	0.38	Allantoin racemase
5elm.1.A	9.62	homo-dimer	HHblits	X-ray	2.00Å	0.24	0.39	Asp/Glu_racemase family protein
5elm.1.B	9.62	homo-dimer	HHblits	X-ray	2.00Å	0.24	0.39	Asp/Glu_racemase family protein
5elm.2.A	9.62	homo-dimer	HHblits	X-ray	2.00Å	0.24	0.39	Asp/Glu_racemase family protein
5elm.2.B	9.62	homo-dimer	HHblits	X-ray	2.00Å	0.24	0.39	Asp/Glu_racemase family protein
2vvt.1.A	8.91	homo-dimer	HHblits	X-ray	1.65Å	0.26	0.38	GLUTAMATE RACEMASE
2vvt.1.B	8.91	homo-dimer	HHblits	X-ray	1.65Å	0.26	0.38	GLUTAMATE RACEMASE
5w1q.1.A	10.00	homo-dimer	HHblits	X-ray	1.95Å	0.27	0.38	Glutamate racemase
3q3c.1.A	14.14	homo-tetramer	HHblits	X-ray	2.30Å	0.27	0.37	Probable 3-hydroxyisobutyrate dehydrogenase
1vpd.1.A	14.14	monomer	HHblits	X-ray	1.65Å	0.27	0.37	TARTRONATE SEMIALDEHYDE REDUCTASE
3pdu.1.A	18.37	homo-tetramer	HHblits	X-ray	1.89Å	0.28	0.37	3-hydroxyisobutyrate dehydrogenase family protein
2jfw.1.A	11.00	homo-dimer	HHblits	X-ray	2.00Å	0.26	0.38	GLUTAMATE RACEMASE
3uho.1.A	12.00	monomer	HHblits	X-ray	2.20Å	0.26	0.38	Glutamate racemase
3uhf.2.A	12.00	monomer	HHblits	X-ray	1.83Å	0.26	0.38	Glutamate racemase
3uhp.1.A	12.00	monomer	HHblits	X-ray	2.79Å	0.26	0.38	Glutamate racemase
3ixm.1.A	12.24	monomer	HHblits	X-ray	1.90Å	0.27	0.37	Arylmalonate decarboxylase
2vlb.1.A	12.24	monomer	HHblits	X-ray	1.92Å	0.27	0.37	ARYLMALONATE DECARBOXYLASE
2vlb.2.A	12.24	monomer	HHblits	X-ray	1.92Å	0.27	0.37	ARYLMALONATE DECARBOXYLASE
2vlb.3.A	12.24	monomer	HHblits	X-ray	1.92Å	0.27	0.37	ARYLMALONATE DECARBOXYLASE
2vlb.4.A	12.24	monomer	HHblits	X-ray	1.92Å	0.27	0.37	ARYLMALONATE DECARBOXYLASE
3dg9.1.A	12.24	monomer	HHblits	X-ray	1.50Å	0.27	0.37	Arylmalonate decarboxylase
3obb.1.A	12.24	homo-tetramer	HHblits	X-ray	2.20Å	0.27	0.37	Probable 3-hydroxyisobutyrate dehydrogenase
3qha.1.A	13.27	homo-dimer	HHblits	X-ray	2.25Å	0.26	0.37	Putative oxidoreductase
2i9p.1.A	12.37	homo-tetramer	HHblits	X-ray	2.55Å	0.27	0.36	3-hydroxyisobutyrate dehydrogenase
3lq1.1.A	10.53	homo-dimer	HHblits	X-ray	2.60Å	0.28	0.36	2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase
5je8.1.B	7.14	homo-dimer	HHblits	X-ray	2.10Å	0.24	0.37	3-hydroxyisobutyrate dehydrogenase
5je8.1.A	7.14	homo-dimer	HHblits	X-ray	2.10Å	0.24	0.37	3-hydroxyisobutyrate dehydrogenase
2jfn.1.A	12.50	monomer	HHblits	X-ray	1.90Å	0.26	0.36	GLUTAMATE RACEMASE
3dtv.3.A	10.53	monomer	HHblits	X-ray	2.10Å	0.26	0.36	Arylmalonate decarboxylase
3dtv.2.A	10.53	monomer	HHblits	X-ray	2.10Å	0.26	0.36	Arylmalonate decarboxylase
3dtv.1.A	10.53	monomer	HHblits	X-ray	2.10Å	0.26	0.36	Arylmalonate decarboxylase
3dtv.4.A	10.53	monomer	HHblits	X-ray	2.10Å	0.26	0.36	Arylmalonate decarboxylase
3eis.1.A	10.53	monomer	HHblits	X-ray	2.10Å	0.26	0.36	Arylmalonate decarboxylase
3eis.2.A	10.53	monomer	HHblits	X-ray	2.10Å	0.26	0.36	Arylmalonate decarboxylase
4ffm.1.A	13.68	monomer	HHblits	X-ray	1.91Å	0.26	0.36	PylC
2pgd.1.A	6.19	homo-dimer	HHblits	X-ray	2.00Å	0.24	0.36	6-PHOSPHOGLUCONATE DEHYDROGENASE
4rcn.1.A	11.70	homo-hexamer	HHblits	X-ray	3.01Å	0.26	0.35	long-chain acyl-CoA carboxylase
4rcn.1.B	11.70	homo-hexamer	HHblits	X-ray	3.01Å	0.26	0.35	long-chain acyl-CoA carboxylase
3d4o.1.A	17.39	homo-dimer	HHblits	X-ray	2.10Å	0.27	0.35	Dipicolinate synthase subunit A
3d4o.1.B	17.39	homo-dimer	HHblits	X-ray	2.10Å	0.27	0.35	Dipicolinate synthase subunit A
2qk4.1.A	12.90	monomer	HHblits	X-ray	2.45Å	0.26	0.35	Trifunctional purine biosynthetic protein adenosine-3
2p4q.1.A	8.33	homo-dimer	HHblits	X-ray	2.37Å	0.23	0.36	6-phosphogluconate dehydrogenase, decarboxylating 1
5im5.1.P	13.19	hetero-oligomer	HHblits	X-ray	3.70Å	0.27	0.34	Designed Keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase
2r7k.1.A	18.18	homo-hexamer	HHblits	X-ray	2.10Å	0.30	0.33	5-formaminoimidazole-4-carboxamide-1-(beta)-D-ribofuranosyl 5'-monophosphate synthetase
3n6r.1.A	13.19	hetero-oligomer	HHblits	X-ray	3.20Å	0.27	0.34	Propionyl-CoA carboxylase, alpha subunit
4zht.1.A	13.04	homo-tetramer	HHblits	X-ray	2.69Å	0.26	0.35	Bifunctional UDP-N-acetylglucosamine 2-epimerase/N-acetylmannosamine kinase
3mjf.1.A	10.99	monomer	HHblits	X-ray	1.47Å	0.26	0.34	Phosphoribosylamine--glycine ligase
5k8k.1.A	17.05	monomer	HHblits	X-ray	2.55Å	0.28	0.33	UDP-2,3-diacylglucosamine hydrolase
2c00.1.A	8.60	monomer	HHblits	X-ray	2.50Å	0.24	0.35	BIOTIN CARBOXYLASE
2c00.2.A	8.60	monomer	HHblits	X-ray	2.50Å	0.24	0.35	BIOTIN CARBOXYLASE
2vqd.1.A	8.60	monomer	HHblits	X-ray	2.41Å	0.24	0.35	BIOTIN CARBOXYLASE
3i23.1.A	14.77	homo-dimer	HHblits	X-ray	2.30Å	0.28	0.33	Oxidoreductase, Gfo/Idh/MocA family
5h80.1.A	8.79	homo-dimer	HHblits	X-ray	1.70Å	0.25	0.34	Carboxylase
1rvg.1.B	10.99	homo-dimer	HHblits	X-ray	2.00Å	0.25	0.34	fructose-1,6-bisphosphate aldolase
1rvg.1.A	10.99	homo-dimer	HHblits	X-ray	2.00Å	0.25	0.34	fructose-1,6-bisphosphate aldolase
1gso.1.A	8.79	monomer	HHblits	X-ray	1.60Å	0.25	0.34	PROTEIN (GLYCINAMIDE RIBONUCLEOTIDE SYNTHETASE)
1vhc.1.A	17.24	homo-trimer	HHblits	X-ray	1.89Å	0.28	0.33	Putative KHG/KDPG aldolase
3lp8.1.A	17.05	monomer	HHblits	X-ray	2.15Å	0.27	0.33	Phosphoribosylamine-glycine ligase
3nt5.1.A	17.65	homo-tetramer	HHblits	X-ray	2.90Å	0.29	0.32	Inositol 2-dehydrogenase/D-chiro-inositol 3-dehydrogenase
4dll.1.A	10.23	homo-dimer	HHblits	X-ray	2.11Å	0.26	0.33	2-hydroxy-3-oxopropionate reductase
3ntr.1.A	17.65	homo-tetramer	HHblits	X-ray	2.65Å	0.29	0.32	Inositol 2-dehydrogenase/D-chiro-inositol 3-dehydrogenase
5tov.1.A	16.09	homo-tetramer	HHblits	X-ray	1.90Å	0.27	0.33	Adenosylhomocysteinase
5tov.1.B	16.09	homo-tetramer	HHblits	X-ray	1.90Å	0.27	0.33	Adenosylhomocysteinase
4qsl.1.A	13.79	homo-tetramer	HHblits	X-ray	3.28Å	0.27	0.33	Pyruvate carboxylase
4qsl.1.B	13.79	homo-tetramer	HHblits	X-ray	3.28Å	0.27	0.33	Pyruvate carboxylase
4qsl.1.C	13.79	homo-tetramer	HHblits	X-ray	3.28Å	0.27	0.33	Pyruvate carboxylase
4qsl.1.D	13.79	homo-tetramer	HHblits	X-ray	3.28Å	0.27	0.33	Pyruvate carboxylase
2r84.1.A	17.65	homo-trimer	HHblits	X-ray	1.90Å	0.29	0.32	PurP protein PF1517
2r87.1.A	17.65	homo-trimer	HHblits	X-ray	2.30Å	0.29	0.32	PurP protein PF1517
2yya.1.A	9.09	monomer	HHblits	X-ray	2.40Å	0.26	0.33	Phosphoribosylamine--glycine ligase
3g8d.1.A	11.11	monomer	HHblits	X-ray	1.90Å	0.24	0.34	Biotin carboxylase
1nvm.1.B	20.24	hetero-oligomer	HHblits	X-ray	1.70Å	0.30	0.32	acetaldehyde dehydrogenase (acylating)
1nvm.2.B	20.24	hetero-oligomer	HHblits	X-ray	1.70Å	0.30	0.32	acetaldehyde dehydrogenase (acylating)
4mio.1.A	16.28	homo-tetramer	HHblits	X-ray	1.50Å	0.28	0.32	Inositol 2-dehydrogenase/D-chiro-inositol 3-dehydrogenase
4mio.1.D	16.28	homo-tetramer	HHblits	X-ray	1.50Å	0.28	0.32	Inositol 2-dehydrogenase/D-chiro-inositol 3-dehydrogenase
2ys6.1.A	11.24	monomer	HHblits	X-ray	2.21Å	0.25	0.33	Phosphoribosylglycinamide synthetase
4mv4.2.A	8.99	monomer	HHblits	X-ray	1.61Å	0.25	0.33	Biotin carboxylase
4l9r.1.A	16.47	homo-tetramer	HHblits	X-ray	1.95Å	0.28	0.32	Inositol 2-dehydrogenase/D-chiro-inositol 3-dehydrogenase
3u9s.1.A	8.89	hetero-oligomer	HHblits	X-ray	3.50Å	0.24	0.34	Methylcrotonyl-CoA carboxylase, alpha-subunit
3u9t.1.A	8.89	hetero-oligomer	HHblits	X-ray	2.90Å	0.24	0.34	Methylcrotonyl-CoA carboxylase, alpha-subunit
2hjs.1.A	11.49	homo-dimer	HHblits	X-ray	2.20Å	0.26	0.33	USG-1 protein homolog
2ip4.1.A	10.11	monomer	HHblits	X-ray	2.80Å	0.25	0.33	Phosphoribosylamine--glycine ligase
2ip4.2.A	10.11	monomer	HHblits	X-ray	2.80Å	0.25	0.33	Phosphoribosylamine--glycine ligase
4l8v.1.A	16.47	homo-tetramer	HHblits	X-ray	2.09Å	0.28	0.32	Inositol 2-dehydrogenase/D-chiro-inositol 3-dehydrogenase
1z7e.1.B	5.49	homo-hexamer	HHblits	X-ray	3.00Å	0.23	0.34	protein ArnA
1z7e.1.A	5.49	homo-hexamer	HHblits	X-ray	3.00Å	0.23	0.34	protein ArnA
1z7e.1.F	5.49	homo-hexamer	HHblits	X-ray	3.00Å	0.23	0.34	protein ArnA
4wkg.1.D	5.49	homo-hexamer	HHblits	X-ray	2.70Å	0.23	0.34	Bifunctional polymyxin resistance protein ArnA
4wkg.1.E	5.49	homo-hexamer	HHblits	X-ray	2.70Å	0.23	0.34	Bifunctional polymyxin resistance protein ArnA
4wkg.1.F	5.49	homo-hexamer	HHblits	X-ray	2.70Å	0.23	0.34	Bifunctional polymyxin resistance protein ArnA
4wkg.1.B	5.49	homo-hexamer	HHblits	X-ray	2.70Å	0.23	0.34	Bifunctional polymyxin resistance protein ArnA
4wkg.1.C	5.49	homo-hexamer	HHblits	X-ray	2.70Å	0.23	0.34	Bifunctional polymyxin resistance protein ArnA
3moi.1.A	18.29	homo-dimer	HHblits	X-ray	2.50Å	0.30	0.31	Probable dehydrogenase
3rv3.1.A	8.99	homo-dimer	HHblits	X-ray	1.91Å	0.24	0.33	Biotin carboxylase
2jfy.1.B	12.94	homo-dimer	HHblits	X-ray	1.90Å	0.27	0.32	GLUTAMATE RACEMASE
2jfz.1.A	12.94	homo-dimer	HHblits	X-ray	1.86Å	0.27	0.32	GLUTAMATE RACEMASE
2jfx.1.A	12.94	homo-dimer	HHblits	X-ray	2.30Å	0.27	0.32	GLUTAMATE RACEMASE
2jfx.1.B	12.94	homo-dimer	HHblits	X-ray	2.30Å	0.27	0.32	GLUTAMATE RACEMASE
2jfy.1.A	12.94	homo-dimer	HHblits	X-ray	1.90Å	0.27	0.32	GLUTAMATE RACEMASE
4b1f.1.B	12.94	homo-dimer	HHblits	X-ray	2.05Å	0.27	0.32	GLUTAMATE RACEMASE
2w4i.1.A	12.94	homo-tetramer	HHblits	X-ray	1.87Å	0.27	0.32	GLUTAMATE RACEMASE
4r9x.1.A	14.46	homo-dimer	HHblits	X-ray	1.85Å	0.29	0.31	Copper homeostasis protein CutC
4r9x.1.B	14.46	homo-dimer	HHblits	X-ray	1.85Å	0.29	0.31	Copper homeostasis protein CutC
3g8c.1.A	8.99	monomer	HHblits	X-ray	2.00Å	0.23	0.33	Biotin carboxylase
3g8c.2.A	8.99	monomer	HHblits	X-ray	2.00Å	0.23	0.33	Biotin carboxylase
2xcl.1.A	9.20	monomer	HHblits	X-ray	2.10Å	0.25	0.33	PHOSPHORIBOSYLAMINE--GLYCINE LIGASE
3f4l.1.A	14.29	homo-dimer	HHblits	X-ray	2.00Å	0.28	0.32	Putative oxidoreductase yhhX
3hnp.1.A	16.47	homo-hexamer	HHblits	X-ray	2.60Å	0.27	0.32	Oxidoreductase
3hnp.1.D	16.47	homo-hexamer	HHblits	X-ray	2.60Å	0.27	0.32	Oxidoreductase
1kji.1.A	15.29	homo-dimer	HHblits	X-ray	1.60Å	0.26	0.32	phosphoribosylglycinamide formyltransferase 2
1kji.1.B	15.29	homo-dimer	HHblits	X-ray	1.60Å	0.26	0.32	phosphoribosylglycinamide formyltransferase 2
5gvj.1.A	17.28	homo-dimer	HHblits	X-ray	1.90Å	0.30	0.30	Enoyl-[acyl-carrier-protein] reductase [FMN]
3gfg.1.A	9.52	homo-dimer	HHblits	X-ray	2.59Å	0.27	0.32	Uncharacterized oxidoreductase yvaA
4kqc.1.A	17.28	monomer	HHblits	X-ray	1.62Å	0.29	0.30	Periplasmic binding protein/LacI transcriptional regulator
2ipl.1.A	19.51	monomer	HHblits	X-ray	1.20Å	0.28	0.31	D-galactose-binding periplasmic protein
1tm2.1.A	9.64	monomer	HHblits	X-ray	1.90Å	0.27	0.31	sugar transport protein
1tjy.1.A	9.64	monomer	HHblits	X-ray	1.30Å	0.27	0.31	sugar transport protein
3ejw.1.A	14.63	monomer	HHblits	X-ray	1.80Å	0.28	0.31	SmLsrB
4n54.1.A	15.85	homo-tetramer	HHblits	X-ray	2.05Å	0.28	0.31	Inositol dehydrogenase
4n54.1.C	15.85	homo-tetramer	HHblits	X-ray	2.05Å	0.28	0.31	Inositol dehydrogenase
4n54.1.D	15.85	homo-tetramer	HHblits	X-ray	2.05Å	0.28	0.31	Inositol dehydrogenase
3cea.1.A	13.25	homo-tetramer	HHblits	X-ray	2.40Å	0.27	0.31	Myo-inositol 2-dehydrogenase
4nv3.1.A	13.58	monomer	HHblits	X-ray	1.09Å	0.29	0.30	Amino acid/amide ABC transporter substrate-binding protein, HAAT family
5gta.1.A	8.43	monomer	HHblits	X-ray	3.00Å	0.27	0.31	Autoinducer 2-binding protein LsrB
2hph.1.A	18.29	monomer	HHblits	X-ray	1.33Å	0.27	0.31	D-galactose-binding periplasmic protein
2ehj.1.A	13.75	homo-tetramer	HHblits	X-ray	2.80Å	0.29	0.30	Uracil phosphoribosyltransferase
2ehj.1.C	13.75	homo-tetramer	HHblits	X-ray	2.80Å	0.29	0.30	Uracil phosphoribosyltransferase
3rcb.1.A	13.41	monomer	HHblits	X-ray	2.49Å	0.27	0.31	Sugar 3-ketoreductase
3bo9.1.A	17.72	homo-dimer	HHblits	X-ray	2.71Å	0.30	0.30	Putative nitroalkan dioxygenase
5gvh.1.A	17.72	homo-dimer	HHblits	X-ray	2.29Å	0.30	0.30	Enoyl-[acyl-carrier-protein] reductase [FMN]
3vot.1.A	12.05	monomer	HHblits	X-ray	1.80Å	0.26	0.31	L-amino acid ligase, BL00235
3vot.2.A	12.05	monomer	HHblits	X-ray	1.80Å	0.26	0.31	L-amino acid ligase, BL00235
3ec7.1.A	11.25	homo-tetramer	HHblits	X-ray	2.15Å	0.29	0.30	Putative Dehydrogenase
1ka9.1.B	18.75	hetero-oligomer	HHblits	X-ray	2.30Å	0.29	0.30	imidazole glycerol phosphate synthase
4gnr.1.A	15.00	monomer	HHblits	X-ray	1.00Å	0.29	0.30	ABC transporter substrate-binding protein-branched chain amino acid transport
4jb0.1.A	12.05	monomer	HHblits	X-ray	1.91Å	0.26	0.31	branched-chain amino acid transport system substrate-binding protein
4wwh.1.A	18.99	monomer	HHblits	X-ray	1.20Å	0.29	0.30	ABC transporter
3rc1.1.A	16.46	monomer	HHblits	X-ray	1.71Å	0.29	0.30	Sugar 3-ketoreductase
3rc9.1.A	10.98	monomer	HHblits	X-ray	1.91Å	0.26	0.31	Sugar 3-ketoreductase
4maa.1.A	13.25	monomer	HHblits	X-ray	2.00Å	0.25	0.31	Putative branched-chain amino acid ABC transporter, periplasmic amino acid-binding protein
4nv3.1.A	8.54	monomer	HHblits	X-ray	1.09Å	0.26	0.31	Amino acid/amide ABC transporter substrate-binding protein, HAAT family
2pud.1.B	12.50	homo-dimer	HHblits	X-ray	2.60Å	0.28	0.30	PROTEIN (PURINE REPRESSOR)
1b73.1.A	13.75	homo-dimer	HHblits	X-ray	2.30Å	0.28	0.30	GLUTAMATE RACEMASE
1glg.1.A	18.75	monomer	HHblits	X-ray	2.00Å	0.28	0.30	GALACTOSE/GLUCOSE-BINDING PROTEIN
2qw1.1.A	18.75	monomer	HHblits	X-ray	1.70Å	0.28	0.30	D-galactose-binding periplasmic protein
2fvy.1.A	18.75	monomer	HHblits	X-ray	0.92Å	0.28	0.30	D-galactose-binding periplasmic protein
4gud.1.A	14.10	monomer	HHblits	X-ray	1.91Å	0.29	0.29	Imidazole glycerol phosphate synthase subunit HisH
3i45.1.A	9.52	monomer	HHblits	X-ray	1.36Å	0.23	0.32	Twin-arginine translocation pathway signal protein
3hut.1.A	17.72	monomer	HHblits	X-ray	1.93Å	0.28	0.30	putative branched-chain amino acid ABC transporter
1efa.1.C	11.25	homo-dimer	HHblits	X-ray	2.60Å	0.27	0.30	LAC REPRESSOR
1jwl.1.D	11.25	homo-dimer	HHblits	X-ray	4.00Å	0.27	0.30	Lactose Operon Repressor
1xtu.1.A	8.75	homo-tetramer	HHblits	X-ray	2.80Å	0.27	0.30	Probable uracil phosphoribosyltransferase
3g6w.1.A	8.75	homo-tetramer	HHblits	X-ray	2.90Å	0.27	0.30	Uracil phosphoribosyltransferase
3g6w.1.B	8.75	homo-tetramer	HHblits	X-ray	2.90Å	0.27	0.30	Uracil phosphoribosyltransferase
1xtv.1.B	8.75	homo-tetramer	HHblits	X-ray	2.60Å	0.27	0.30	Probable uracil phosphoribosyltransferase
1xtv.1.C	8.75	homo-tetramer	HHblits	X-ray	2.60Å	0.27	0.30	Probable uracil phosphoribosyltransferase
1xtt.1.A	8.75	homo-tetramer	HHblits	X-ray	1.80Å	0.27	0.30	Probable uracil phosphoribosyltransferase
1xtt.1.B	8.75	homo-tetramer	HHblits	X-ray	1.80Å	0.27	0.30	Probable uracil phosphoribosyltransferase
1vst.1.A	8.75	homo-tetramer	HHblits	X-ray	2.80Å	0.27	0.30	Uracil phosphoribosyltransferase
2ipm.1.A	17.50	monomer	HHblits	X-ray	1.12Å	0.27	0.30	D-galactose-binding periplasmic protein
2qvc.1.A	17.72	homo-dimer	HHblits	X-ray	2.40Å	0.28	0.30	Sugar ABC transporter, periplasmic sugar-binding protein
3qlv.1.C	11.39	hetero-oligomer	HHblits	X-ray	3.94Å	0.28	0.30	Glutamate receptor, ionotropic kainate 2
3h6g.1.A	11.39	homo-dimer	HHblits	X-ray	2.70Å	0.28	0.30	Glutamate receptor, ionotropic kainate 2
3h6h.1.A	11.39	homo-dimer	HHblits	X-ray	2.90Å	0.28	0.30	Glutamate receptor, ionotropic kainate 2
1bdi.1.B	12.66	homo-dimer	HHblits	X-ray	3.00Å	0.28	0.30	PROTEIN (PURINE REPRESSOR)
1ez1.1.A	17.72	homo-dimer	HHblits	X-ray	1.75Å	0.28	0.30	PHOSPHORIBOSYLGLYCINAMIDE FORMYLTRANSFERASE 2
1ez1.1.B	17.72	homo-dimer	HHblits	X-ray	1.75Å	0.28	0.30	PHOSPHORIBOSYLGLYCINAMIDE FORMYLTRANSFERASE 2
3h5l.1.A	12.20	monomer	HHblits	X-ray	1.70Å	0.25	0.31	putative Branched-chain amino acid ABC transporter
3ax6.1.A	18.18	homo-dimer	HHblits	X-ray	2.20Å	0.29	0.29	Phosphoribosylaminoimidazole carboxylase, ATPase subunit
3ax6.1.B	18.18	homo-dimer	HHblits	X-ray	2.20Å	0.29	0.29	Phosphoribosylaminoimidazole carboxylase, ATPase subunit
3ax6.2.B	18.18	homo-dimer	HHblits	X-ray	2.20Å	0.29	0.29	Phosphoribosylaminoimidazole carboxylase, ATPase subunit
1vh7.1.A	7.59	monomer	HHblits	X-ray	1.90Å	0.27	0.30	Imidazole glycerol phosphate synthase subunit hisF
1vgv.1.B	13.75	homo-dimer	HHblits	X-ray	2.31Å	0.26	0.30	UDP-N-acetylglucosamine 2-epimerase
1vgv.1.A	13.75	homo-dimer	HHblits	X-ray	2.31Å	0.26	0.30	UDP-N-acetylglucosamine 2-epimerase
1vgv.2.B	13.75	homo-dimer	HHblits	X-ray	2.31Å	0.26	0.30	UDP-N-acetylglucosamine 2-epimerase
4irx.1.A	14.10	monomer	HHblits	X-ray	1.45Å	0.28	0.29	Sugar ABC transporter, periplasmic sugar-binding protein
2w6m.1.A	9.64	monomer	HHblits	X-ray	2.00Å	0.23	0.31	BIOTIN CARBOXYLASE
1bnc.1.B	9.64	homo-dimer	HHblits	X-ray	2.40Å	0.23	0.31	BIOTIN CARBOXYLASE
1bnc.1.A	9.64	homo-dimer	HHblits	X-ray	2.40Å	0.23	0.31	BIOTIN CARBOXYLASE
4hr7.1.A	9.64	hetero-oligomer	HHblits	X-ray	2.50Å	0.23	0.31	Biotin carboxylase
4hr7.1.C	9.64	hetero-oligomer	HHblits	X-ray	2.50Å	0.23	0.31	Biotin carboxylase
4hr7.1.E	9.64	hetero-oligomer	HHblits	X-ray	2.50Å	0.23	0.31	Biotin carboxylase
4hr7.1.F	9.64	hetero-oligomer	HHblits	X-ray	2.50Å	0.23	0.31	Biotin carboxylase
2j9g.2.A	9.64	monomer	HHblits	X-ray	2.05Å	0.23	0.31	BIOTIN CARBOXYLASE
2vr1.2.A	9.64	monomer	HHblits	X-ray	2.60Å	0.23	0.31	BIOTIN CARBOXYLASE
4gj1.1.A	11.39	monomer	HHblits	X-ray	2.15Å	0.27	0.30	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase
2wrz.1.A	15.19	monomer	HHblits	X-ray	2.20Å	0.27	0.30	L-ARABINOSE-BINDING PERIPLASMIC PROTEIN
2wrz.2.A	15.19	monomer	HHblits	X-ray	2.20Å	0.27	0.30	L-ARABINOSE-BINDING PERIPLASMIC PROTEIN
1f6d.1.B	13.75	homo-dimer	HHblits	X-ray	2.50Å	0.26	0.30	UDP-N-ACETYLGLUCOSAMINE 2-EPIMERASE
1f6d.1.A	13.75	homo-dimer	HHblits	X-ray	2.50Å	0.26	0.30	UDP-N-ACETYLGLUCOSAMINE 2-EPIMERASE
3hsy.1.A	9.76	homo-dimer	HHblits	X-ray	1.75Å	0.24	0.31	Glutamate receptor 2
3hsy.1.B	9.76	homo-dimer	HHblits	X-ray	1.75Å	0.24	0.31	Glutamate receptor 2
5d32.1.A	8.86	homo-dimer	HHblits	X-ray	2.10Å	0.27	0.30	De novo kemp eliminase KE07 round 6
4j9j.1.A	5.00	monomer	HHblits	X-ray	2.30Å	0.25	0.30	Imidazole glycerol phosphate synthase subunit HisF
3g85.1.A	18.18	monomer	HHblits	X-ray	1.84Å	0.28	0.29	Transcriptional regulator (LacI family)
3q2i.1.A	11.54	homo-octamer	HHblits	X-ray	1.50Å	0.27	0.29	dehydrogenase
4iq0.1.A	12.66	homo-dimer	HHblits	X-ray	2.00Å	0.26	0.30	Oxidoreductase, Gfo/Idh/MocA family
4iq0.2.B	12.66	homo-dimer	HHblits	X-ray	2.00Å	0.26	0.30	Oxidoreductase, Gfo/Idh/MocA family
1qh1.1.B	15.58	hetero-oligomer	HHblits	X-ray	1.60Å	0.28	0.29	PROTEIN (NITROGENASE MOLYBDENUM IRON PROTEIN)
3n0w.1.A	12.66	monomer	HHblits	X-ray	1.88Å	0.26	0.30	ABC branched chain amino acid family transporter, periplasmic ligand binding protein
4pz9.1.B	20.27	homo-dimer	HHblits	X-ray	1.94Å	0.31	0.28	Glucosyl-3-phosphoglycerate phosphatase
4pz9.1.A	20.27	homo-dimer	HHblits	X-ray	1.94Å	0.31	0.28	Glucosyl-3-phosphoglycerate phosphatase
4pza.1.B	20.27	homo-dimer	HHblits	X-ray	1.78Å	0.31	0.28	Glucosyl-3-phosphoglycerate phosphatase
2h0a.1.A	12.82	homo-dimer	HHblits	X-ray	2.80Å	0.27	0.29	Transcriptional regulator
2ho5.1.A	11.39	homo-dimer	HHblits	X-ray	2.56Å	0.26	0.30	Oxidoreductase, Gfo/Idh/MocA family
4z0n.1.A	11.39	monomer	HHblits	X-ray	1.26Å	0.26	0.30	Periplasmic binding protein/LacI transcriptional regulator
3iio.1.A	10.39	monomer	HHblits	X-ray	2.25Å	0.28	0.29	KE07
4kvf.1.A	12.82	monomer	HHblits	X-ray	1.72Å	0.27	0.29	Rhamnose ABC transporter, periplasmic rhamnose-binding protein
4ewn.1.A	6.41	monomer	HHblits	X-ray	1.90Å	0.26	0.29	Imidazole glycerol phosphate synthase subunit HisF
2a0n.1.A	7.79	monomer	HHblits	X-ray	1.64Å	0.27	0.29	Imidazole glycerol phosphate synthase subunit hisF
4jb0.1.A	10.26	monomer	HHblits	X-ray	1.91Å	0.26	0.29	branched-chain amino acid transport system substrate-binding protein
5d2y.1.A	7.79	monomer	HHblits	X-ray	1.98Å	0.27	0.29	De novo designed kemp eliminase KE07
5tql.1.A	7.79	monomer	HHblits	X-ray	1.90Å	0.27	0.29	Imidazole glycerol phosphate synthase subunit HisF
5d33.1.A	9.09	homo-dimer	HHblits	X-ray	1.59Å	0.27	0.29	de novo kemp eliminase KE07 round 7
5d33.1.B	9.09	homo-dimer	HHblits	X-ray	1.59Å	0.27	0.29	de novo kemp eliminase KE07 round 7
4joq.1.A	15.79	homo-dimer	HHblits	X-ray	1.90Å	0.28	0.29	ABC ribose transporter, periplasmic solute-binding protein
4ycs.1.A	11.69	monomer	HHblits	X-ray	1.98Å	0.26	0.29	Uncharacterized protein
4ycs.2.A	11.69	monomer	HHblits	X-ray	1.98Å	0.26	0.29	Uncharacterized protein
4uqj.1.A	8.75	homo-tetramer	HHblits	EM	10.40Å	0.23	0.30	GLUTAMATE RECEPTOR 2
4uqj.1.B	8.75	homo-tetramer	HHblits	EM	10.40Å	0.23	0.30	GLUTAMATE RECEPTOR 2
4uqj.1.C	8.75	homo-tetramer	HHblits	EM	10.40Å	0.23	0.30	GLUTAMATE RECEPTOR 2
4uqj.1.D	8.75	homo-tetramer	HHblits	EM	10.40Å	0.23	0.30	GLUTAMATE RECEPTOR 2
1thf.1.A	7.89	homo-dimer	HHblits	X-ray	1.45Å	0.27	0.29	HISF PROTEIN
2y85.1.A	12.82	monomer	HHblits	X-ray	2.40Å	0.25	0.29	PHOSPHORIBOSYL ISOMERASE A
3zs4.1.A	12.82	monomer	HHblits	X-ray	1.90Å	0.25	0.29	PHOSPHORIBOSYL ISOMERASE A
2wjz.1.A	7.89	hetero-oligomer	HHblits	X-ray	2.60Å	0.27	0.29	IMIDAZOLE GLYCEROL PHOSPHATE SYNTHASE HISF
3zr4.2.A	7.89	hetero-oligomer	HHblits	X-ray	2.41Å	0.27	0.29	IMIDAZOLE GLYCEROL PHOSPHATE SYNTHASE SUBUNIT HISF
4u5b.1.A	8.75	hetero-oligomer	HHblits	X-ray	3.50Å	0.23	0.30	Glutamate receptor 2
4u5b.1.B	8.75	hetero-oligomer	HHblits	X-ray	3.50Å	0.23	0.30	Glutamate receptor 2
4u5b.1.C	8.75	hetero-oligomer	HHblits	X-ray	3.50Å	0.23	0.30	Glutamate receptor 2
4u5b.1.D	8.75	hetero-oligomer	HHblits	X-ray	3.50Å	0.23	0.30	Glutamate receptor 2
1gpw.1.A	7.89	hetero-oligomer	HHblits	X-ray	2.40Å	0.27	0.29	HISF PROTEIN
1gpw.3.A	7.89	hetero-oligomer	HHblits	X-ray	2.40Å	0.27	0.29	HISF PROTEIN
5ide.1.A	10.00	hetero-oligomer	HHblits	EM	NA	0.23	0.30	Glutamate receptor 2
5ide.1.C	10.00	hetero-oligomer	HHblits	EM	NA	0.23	0.30	Glutamate receptor 2
5idf.1.A	10.00	hetero-oligomer	HHblits	EM	NA	0.23	0.30	Glutamate receptor 2
5idf.1.C	10.00	hetero-oligomer	HHblits	EM	NA	0.23	0.30	Glutamate receptor 2
4u5f.1.A	10.13	hetero-oligomer	HHblits	X-ray	3.70Å	0.23	0.30	Glutamate receptor 2
4u5f.1.B	10.13	hetero-oligomer	HHblits	X-ray	3.70Å	0.23	0.30	Glutamate receptor 2
4u5f.1.C	10.13	hetero-oligomer	HHblits	X-ray	3.70Å	0.23	0.30	Glutamate receptor 2
4u5f.1.D	10.13	hetero-oligomer	HHblits	X-ray	3.70Å	0.23	0.30	Glutamate receptor 2
4x9s.1.A	12.82	monomer	HHblits	X-ray	1.60Å	0.24	0.29	Phosphoribosyl isomerase A
2y88.1.A	12.99	monomer	HHblits	X-ray	1.33Å	0.25	0.29	PHOSPHORIBOSYL ISOMERASE A
2y89.1.A	12.99	monomer	HHblits	X-ray	2.50Å	0.25	0.29	PHOSPHORIBOSYL ISOMERASE A
5fwy.1.A	7.89	hetero-oligomer	HHblits	X-ray	2.12Å	0.26	0.29	GLUTAMATE RECEPTOR 2
5fwx.2.A	7.89	hetero-oligomer	HHblits	X-ray	2.50Å	0.26	0.29	GLUTAMATE RECEPTOR 2
5fwx.1.A	7.89	hetero-oligomer	HHblits	X-ray	2.50Å	0.26	0.29	GLUTAMATE RECEPTOR 2
3cwo.1.A	10.53	homo-dimer	HHblits	X-ray	3.10Å	0.26	0.29	beta/alpha-barrel protein based on 1THF and 1TMY
3hsy.1.A	6.49	homo-dimer	HHblits	X-ray	1.75Å	0.25	0.29	Glutamate receptor 2
3hsy.1.B	6.49	homo-dimer	HHblits	X-ray	1.75Å	0.25	0.29	Glutamate receptor 2
5vev.1.A	6.49	monomer	HHblits	X-ray	1.90Å	0.25	0.29	Phosphoribosylamine--glycine ligase
3p74.1.A	13.33	monomer	HHblits	X-ray	1.20Å	0.27	0.28	Pentaerythritol tetranitrate reductase
2abb.1.A	13.33	monomer	HHblits	X-ray	1.00Å	0.27	0.28	pentaerythritol tetranitrate reductase
1vys.1.A	13.33	monomer	HHblits	X-ray	1.80Å	0.27	0.28	PENTAERYTHRITOL TETRANITRATE REDUCTASE
3p67.1.A	13.51	monomer	HHblits	X-ray	1.50Å	0.27	0.28	Pentaerythritol tetranitrate reductase
5lfa.1.A	13.33	monomer	HHblits	X-ray	2.50Å	0.26	0.28	(6-4) photolyase
2aba.1.A	12.33	monomer	HHblits	X-ray	1.05Å	0.28	0.27	pentaerythritol tetranitrate reductase
3p81.1.A	12.33	monomer	HHblits	X-ray	1.20Å	0.27	0.27	Pentaerythritol tetranitrate reductase
3p8i.1.A	12.33	monomer	HHblits	X-ray	1.19Å	0.27	0.27	Pentaerythritol tetranitrate reductase
3p62.1.A	12.33	monomer	HHblits	X-ray	1.40Å	0.27	0.27	Pentaerythritol tetranitrate reductase
3p8j.1.A	12.33	monomer	HHblits	X-ray	1.00Å	0.27	0.27	Pentaerythritol tetranitrate reductase
5kuh.1.A	10.96	homo-tetramer	HHblits	EM	NA	0.27	0.27	Glutamate receptor ionotropic, kainate 2
5kuh.1.B	10.96	homo-tetramer	HHblits	EM	NA	0.27	0.27	Glutamate receptor ionotropic, kainate 2
2qiw.1.A	12.16	homo-dimer	HHblits	X-ray	1.80Å	0.26	0.28	PEP phosphonomutase
1vyp.1.A	12.33	monomer	HHblits	X-ray	1.27Å	0.27	0.27	PENTAERYTHRITOL TETRANITRATE REDUCTASE
3og3.1.A	5.41	monomer	HHblits	X-ray	2.08Å	0.26	0.28	Imidazole glycerol phosphate synthase subunit hisF
3p82.1.A	12.33	monomer	HHblits	X-ray	2.20Å	0.27	0.27	Pentaerythritol tetranitrate reductase
3p84.1.A	12.33	monomer	HHblits	X-ray	1.10Å	0.27	0.27	Pentaerythritol tetranitrate reductase
5lgx.1.A	10.96	monomer	HHblits	X-ray	1.50Å	0.27	0.27	Pentaerythritol tetranitrate reductase
4ab4.1.A	13.33	monomer	HHblits	X-ray	1.50Å	0.25	0.28	XENOBIOTIC REDUCTASE B
3qlt.1.A	11.11	homo-dimer	HHblits	X-ray	2.99Å	0.28	0.27	Glutamate receptor, ionotropic kainate 2
3qlu.1.B	11.11	hetero-oligomer	HHblits	X-ray	2.91Å	0.28	0.27	Glutamate receptor, ionotropic kainate 2
3gka.1.A	14.67	monomer	HHblits	X-ray	2.30Å	0.24	0.28	N-ethylmaleimide reductase
5fwy.1.B	15.49	hetero-oligomer	HHblits	X-ray	2.12Å	0.28	0.27	GLUTAMATE RECEPTOR 3
1m1b.1.A	12.50	homo-tetramer	HHblits	X-ray	2.25Å	0.27	0.27	PHOSPHOENOLPYRUVATE PHOSPHOMUTASE
1s2v.1.A	12.50	homo-tetramer	HHblits	X-ray	2.10Å	0.27	0.27	Phosphoenolpyruvate phosphomutase
1s2w.1.A	12.50	monomer	HHblits	X-ray	1.69Å	0.27	0.27	Phosphoenolpyruvate phosphomutase
4nas.1.A	15.94	homo-dimer	HHblits	X-ray	1.92Å	0.30	0.26	Ribulose-bisphosphate carboxylase
3n0x.1.A	10.81	monomer	HHblits	X-ray	1.50Å	0.24	0.28	Possible substrate binding protein of ABC transporter system
3saj.1.A	14.08	homo-dimer	HHblits	X-ray	2.50Å	0.28	0.27	Glutamate receptor 1
3saj.1.B	14.08	homo-dimer	HHblits	X-ray	2.50Å	0.28	0.27	Glutamate receptor 1
3saj.2.A	14.08	homo-dimer	HHblits	X-ray	2.50Å	0.28	0.27	Glutamate receptor 1
3saj.2.B	14.08	homo-dimer	HHblits	X-ray	2.50Å	0.28	0.27	Glutamate receptor 1
4iyj.1.A	20.59	homo-dimer	HHblits	X-ray	1.37Å	0.31	0.26	GDSL-like protein
3aw8.1.A	10.81	homo-dimer	HHblits	X-ray	2.60Å	0.24	0.28	Phosphoribosylaminoimidazole carboxylase, ATPase subunit
3t8q.1.A	18.84	homo-dimer	HHblits	X-ray	2.00Å	0.29	0.26	Mandelate racemase/muconate lactonizing enzyme family protein
2eq5.1.A	17.65	homo-dimer	HHblits	X-ray	2.20Å	0.30	0.26	228aa long hypothetical hydantoin racemase
2eq5.2.B	17.65	homo-dimer	HHblits	X-ray	2.20Å	0.30	0.26	228aa long hypothetical hydantoin racemase
3wgi.1.B	12.50	homo-dimer	HHblits	X-ray	3.25Å	0.26	0.27	Redox-sensing transcriptional repressor rex
3wg9.2.A	12.50	homo-dimer	HHblits	X-ray	1.97Å	0.26	0.27	Redox-sensing transcriptional repressor rex
3wg9.2.B	12.50	homo-dimer	HHblits	X-ray	1.97Å	0.26	0.27	Redox-sensing transcriptional repressor rex
3wgh.1.B	12.50	homo-dimer	HHblits	X-ray	2.05Å	0.26	0.27	Redox-sensing transcriptional repressor rex
3wgg.1.A	12.50	homo-dimer	HHblits	X-ray	2.10Å	0.26	0.27	Redox-sensing transcriptional repressor rex
3wgg.1.B	12.50	homo-dimer	HHblits	X-ray	2.10Å	0.26	0.27	Redox-sensing transcriptional repressor rex
3t9p.1.A	18.84	homo-dimer	HHblits	X-ray	1.97Å	0.29	0.26	Mandelate racemase/muconate lactonizing enzyme family protein
3nnd.1.A	10.96	homo-tetramer	HHblits	X-ray	2.80Å	0.25	0.27	Possible substrate binding protein of ABC transporter system
3sbf.1.A	15.71	homo-dimer	HHblits	X-ray	1.50Å	0.28	0.26	mandelate racemase / muconate lactonizing enzyme
2oek.1.A	10.14	homo-dimer	HHblits	X-ray	1.80Å	0.29	0.26	2,3-diketo-5-methylthiopentyl-1-phosphate enolase
4mg4.1.A	11.11	homo-dimer	HHblits	X-ray	1.70Å	0.25	0.27	Phosphonomutase
4mg4.2.B	11.11	homo-dimer	HHblits	X-ray	1.70Å	0.25	0.27	Phosphonomutase
4jj6.1.A	15.94	homo-octamer	HHblits	X-ray	1.80Å	0.28	0.26	Acetyl xylan esterase
3tji.1.A	12.86	homo-octamer	HHblits	X-ray	1.80Å	0.27	0.26	Mandelate racemase/muconate lactonizing enzyme, N-terminal domain protein
4oao.1.A	16.18	homo-octamer	HHblits	X-ray	2.05Å	0.29	0.26	Acetyl xylan esterase
3r25.1.A	14.29	homo-dimer	HHblits	X-ray	1.60Å	0.27	0.26	mandelate racemase / muconate lactonizing enzyme
4gir.1.A	11.43	homo-octamer	HHblits	X-ray	2.00Å	0.27	0.26	Enolase
4oap.1.A	16.18	homo-octamer	HHblits	X-ray	1.93Å	0.29	0.26	Acetyl xylan esterase
5bn1.1.A	16.18	homo-octamer	HHblits	X-ray	1.60Å	0.29	0.26	Acetyl xylan esterase
3nkl.1.A	17.65	homo-dimer	HHblits	X-ray	1.90Å	0.29	0.26	UDP-D-quinovosamine 4-dehydrogenase
3nkl.1.B	17.65	homo-dimer	HHblits	X-ray	1.90Å	0.29	0.26	UDP-D-quinovosamine 4-dehydrogenase
3ssz.1.A	11.43	homo-octamer	HHblits	X-ray	2.39Å	0.27	0.26	Mandelate racemase/muconate lactonizing enzyme, N-terminal domain protein
5jd3.1.A	16.18	monomer	HHblits	X-ray	2.30Å	0.29	0.26	LAE5
2pge.1.A	7.04	monomer	HHblits	X-ray	1.60Å	0.25	0.27	MenC
3rr1.1.A	12.86	homo-octamer	HHblits	X-ray	1.95Å	0.26	0.26	Putative D-galactonate dehydratase
3p94.1.A	19.40	monomer	HHblits	X-ray	1.93Å	0.30	0.25	GDSL-like Lipase
5tie.1.A	14.71	monomer	HHblits	X-ray	1.15Å	0.28	0.26	Acyl-CoA thioesterase I
5tid.1.A	14.71	monomer	HHblits	X-ray	1.20Å	0.28	0.26	Acyl-CoA thioesterase I
3rjt.1.A	16.18	homo-dimer	HHblits	X-ray	1.50Å	0.28	0.26	Lipolytic protein G-D-S-L family
4e6m.1.A	7.14	homo-octamer	HHblits	X-ray	1.80Å	0.26	0.26	Putative dehydratase protein
3gy1.1.A	11.43	homo-octamer	HHblits	X-ray	1.60Å	0.26	0.26	Mandelate racemase/muconate lactonizing protein
3t4w.1.A	8.57	homo-octamer	HHblits	X-ray	2.52Å	0.26	0.26	Mandelate racemase/muconate lactonizing enzyme family protein
4jko.1.A	14.71	homo-octamer	HHblits	X-ray	1.90Å	0.28	0.26	Acetyl xylan esterase
4h1z.1.A	8.57	homo-octamer	HHblits	X-ray	2.01Å	0.26	0.26	Enolase Q92Zs5
3vk5.1.A	16.67	homo-dimer	HHblits	X-ray	1.39Å	0.30	0.25	MoeO5
2bdq.1.A	23.08	homo-dimer	HHblits	X-ray	2.30Å	0.31	0.24	copper homeostasis protein CutC
4hf7.1.A	16.42	homo-dimer	HHblits	X-ray	1.77Å	0.28	0.25	Putative acylhydrolase
5unc.1.A	5.63	homo-tetramer	HHblits	X-ray	1.71Å	0.24	0.27	PHOSPHOENOLPYRUVATE PHOSPHOMUTASE
5tic.1.A	14.93	monomer	HHblits	X-ray	1.65Å	0.28	0.25	Acyl-CoA thioesterase I
5tic.2.A	14.93	monomer	HHblits	X-ray	1.65Å	0.28	0.25	Acyl-CoA thioesterase I
4q9a.1.A	11.76	homo-dimer	HHblits	X-ray	2.86Å	0.27	0.26	Tat pathway signal sequence domain protein
1yzf.1.A	15.15	monomer	HHblits	X-ray	1.90Å	0.29	0.25	lipase/acylhydrolase
1j00.1.A	15.15	monomer	HHblits	X-ray	2.00Å	0.29	0.25	Thioesterase I
1u8u.1.A	15.15	monomer	HHblits	X-ray	2.08Å	0.29	0.25	Acyl-CoA thioesterase I
4ppy.1.A	16.67	homo-dimer	HHblits	X-ray	2.00Å	0.29	0.25	Putative acylhydrolase
1v2g.1.A	15.15	monomer	HHblits	X-ray	2.00Å	0.29	0.25	Acyl-CoA thioesterase I
3rcy.1.A	8.70	homo-octamer	HHblits	X-ray	1.99Å	0.25	0.26	Mandelate racemase/muconate lactonizing enzyme-like protein
4kem.1.A	8.70	homo-dimer	HHblits	X-ray	1.30Å	0.25	0.26	Mandelate racemase/muconate lactonizing enzyme
4il2.1.A	2.86	homo-octamer	HHblits	X-ray	1.95Å	0.24	0.26	Starvation sensing protein rspA
4e38.1.A	21.54	homo-trimer	HHblits	X-ray	1.64Å	0.30	0.24	Keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase
4e38.1.C	21.54	homo-trimer	HHblits	X-ray	1.64Å	0.30	0.24	Keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase
2o14.1.A	15.15	monomer	HHblits	X-ray	2.10Å	0.28	0.25	Hypothetical protein yxiM
4jj4.1.A	15.15	homo-octamer	HHblits	X-ray	2.13Å	0.27	0.25	Acetyl xylan esterase
3q2k.1.A	15.15	homo-octamer	HHblits	X-ray	2.13Å	0.27	0.25	oxidoreductase
3q2k.1.B	15.15	homo-octamer	HHblits	X-ray	2.13Å	0.27	0.25	oxidoreductase
5b5s.1.A	15.38	monomer	HHblits	X-ray	1.50Å	0.28	0.24	Acetic acid
3iht.1.A	10.77	homo-dimer	HHblits	X-ray	1.80Å	0.28	0.24	S-adenosyl-L-methionine methyl transferase
3iht.1.B	10.77	homo-dimer	HHblits	X-ray	1.80Å	0.28	0.24	S-adenosyl-L-methionine methyl transferase
2uyy.1.A	12.12	homo-tetramer	HHblits	X-ray	2.50Å	0.26	0.25	N-PAC PROTEIN
2gzm.1.A	17.74	homo-dimer	HHblits	X-ray	1.99Å	0.30	0.23	Glutamate racemase
2gzm.1.B	17.74	homo-dimer	HHblits	X-ray	1.99Å	0.30	0.23	Glutamate racemase
2gzm.2.B	17.74	homo-dimer	HHblits	X-ray	1.99Å	0.30	0.23	Glutamate racemase
1m7h.4.B	22.95	homo-tetramer	HHblits	X-ray	2.00Å	0.31	0.23	Adenylylsulfate kinase
1d6j.1.B	22.95	homo-dimer	HHblits	X-ray	2.00Å	0.31	0.23	ADENOSINE-5'PHOSPHOSULFATE KINASE
1d6j.1.A	22.95	homo-dimer	HHblits	X-ray	2.00Å	0.31	0.23	ADENOSINE-5'PHOSPHOSULFATE KINASE
1m7h.4.C	22.95	homo-tetramer	HHblits	X-ray	2.00Å	0.31	0.23	Adenylylsulfate kinase
1m7g.5.A	22.95	homo-tetramer	HHblits	X-ray	1.43Å	0.31	0.23	Adenylylsulfate kinase
2dwu.1.A	21.31	homo-dimer	HHblits	X-ray	1.60Å	0.30	0.23	Glutamate racemase
2dwu.2.A	21.31	homo-dimer	HHblits	X-ray	1.60Å	0.30	0.23	Glutamate racemase
3ixl.1.A	12.90	monomer	HHblits	X-ray	1.45Å	0.28	0.23	Arylmalonate decarboxylase
4bzp.1.A	25.00	homo-dimer	HHblits	X-ray	1.47Å	0.30	0.23	BIFUNCTIONAL ENZYME CYSN/CYSC
4u63.1.A	9.52	monomer	HHblits	X-ray	1.67Å	0.26	0.24	DNA photolyase
3h0d.1.A	11.48	homo-dimer	HHblits	X-ray	2.40Å	0.28	0.23	CtsR
3h0d.1.B	11.48	homo-dimer	HHblits	X-ray	2.40Å	0.28	0.23	CtsR
2p2q.1.A	11.29	monomer	HHblits	X-ray	2.42Å	0.26	0.23	Acetyl-coenzyme A synthetase
4bzq.1.A	25.42	homo-dimer	HHblits	X-ray	2.10Å	0.30	0.22	BIFUNCTIONAL ENZYME CYSN/CYSC
4r9x.1.A	14.75	homo-dimer	HHblits	X-ray	1.85Å	0.27	0.23	Copper homeostasis protein CutC
4r9x.1.B	14.75	homo-dimer	HHblits	X-ray	1.85Å	0.27	0.23	Copper homeostasis protein CutC
4fq5.1.A	11.48	homo-tetramer	HHblits	X-ray	2.10Å	0.27	0.23	Maleate cis-trans isomerase
4fq5.1.B	11.48	homo-tetramer	HHblits	X-ray	2.10Å	0.27	0.23	Maleate cis-trans isomerase
2p2f.1.A	9.68	monomer	HHblits	X-ray	2.58Å	0.26	0.23	Acetyl-coenzyme A synthetase
3qvj.1.A	13.56	homo-hexamer	HHblits	X-ray	2.10Å	0.29	0.22	Putative hydantoin racemase
2ofw.1.B	25.00	homo-dimer	HHblits	X-ray	2.05Å	0.31	0.21	APS kinase domain of the PAPS synthetase 1
2ofw.1.A	25.00	homo-dimer	HHblits	X-ray	2.05Å	0.31	0.21	APS kinase domain of the PAPS synthetase 1
4uhh.1.A	23.64	monomer	HHblits	X-ray	1.06Å	0.32	0.21	ESTERASE
4mwa.1.A	14.55	homo-tetramer	HHblits	X-ray	1.85Å	0.31	0.21	4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
4mwa.1.B	14.55	homo-tetramer	HHblits	X-ray	1.85Å	0.31	0.21	4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
4mwa.1.C	14.55	homo-tetramer	HHblits	X-ray	1.85Å	0.31	0.21	4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
4mwa.1.D	14.55	homo-tetramer	HHblits	X-ray	1.85Å	0.31	0.21	4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
4mwa.2.B	14.55	homo-tetramer	HHblits	X-ray	1.85Å	0.31	0.21	4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
4mwa.2.D	14.55	homo-tetramer	HHblits	X-ray	1.85Å	0.31	0.21	4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
2vpt.1.A	10.17	homo-dimer	HHblits	X-ray	1.40Å	0.25	0.22	LIPOLYTIC ENZYME
3noy.1.A	14.29	homo-dimer	HHblits	X-ray	2.70Å	0.29	0.21	4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
3noy.2.A	14.29	homo-dimer	HHblits	X-ray	2.70Å	0.29	0.21	4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
2xec.1.A	24.53	homo-dimer	HHblits	X-ray	2.20Å	0.33	0.20	PUTATIVE MALEATE ISOMERASE
3lft.1.A	13.79	monomer	HHblits	X-ray	1.35Å	0.26	0.22	uncharacterized protein
5tie.1.A	6.90	monomer	HHblits	X-ray	1.15Å	0.25	0.22	Acyl-CoA thioesterase I
5tid.1.A	6.90	monomer	HHblits	X-ray	1.20Å	0.25	0.22	Acyl-CoA thioesterase I
4ix1.1.A	14.29	homo-dimer	HHblits	X-ray	2.80Å	0.27	0.21	hypothetical protein
4ix1.1.B	14.29	homo-dimer	HHblits	X-ray	2.80Å	0.27	0.21	hypothetical protein
2dgd.1.A	18.87	homo-octamer	HHblits	X-ray	2.90Å	0.31	0.20	223aa long hypothetical arylmalonate decarboxylase
1wom.1.A	21.15	monomer	HHblits	X-ray	2.50Å	0.32	0.20	Sigma factor sigB regulation protein rsbQ
1wpr.1.A	21.15	monomer	HHblits	X-ray	2.60Å	0.32	0.20	Sigma factor sigB regulation protein rsbQ
1wpr.2.A	21.15	monomer	HHblits	X-ray	2.60Å	0.32	0.20	Sigma factor sigB regulation protein rsbQ
1vhc.1.A	12.50	homo-trimer	HHblits	X-ray	1.89Å	0.26	0.21	Putative KHG/KDPG aldolase
4uhc.1.A	23.08	monomer	HHblits	X-ray	1.03Å	0.32	0.20	ESTERASE
4uhd.1.A	23.08	monomer	HHblits	X-ray	1.07Å	0.32	0.20	ESTERASE
3vk5.1.A	14.55	homo-dimer	HHblits	X-ray	1.39Å	0.27	0.21	MoeO5
4fq7.1.A	16.98	homo-tetramer	HHblits	X-ray	3.00Å	0.30	0.20	Maleate cis-trans isomerase
2xed.1.A	23.53	monomer	HHblits	X-ray	1.95Å	0.32	0.19	PUTATIVE MALEATE ISOMERASE
1wbh.1.A	10.91	homo-trimer	HHblits	X-ray	1.55Å	0.26	0.21	KHG/KDPG ALDOLASE
4yv7.1.A	12.50	monomer	HHblits	X-ray	2.30Å	0.24	0.21	Periplasmic binding protein/LacI transcriptional regulator
5im5.1.P	9.26	hetero-oligomer	HHblits	X-ray	3.70Å	0.27	0.20	Designed Keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase
1wau.1.A	9.09	homo-trimer	HHblits	X-ray	2.80Å	0.25	0.21	KHG/KDPG ALDOLASE
1fq0.1.A	11.11	homo-trimer	HHblits	X-ray	2.10Å	0.26	0.20	KDPG ALDOLASE
1eua.1.C	11.11	homo-trimer	HHblits	X-ray	1.95Å	0.26	0.20	KDPG ALDOLASE
4bk9.1.A	16.98	homo-trimer	HHblits	X-ray	2.77Å	0.26	0.20	2-DEHYDRO-3-DEOXYPHOSPHOGLUCONATE ALDOLASE/4-HYDROXY-2-OXO GLUTARATE ALDOLASE
1fwr.1.A	11.54	homo-trimer	HHblits	X-ray	2.70Å	0.27	0.20	KDPG ALDOLASE
4e38.1.A	7.69	homo-trimer	HHblits	X-ray	1.64Å	0.26	0.20	Keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase
4e38.1.C	7.69	homo-trimer	HHblits	X-ray	1.64Å	0.26	0.20	Keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase
1dqn.1.A	20.83	homo-dimer	HHblits	X-ray	1.75Å	0.32	0.18	GUANINE PHOSPHORIBOSYLTRANSFERASE
1mxs.1.A	20.00	homo-trimer	HHblits	X-ray	2.20Å	0.29	0.19	KDPG Aldolase
4mg4.1.A	18.00	homo-dimer	HHblits	X-ray	1.70Å	0.27	0.19	Phosphonomutase
4mg4.2.B	18.00	homo-dimer	HHblits	X-ray	1.70Å	0.27	0.19	Phosphonomutase
4i3f.1.A	14.00	monomer	HHblits	X-ray	1.69Å	0.27	0.19	serine hydrolase CCSP0084
1vdm.1.B	18.37	homo-12-mer	HHblits	X-ray	2.50Å	0.29	0.18	purine phosphoribosyltransferase
1vdm.1.A	18.37	homo-12-mer	HHblits	X-ray	2.50Å	0.29	0.18	purine phosphoribosyltransferase
1vdm.1.E	18.37	homo-12-mer	HHblits	X-ray	2.50Å	0.29	0.18	purine phosphoribosyltransferase
1a98.1.A	18.37	homo-tetramer	HHblits	X-ray	2.25Å	0.28	0.18	XANTHINE-GUANINE PHOSPHORIBOSYLTRANSFERASE
3w06.1.A	14.29	monomer	HHblits	X-ray	1.15Å	0.28	0.18	Hydrolase, alpha/beta fold family protein
1a96.1.A	20.83	homo-tetramer	HHblits	X-ray	2.00Å	0.29	0.18	XANTHINE-GUANINE PHOSPHORIBOSYLTRANSFERASE
1a96.1.C	20.83	homo-tetramer	HHblits	X-ray	2.00Å	0.29	0.18	XANTHINE-GUANINE PHOSPHORIBOSYLTRANSFERASE
1nul.1.B	20.83	homo-tetramer	HHblits	X-ray	1.80Å	0.29	0.18	XANTHINE-GUANINE PHOSPHORIBOSYLTRANSFERASE
4jls.2.A	20.83	homo-tetramer	HHblits	X-ray	2.20Å	0.29	0.18	Xanthine phosphoribosyltransferase
1eo1.1.A	14.58	monomer	HHblits	NMR	NA	0.29	0.18	HYPOTHETICAL PROTEIN MTH1175
1rdu.1.A	16.67	monomer	HHblits	NMR	NA	0.28	0.18	conserved hypothetical protein
1a97.1.A	21.28	homo-tetramer	HHblits	X-ray	2.60Å	0.30	0.18	XANTHINE-GUANINE PHOSPHORIBOSYLTRANSFERASE
4dnh.1.A	8.16	monomer	HHblits	X-ray	2.50Å	0.26	0.18	Uncharacterized protein
1war.1.A	19.15	monomer	HHblits	X-ray	2.22Å	0.29	0.18	HUMAN PURPLE ACID PHOSPHATASE
2bq8.1.A	19.15	monomer	HHblits	X-ray	2.20Å	0.29	0.18	TARTRATE-RESISTANT ACID PHOSPHATASE TYPE 5
1gso.1.A	17.02	monomer	HHblits	X-ray	1.60Å	0.28	0.18	PROTEIN (GLYCINAMIDE RIBONUCLEOTIDE SYNTHETASE)
2kho.1.A	25.58	monomer	HHblits	NMR	NA	0.35	0.16	Heat shock protein 70
3mjf.1.A	14.58	monomer	HHblits	X-ray	1.47Å	0.26	0.18	Phosphoribosylamine--glycine ligase
2qk4.1.A	12.77	monomer	HHblits	X-ray	2.45Å	0.27	0.18	Trifunctional purine biosynthetic protein adenosine-3
4tug.1.C	8.33	homo-hexamer	HHblits	X-ray	3.55Å	0.25	0.18	DNA double-strand break repair protein Mre11
4tug.1.A	8.33	homo-hexamer	HHblits	X-ray	3.55Å	0.25	0.18	DNA double-strand break repair protein Mre11
4tug.1.F	8.33	homo-hexamer	HHblits	X-ray	3.55Å	0.25	0.18	DNA double-strand break repair protein Mre11
3ef6.1.A	30.95	monomer	HHblits	X-ray	1.80Å	0.35	0.16	Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase
4emi.1.A	30.95	monomer	HHblits	X-ray	1.81Å	0.35	0.16	TodA
4emj.1.A	30.95	hetero-oligomer	HHblits	X-ray	2.40Å	0.35	0.16	TodA
2ys6.1.A	10.42	monomer	HHblits	X-ray	2.21Å	0.25	0.18	Phosphoribosylglycinamide synthetase
4fx9.1.A	20.93	homo-dimer	HHblits	X-ray	2.70Å	0.33	0.16	Coenzyme A disulfide reductase
2xa9.1.A	13.04	monomer	HHblits	X-ray	2.50Å	0.27	0.17	TREHALOSE-SYNTHASE TRET
2xcl.1.A	10.42	monomer	HHblits	X-ray	2.10Å	0.23	0.18	PHOSPHORIBOSYLAMINE--GLYCINE LIGASE
1x7i.1.A	20.93	homo-dimer	HHblits	X-ray	1.70Å	0.31	0.16	Copper homeostasis protein cutC
1x7i.1.B	20.93	homo-dimer	HHblits	X-ray	1.70Å	0.31	0.16	Copper homeostasis protein cutC
1twd.1.A	20.93	homo-dimer	HHblits	X-ray	1.70Å	0.31	0.16	Copper homeostasis protein cutC
1twd.1.B	20.93	homo-dimer	HHblits	X-ray	1.70Å	0.31	0.16	Copper homeostasis protein cutC
2xa1.1.A	13.33	monomer	HHblits	X-ray	2.47Å	0.27	0.17	TREHALOSE-SYNTHASE TRET
2x6r.1.A	13.33	monomer	HHblits	X-ray	2.20Å	0.27	0.17	TREHALOSE-SYNTHASE TRET
3hyv.1.A	29.27	homo-trimer	HHblits	X-ray	2.30Å	0.34	0.15	Sulfide-quinone reductase
2v3a.1.A	18.60	monomer	HHblits	X-ray	2.40Å	0.30	0.16	RUBREDOXIN REDUCTASE
2v3b.1.A	18.60	hetero-oligomer	HHblits	X-ray	2.45Å	0.30	0.16	RUBREDOXIN REDUCTASE
1q1r.1.A	23.81	monomer	HHblits	X-ray	1.91Å	0.32	0.16	Putidaredoxin reductase
1q1w.2.A	23.81	monomer	HHblits	X-ray	2.60Å	0.32	0.16	Putidaredoxin reductase
5l1n.1.A	19.05	homo-dimer	HHblits	X-ray	3.60Å	0.32	0.16	Coenzyme A disulfide reductase
2bdq.1.A	18.18	homo-dimer	HHblits	X-ray	2.30Å	0.28	0.17	copper homeostasis protein CutC
3lb8.1.A	21.43	hetero-oligomer	HHblits	X-ray	2.60Å	0.31	0.16	Putidaredoxin reductase
3lb8.2.A	21.43	hetero-oligomer	HHblits	X-ray	2.60Å	0.31	0.16	Putidaredoxin reductase
1iu9.1.A	21.95	monomer	HHblits	X-ray	2.04Å	0.33	0.15	aspartate racemase
2c7g.1.A	19.05	homo-dimer	HHblits	X-ray	1.80Å	0.31	0.16	NADPH-FERREDOXIN REDUCTASE FPRA
1lqu.1.A	19.05	monomer	HHblits	X-ray	1.25Å	0.31	0.16	FprA
3o8o.1.B	19.05	hetero-oligomer	HHblits	X-ray	2.90Å	0.30	0.16	6-phosphofructokinase subunit beta
4h4v.1.A	21.95	homo-dimer	HHblits	X-ray	1.40Å	0.32	0.15	Biphenyl dioxygenase ferredoxin reductase subunit
4h4x.1.A	21.95	homo-dimer	HHblits	X-ray	1.50Å	0.32	0.15	Biphenyl dioxygenase ferredoxin reductase subunit
4h4r.1.A	21.95	homo-dimer	HHblits	X-ray	1.40Å	0.32	0.15	Biphenyl dioxygenase ferredoxin reductase subunit
2gr3.1.A	21.95	homo-dimer	HHblits	X-ray	1.50Å	0.32	0.15	ferredoxin reductase
4h4p.1.A	21.95	homo-dimer	HHblits	X-ray	1.50Å	0.32	0.15	Biphenyl dioxygenase ferredoxin reductase subunit
3kd9.1.A	19.51	homo-dimer	HHblits	X-ray	2.75Å	0.32	0.15	Coenzyme A disulfide reductase
5enz.1.A	13.64	homo-dimer	HHblits	X-ray	1.91Å	0.27	0.17	UDP-GlcNAc 2-epimerase
5enz.1.B	13.64	homo-dimer	HHblits	X-ray	1.91Å	0.27	0.17	UDP-GlcNAc 2-epimerase
4evz.1.A	25.00	monomer	HHblits	X-ray	1.46Å	0.34	0.15	HisF-LUCA
5fs9.1.A	19.51	monomer	HHblits	X-ray	1.75Å	0.31	0.15	APOPTOSIS-INDUCING FACTOR 1, MITOCHONDRIAL
3beo.1.A	16.28	homo-dimer	HHblits	X-ray	1.70Å	0.27	0.16	UDP-N-acetylglucosamine 2-epimerase
2yvg.1.A	22.50	homo-dimer	HHblits	X-ray	1.60Å	0.33	0.15	Ferredoxin reductase
2yvj.1.A	22.50	hetero-oligomer	HHblits	X-ray	1.90Å	0.33	0.15	Ferredoxin reductase
2yvj.1.C	22.50	hetero-oligomer	HHblits	X-ray	1.90Å	0.33	0.15	Ferredoxin reductase
1d7y.1.A	22.50	homo-dimer	HHblits	X-ray	2.10Å	0.33	0.15	FERREDOXIN REDUCTASE
4h4t.1.A	22.50	homo-dimer	HHblits	X-ray	1.50Å	0.33	0.15	Biphenyl dioxygenase ferredoxin reductase subunit
4h4z.1.A	22.50	homo-dimer	HHblits	X-ray	1.95Å	0.33	0.15	Biphenyl dioxygenase ferredoxin reductase subunit
3iwa.1.A	24.39	homo-dimer	HHblits	X-ray	2.30Å	0.30	0.15	FAD-dependent pyridine nucleotide-disulphide oxidoreductase
3jcs.1.O	27.50	hetero-oligomer	HHblits	EM	NA	0.32	0.15	ribosomal protein L8e
5t2a.40.A	27.50	monomer	HHblits	EM	NA	0.32	0.15	eL8
3lxd.1.A	17.07	monomer	HHblits	X-ray	2.50Å	0.30	0.15	FAD-dependent pyridine nucleotide-disulphide oxidoreductase
1v8b.1.A	12.20	homo-tetramer	HHblits	X-ray	2.40Å	0.30	0.15	adenosylhomocysteinase
4fdc.1.A	20.00	monomer	HHblits	X-ray	2.40Å	0.32	0.15	Apoptosis-inducing factor 1, mitochondrial
4bur.1.A	20.00	monomer	HHblits	X-ray	2.88Å	0.32	0.15	APOPTOSIS INDUCING FACTOR 1, MITOCHONDRIAL
4bur.3.A	20.00	monomer	HHblits	X-ray	2.88Å	0.32	0.15	APOPTOSIS INDUCING FACTOR 1, MITOCHONDRIAL
4lii.1.A	20.00	monomer	HHblits	X-ray	1.88Å	0.32	0.15	Apoptosis-inducing factor 1, mitochondrial
5kvh.1.A	20.00	homo-dimer	HHblits	X-ray	2.27Å	0.32	0.15	Apoptosis-inducing factor 1, mitochondrial
5fs8.1.A	20.00	monomer	HHblits	X-ray	1.40Å	0.32	0.15	APOPTOSIS-INDUCING FACTOR 1, MITOCHONDRIAL
5fs7.1.A	20.00	monomer	HHblits	X-ray	1.85Å	0.32	0.15	APOPTOSIS-INDUCING FACTOR 1, MITOCHONDRIAL
1m6i.1.A	20.00	monomer	HHblits	X-ray	1.80Å	0.32	0.15	Programmed cell death protein 8
5fs6.1.A	20.00	monomer	HHblits	X-ray	1.90Å	0.32	0.15	APOPTOSIS-INDUCING FACTOR 1, MITOCHONDRIAL
1gv4.1.A	20.00	monomer	HHblits	X-ray	2.00Å	0.32	0.15	PROGRAMED CELL DEATH PROTEIN 8
5fmh.1.A	20.00	monomer	HHblits	X-ray	1.80Å	0.32	0.15	APOPTOSIS-INDUCING FACTOR 1, MITOCHONDRIAL
3gd3.1.A	20.00	monomer	HHblits	X-ray	2.95Å	0.32	0.15	Apoptosis-inducing factor 1, mitochondrial
3gd3.2.A	20.00	monomer	HHblits	X-ray	2.95Å	0.32	0.15	Apoptosis-inducing factor 1, mitochondrial
3gd3.4.A	20.00	monomer	HHblits	X-ray	2.95Å	0.32	0.15	Apoptosis-inducing factor 1, mitochondrial
5miu.1.A	20.00	monomer	HHblits	X-ray	3.50Å	0.32	0.15	Apoptosis-inducing factor 1, mitochondrial
5miv.1.A	20.00	homo-dimer	HHblits	X-ray	3.10Å	0.32	0.15	Apoptosis-inducing factor 1, mitochondrial
5miv.1.B	20.00	homo-dimer	HHblits	X-ray	3.10Å	0.32	0.15	Apoptosis-inducing factor 1, mitochondrial
3gd4.1.A	20.00	homo-dimer	HHblits	X-ray	2.24Å	0.32	0.15	Apoptosis-inducing factor 1, mitochondrial
3gd4.1.B	20.00	homo-dimer	HHblits	X-ray	2.24Å	0.32	0.15	Apoptosis-inducing factor 1, mitochondrial
3jah.57.A	30.00	monomer	HHblits	EM	NA	0.32	0.15	eS12
5k0y.1.d	30.00	hetero-oligomer	HHblits	EM	NA	0.32	0.15	40S ribosomal protein S12
3cge.1.A	19.51	homo-dimer	HHblits	X-ray	2.26Å	0.29	0.15	Pyridine nucleotide-disulfide oxidoreductase, class I
3nta.1.A	19.05	homo-dimer	HHblits	X-ray	2.01Å	0.27	0.16	FAD-dependent pyridine nucleotide-disulphide oxidoreductase
3ntd.1.A	19.05	homo-dimer	HHblits	X-ray	1.99Å	0.27	0.16	FAD-dependent pyridine nucleotide-disulphide oxidoreductase
3ics.1.A	19.51	homo-dimer	HHblits	X-ray	1.94Å	0.29	0.15	Coenzyme A-Disulfide Reductase
4u4n.116.A	22.50	monomer	HHblits	X-ray	3.10Å	0.31	0.15	60S ribosomal protein L8-A
4u4r.41.A	22.50	monomer	HHblits	X-ray	2.80Å	0.31	0.15	60S ribosomal protein L8-A
1yqz.1.A	21.95	homo-dimer	HHblits	X-ray	1.54Å	0.29	0.15	coenzyme A disulfide reductase
3td9.1.A	9.76	homo-dimer	HHblits	X-ray	1.90Å	0.29	0.15	Branched chain amino acid ABC transporter, periplasmic amino acid-binding protein
5t5h.1.j	20.00	hetero-oligomer	HHblits	EM	NA	0.31	0.15	Ribosomal protein L7a-like protein
5kvi.1.A	20.51	monomer	HHblits	X-ray	2.00Å	0.32	0.15	Apoptosis-inducing factor 1, mitochondrial
3sg0.1.A	20.51	monomer	HHblits	X-ray	1.20Å	0.32	0.15	Extracellular ligand-binding receptor
3noy.1.A	28.21	homo-dimer	HHblits	X-ray	2.70Å	0.32	0.15	4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
3noy.2.A	28.21	homo-dimer	HHblits	X-ray	2.70Å	0.32	0.15	4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
2r68.1.A	14.29	monomer	HHblits	X-ray	2.40Å	0.26	0.16	Glycosyl transferase, group 1
3n4y.1.A	17.50	monomer	HHblits	X-ray	2.40Å	0.30	0.15	50S ribosomal protein L30e
1w40.1.A	17.50	monomer	HHblits	X-ray	2.03Å	0.30	0.15	50S RIBOSOMAL PROTEIN L30E
4v4n.65.A	23.08	monomer	HHblits	EM	NA	0.32	0.15	50S ribosomal protein L30E
4v6u.56.A	23.08	monomer	HHblits	EM	NA	0.32	0.15	50S ribosomal protein L30e
4ru0.1.A	17.07	monomer	HHblits	X-ray	2.44Å	0.28	0.15	Putative branched-chain amino acid ABC transporter, periplasmic branched-chain amino acid-binding protein
3h5l.1.A	15.00	monomer	HHblits	X-ray	1.70Å	0.30	0.15	putative Branched-chain amino acid ABC transporter
4ocg.1.A	19.51	homo-dimer	HHblits	X-ray	2.75Å	0.28	0.15	FAD-dependent pyridine nucleotide-disulphide oxidoreductase
3nt6.1.A	19.51	homo-dimer	HHblits	X-ray	2.00Å	0.28	0.15	FAD-dependent pyridine nucleotide-disulphide oxidoreductase
3cgb.1.A	20.00	homo-dimer	HHblits	X-ray	1.90Å	0.30	0.15	Pyridine nucleotide-disulfide oxidoreductase, class I
4gnr.1.A	12.50	monomer	HHblits	X-ray	1.00Å	0.30	0.15	ABC transporter substrate-binding protein-branched chain amino acid transport
1go1.1.A	17.50	monomer	HHblits	NMR	NA	0.29	0.15	50S RIBOSOMAL PROTEIN L30E
1go0.1.A	17.50	monomer	HHblits	NMR	NA	0.29	0.15	50S RIBOSOMAL PROTEIN L30E
1h7m.1.A	17.50	monomer	HHblits	X-ray	1.96Å	0.29	0.15	50S RIBOSOMAL PROTEIN L30E
4x2r.1.A	20.00	monomer	HHblits	X-ray	1.05Å	0.29	0.15	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase
4em3.1.A	22.50	homo-dimer	HHblits	X-ray	1.98Å	0.29	0.15	Coenzyme A disulfide reductase
4qwv.1.A	17.50	monomer	HHblits	X-ray	2.45Å	0.29	0.15	High-affinity leucine-specific transport system periplasmic binding protein, Chemotaxis protein CheY
4dqd.1.A	17.95	monomer	HHblits	X-ray	1.60Å	0.31	0.15	Extracellular ligand-binding receptor
3n4z.1.A	20.51	monomer	HHblits	X-ray	2.40Å	0.31	0.15	50S ribosomal protein L30e
3n4z.2.A	20.51	monomer	HHblits	X-ray	2.40Å	0.31	0.15	50S ribosomal protein L30e
4kv7.1.A	20.51	monomer	HHblits	X-ray	1.20Å	0.31	0.15	Probable leucine/isoleucine/valine-binding protein
1yk1.1.A	7.32	hetero-oligomer	HHblits	X-ray	2.90Å	0.27	0.15	Atrial natriuretic peptide clearance receptor
1yk1.1.B	7.32	hetero-oligomer	HHblits	X-ray	2.90Å	0.27	0.15	Atrial natriuretic peptide clearance receptor
4fx7.1.A	4.88	monomer	HHblits	X-ray	2.08Å	0.27	0.15	Imidazole glycerol phosphate synthase subunit HisF
3ra6.1.A	17.95	monomer	HHblits	X-ray	2.00Å	0.31	0.15	50S ribosomal protein L30e
1w41.1.A	17.95	monomer	HHblits	X-ray	1.70Å	0.31	0.15	50S RIBOSOMAL PROTEIN L30E
3ra5.1.A	17.95	homo-dimer	HHblits	X-ray	1.80Å	0.31	0.15	50S ribosomal protein L30e
4v8m.58.A	20.51	monomer	HHblits	EM	5.57Å	0.30	0.15	60S RIBOSOMAL PROTEIN L30
5oql.1.V	10.26	hetero-oligomer	HHblits	EM	NA	0.30	0.15	Snu13
3cpq.1.A	23.08	homo-dimer	HHblits	X-ray	1.90Å	0.30	0.15	50S ribosomal protein L30e
3lfo.1.A	17.95	monomer	HHblits	X-ray	1.80Å	0.30	0.15	50S ribosomal protein L30e
4v8m.75.A	20.51	monomer	HHblits	EM	5.57Å	0.30	0.15	60S RIBOSOMAL PROTEIN L7A, PUTATIVE
1w42.1.A	17.95	monomer	HHblits	X-ray	1.80Å	0.30	0.15	50S RIBOSOMAL PROTEIN L30E
5l2e.1.A	28.95	homo-dimer	HHblits	X-ray	4.15Å	0.32	0.14	Glutamate receptor ionotropic, delta-2,Glutamate receptor ionotropic, delta-2
4eqr.1.A	23.08	homo-dimer	HHblits	X-ray	1.80Å	0.30	0.15	Coenzyme A disulfide reductase
4emw.1.A	23.08	homo-dimer	HHblits	X-ray	2.39Å	0.30	0.15	Coenzyme A disulfide reductase
4eqx.1.A	23.08	homo-dimer	HHblits	X-ray	1.70Å	0.30	0.15	Coenzyme A disulfide reductase
4eqw.1.A	23.08	homo-dimer	HHblits	X-ray	1.50Å	0.30	0.15	Coenzyme A disulfide reductase
3ukj.1.A	17.95	monomer	HHblits	X-ray	1.60Å	0.30	0.15	Extracellular ligand-binding receptor
4bts.100.A	15.00	monomer	HHblits	X-ray	3.70Å	0.28	0.15	40S RIBOSOMAL PROTEIN RPS12E
4v5o.2.3	15.00	hetero-oligomer	HHblits	X-ray	3.93Å	0.28	0.15	RIBOSOMAL PROTEIN L7AE CONTAINING PROTEIN
4v5o.1.3	15.00	hetero-oligomer	HHblits	X-ray	3.93Å	0.28	0.15	RIBOSOMAL PROTEIN L7AE CONTAINING PROTEIN
1e7k.1.A	17.95	monomer	HHblits	X-ray	2.90Å	0.30	0.15	15.5 KD RNA BINDING PROTEIN
5o9z.1.O	17.95	hetero-oligomer	HHblits	EM	NA	0.30	0.15	NHP2-like protein 1
3ipa.1.A	17.95	monomer	HHblits	X-ray	1.55Å	0.29	0.15	ABC transporter, substrate binding protein (Amino acid)
3ipc.1.A	17.95	monomer	HHblits	X-ray	1.30Å	0.29	0.15	ABC transporter, substrate binding protein (Amino acid)
2bc1.1.A	12.50	homo-dimer	HHblits	X-ray	2.15Å	0.27	0.15	NADH Oxidase
4lck.1.A	17.95	monomer	HHblits	X-ray	3.20Å	0.29	0.15	Ribosomal protein YbxF
4lck.2.A	17.95	monomer	HHblits	X-ray	3.20Å	0.29	0.15	Ribosomal protein YbxF
3v7e.1.A	17.95	monomer	HHblits	X-ray	2.80Å	0.29	0.15	Ribosome-associated protein L7Ae-like
4tzz.2.A	17.95	monomer	HHblits	X-ray	3.64Å	0.29	0.15	Ribosome-associated protein L7Ae-like
4tzp.2.A	17.95	monomer	HHblits	X-ray	8.50Å	0.29	0.15	Ribosome-associated protein L7Ae-like
4tzw.1.A	17.95	monomer	HHblits	X-ray	4.67Å	0.29	0.15	Ribosome-associated protein L7Ae-like
4q6w.1.A	10.26	monomer	HHblits	X-ray	1.84Å	0.29	0.15	Putative leu/ile/val-binding protein
2lbp.1.A	15.38	monomer	HHblits	X-ray	2.40Å	0.29	0.15	LEUCINE-BINDING PROTEIN
1w3e.1.A	15.38	monomer	HHblits	X-ray	1.77Å	0.29	0.15	50S RIBOSOMAL PROTEIN L30E
1vzw.1.A	15.00	monomer	HHblits	X-ray	1.80Å	0.27	0.15	PHOSPHORIBOSYL ISOMERASE A
2vep.1.A	15.00	monomer	HHblits	X-ray	1.80Å	0.27	0.15	PHOSPHORIBOSYL ISOMERASE A
1h5y.1.A	15.79	monomer	HHblits	X-ray	2.00Å	0.31	0.14	HISF
4nut.1.A	15.38	hetero-oligomer	HHblits	X-ray	1.55Å	0.28	0.15	13 kDa ribonucleoprotein-associated protein
3jcm.1.G	15.38	hetero-oligomer	HHblits	EM	NA	0.28	0.15	13 kDa ribonucleoprotein-associated protein
1zwz.1.A	15.38	monomer	HHblits	X-ray	1.90Å	0.28	0.15	Snu13p
5wyk.1.G	15.38	hetero-oligomer	HHblits	EM	NA	0.28	0.15	13 kDa ribonucleoprotein-associated protein
5wyj.7.A	15.38	monomer	HHblits	EM	NA	0.28	0.15	13 kDa ribonucleoprotein-associated protein
5nrl.1.R	15.38	hetero-oligomer	HHblits	EM	NA	0.28	0.15	13 kDa ribonucleoprotein-associated protein
5wlc.48.A	15.38	monomer	HHblits	EM	NA	0.28	0.15	Snu13
5wlc.47.A	15.38	monomer	HHblits	EM	NA	0.28	0.15	Snu13
3o85.1.A	10.26	monomer	HHblits	X-ray	1.81Å	0.28	0.15	Ribosomal protein L7Ae
2aif.1.A	12.82	monomer	HHblits	X-ray	1.89Å	0.28	0.15	ribosomal protein L7A
3oc4.1.A	18.42	homo-dimer	HHblits	X-ray	2.60Å	0.30	0.14	Oxidoreductase, pyridine nucleotide-disulfide family
3oc4.1.B	18.42	homo-dimer	HHblits	X-ray	2.60Å	0.30	0.14	Oxidoreductase, pyridine nucleotide-disulfide family
3i45.1.A	10.26	monomer	HHblits	X-ray	1.36Å	0.28	0.15	Twin-arginine translocation pathway signal protein
4x00.1.A	15.38	monomer	HHblits	X-ray	1.38Å	0.28	0.15	Putative hydrolase
4v6w.7.A	17.95	monomer	HHblits	EM	NA	0.28	0.15	40S ribosomal protein S12
1nhr.1.A	18.42	monomer	HHblits	X-ray	2.10Å	0.30	0.14	NADH PEROXIDASE
1f8w.1.A	18.42	homo-tetramer	HHblits	X-ray	2.45Å	0.30	0.14	NADH PEROXIDASE
5er0.1.A	12.82	homo-dimer	HHblits	X-ray	2.41Å	0.28	0.15	NADH oxidase
4n0q.1.A	18.42	monomer	HHblits	X-ray	2.30Å	0.29	0.14	Leu/Ile/Val-binding protein homolog 3
4u4f.1.A	7.32	homo-tetramer	HHblits	X-ray	4.79Å	0.23	0.15	Glutamate receptor 2
4u4f.1.B	7.32	homo-tetramer	HHblits	X-ray	4.79Å	0.23	0.15	Glutamate receptor 2
4u4f.1.C	7.32	homo-tetramer	HHblits	X-ray	4.79Å	0.23	0.15	Glutamate receptor 2
4u4f.1.D	7.32	homo-tetramer	HHblits	X-ray	4.79Å	0.23	0.15	Glutamate receptor 2
4u4g.1.A	7.32	homo-tetramer	HHblits	X-ray	4.49Å	0.23	0.15	Glutamate receptor 2
4u4g.1.B	7.32	homo-tetramer	HHblits	X-ray	4.49Å	0.23	0.15	Glutamate receptor 2
4u4g.1.C	7.32	homo-tetramer	HHblits	X-ray	4.49Å	0.23	0.15	Glutamate receptor 2
4u4g.1.D	7.32	homo-tetramer	HHblits	X-ray	4.49Å	0.23	0.15	Glutamate receptor 2
4u5e.1.A	7.32	hetero-oligomer	HHblits	X-ray	3.51Å	0.23	0.15	Glutamate receptor 2
4u5e.1.B	7.32	hetero-oligomer	HHblits	X-ray	3.51Å	0.23	0.15	Glutamate receptor 2
4u5e.1.C	7.32	hetero-oligomer	HHblits	X-ray	3.51Å	0.23	0.15	Glutamate receptor 2
4u5e.1.D	7.32	hetero-oligomer	HHblits	X-ray	3.51Å	0.23	0.15	Glutamate receptor 2
4u1y.1.A	7.32	homo-tetramer	HHblits	X-ray	3.90Å	0.23	0.15	Glutamate receptor 2
4u1y.1.B	7.32	homo-tetramer	HHblits	X-ray	3.90Å	0.23	0.15	Glutamate receptor 2
4u1y.1.C	7.32	homo-tetramer	HHblits	X-ray	3.90Å	0.23	0.15	Glutamate receptor 2
4u1y.1.D	7.32	homo-tetramer	HHblits	X-ray	3.90Å	0.23	0.15	Glutamate receptor 2
4u5c.1.A	7.32	hetero-oligomer	HHblits	X-ray	3.69Å	0.23	0.15	Glutamate receptor 2
4u5c.1.B	7.32	hetero-oligomer	HHblits	X-ray	3.69Å	0.23	0.15	Glutamate receptor 2
4u5c.1.C	7.32	hetero-oligomer	HHblits	X-ray	3.69Å	0.23	0.15	Glutamate receptor 2
4u5c.1.D	7.32	hetero-oligomer	HHblits	X-ray	3.69Å	0.23	0.15	Glutamate receptor 2
4u5d.1.A	7.32	hetero-oligomer	HHblits	X-ray	3.58Å	0.23	0.15	Glutamate receptor 2
4u5d.1.B	7.32	hetero-oligomer	HHblits	X-ray	3.58Å	0.23	0.15	Glutamate receptor 2
4u5d.1.C	7.32	hetero-oligomer	HHblits	X-ray	3.58Å	0.23	0.15	Glutamate receptor 2
4u5d.1.D	7.32	hetero-oligomer	HHblits	X-ray	3.58Å	0.23	0.15	Glutamate receptor 2
4uq6.1.A	7.32	homo-tetramer	HHblits	EM	12.80Å	0.23	0.15	GLUTAMATE RECEPTOR 2
4uq6.1.B	7.32	homo-tetramer	HHblits	EM	12.80Å	0.23	0.15	GLUTAMATE RECEPTOR 2
5kbs.1.A	7.32	homo-tetramer	HHblits	EM	NA	0.23	0.15	Glutamate receptor 2,Voltage-dependent calcium channel gamma-2 subunit
5kbs.1.B	7.32	homo-tetramer	HHblits	EM	NA	0.23	0.15	Glutamate receptor 2,Voltage-dependent calcium channel gamma-2 subunit
5kbs.1.C	7.32	homo-tetramer	HHblits	EM	NA	0.23	0.15	Glutamate receptor 2,Voltage-dependent calcium channel gamma-2 subunit
5kbs.1.D	7.32	homo-tetramer	HHblits	EM	NA	0.23	0.15	Glutamate receptor 2,Voltage-dependent calcium channel gamma-2 subunit
5l1g.1.C	7.32	homo-tetramer	HHblits	X-ray	4.51Å	0.23	0.15	Glutamate receptor 2
5l1g.1.B	7.32	homo-tetramer	HHblits	X-ray	4.51Å	0.23	0.15	Glutamate receptor 2
5l1g.1.A	7.32	homo-tetramer	HHblits	X-ray	4.51Å	0.23	0.15	Glutamate receptor 2
5l1g.1.D	7.32	homo-tetramer	HHblits	X-ray	4.51Å	0.23	0.15	Glutamate receptor 2
5l1b.1.D	7.32	homo-tetramer	HHblits	X-ray	4.00Å	0.23	0.15	Glutamate receptor 2,Glutamate receptor 2
5l1b.1.C	7.32	homo-tetramer	HHblits	X-ray	4.00Å	0.23	0.15	Glutamate receptor 2,Glutamate receptor 2
5l1b.1.B	7.32	homo-tetramer	HHblits	X-ray	4.00Å	0.23	0.15	Glutamate receptor 2,Glutamate receptor 2
5l1b.1.A	7.32	homo-tetramer	HHblits	X-ray	4.00Å	0.23	0.15	Glutamate receptor 2,Glutamate receptor 2
4zpj.1.A	18.42	monomer	HHblits	X-ray	2.24Å	0.29	0.14	Extracellular ligand-binding receptor
5kuh.1.A	15.79	homo-tetramer	HHblits	EM	NA	0.29	0.14	Glutamate receptor ionotropic, kainate 2
5kuh.1.B	15.79	homo-tetramer	HHblits	EM	NA	0.29	0.14	Glutamate receptor ionotropic, kainate 2
1usi.1.A	15.79	monomer	HHblits	X-ray	1.80Å	0.29	0.14	LEUCINE-SPECIFIC BINDING PROTEIN
1usg.1.A	15.79	homo-dimer	HHblits	X-ray	1.53Å	0.29	0.14	LEUCINE-SPECIFIC BINDING PROTEIN
2zvi.1.A	16.22	homo-dimer	HHblits	X-ray	2.30Å	0.31	0.14	2,3-diketo-5-methylthiopentyl-1-phosphate enolase
2zvi.1.B	16.22	homo-dimer	HHblits	X-ray	2.30Å	0.31	0.14	2,3-diketo-5-methylthiopentyl-1-phosphate enolase
2zvi.2.A	16.22	homo-dimer	HHblits	X-ray	2.30Å	0.31	0.14	2,3-diketo-5-methylthiopentyl-1-phosphate enolase
2liv.1.A	15.79	monomer	HHblits	X-ray	2.40Å	0.28	0.14	LEUCINE
5xxb.1.4	12.82	hetero-oligomer	HHblits	EM	NA	0.26	0.15	Ribosomal protein eL30
3n0x.1.A	10.00	monomer	HHblits	X-ray	1.50Å	0.24	0.15	Possible substrate binding protein of ABC transporter system
4v6w.63.A	18.92	monomer	HHblits	EM	NA	0.30	0.14	60S ribosomal protein L30
3vrd.1.B	25.00	hetero-oligomer	HHblits	X-ray	1.50Å	0.32	0.14	Flavocytochrome c flavin subunit
4d67.1.1	10.53	hetero-oligomer	HHblits	EM	9.00Å	0.28	0.14	60S RIBOSOMAL PROTEIN L30
3j92.1.1	10.53	hetero-oligomer	HHblits	EM	NA	0.28	0.14	eL30
3j7o.1.4	10.53	hetero-oligomer	HHblits	EM	3.50Å	0.28	0.14	Ribosomal protein eL30
5t2c.43.A	10.53	monomer	HHblits	EM	NA	0.28	0.14	60S ribosomal protein L30
4ug0.28.A	10.53	monomer	HHblits	EM	NA	0.28	0.14	60S RIBOSOMAL PROTEIN L30
4v6x.63.A	10.53	monomer	HHblits	EM	NA	0.28	0.14	60S ribosomal protein L30
4v5z.48.A	10.53	monomer	HHblits	EM	NA	0.28	0.14	60S Ribosomal protein L30e
5lks.28.A	10.53	monomer	HHblits	EM	NA	0.28	0.14	60S ribosomal protein L30
5aj0.29.A	10.53	monomer	HHblits	EM	3.50Å	0.28	0.14	60S ribosomal protein L30
4uqk.1.A	7.50	homo-tetramer	HHblits	EM	16.40Å	0.24	0.15	GLUTAMATE RECEPTOR 2
4uqk.1.B	7.50	homo-tetramer	HHblits	EM	16.40Å	0.24	0.15	GLUTAMATE RECEPTOR 2
3ukj.1.A	10.53	monomer	HHblits	X-ray	1.60Å	0.27	0.14	Extracellular ligand-binding receptor
4ru0.1.A	10.53	monomer	HHblits	X-ray	2.44Å	0.27	0.14	Putative branched-chain amino acid ABC transporter, periplasmic branched-chain amino acid-binding protein
3uk0.1.A	13.16	monomer	HHblits	X-ray	1.49Å	0.27	0.14	Extracellular ligand-binding receptor
3vi6.1.A	10.53	monomer	HHblits	X-ray	1.59Å	0.27	0.14	60S ribosomal protein L30
4dqd.1.A	13.16	monomer	HHblits	X-ray	1.60Å	0.27	0.14	Extracellular ligand-binding receptor
5lzz.28.A	10.53	monomer	HHblits	EM	3.47Å	0.27	0.14	eL30
4q6w.1.A	2.63	monomer	HHblits	X-ray	1.84Å	0.27	0.14	Putative leu/ile/val-binding protein
3tx6.1.A	10.53	monomer	HHblits	X-ray	1.50Å	0.26	0.14	Putative branched-chain amino acid transport system substrate-binding protein
3jcs.1.b	15.79	hetero-oligomer	HHblits	EM	NA	0.26	0.14	ribosomal protein L30e
5t2a.23.A	15.79	monomer	HHblits	EM	NA	0.26	0.14	eL30
3nnd.1.A	10.26	homo-tetramer	HHblits	X-ray	2.80Å	0.24	0.15	Possible substrate binding protein of ABC transporter system
3saj.1.A	10.00	homo-dimer	HHblits	X-ray	2.50Å	0.22	0.15	Glutamate receptor 1
3saj.1.B	10.00	homo-dimer	HHblits	X-ray	2.50Å	0.22	0.15	Glutamate receptor 1
3saj.2.A	10.00	homo-dimer	HHblits	X-ray	2.50Å	0.22	0.15	Glutamate receptor 1
3saj.2.B	10.00	homo-dimer	HHblits	X-ray	2.50Å	0.22	0.15	Glutamate receptor 1
5kbv.1.A	7.69	homo-tetramer	HHblits	EM	NA	0.24	0.15	Glutamate receptor 2
5kbv.1.B	7.69	homo-tetramer	HHblits	EM	NA	0.24	0.15	Glutamate receptor 2
5kbv.1.C	7.69	homo-tetramer	HHblits	EM	NA	0.24	0.15	Glutamate receptor 2
5kbv.1.D	7.69	homo-tetramer	HHblits	EM	NA	0.24	0.15	Glutamate receptor 2
4mlc.1.A	19.44	monomer	HHblits	X-ray	2.71Å	0.30	0.14	Extracellular ligand-binding receptor
4q6b.1.A	19.44	monomer	HHblits	X-ray	1.67Å	0.30	0.14	Extracellular ligand-binding receptor
4kv7.1.A	7.89	monomer	HHblits	X-ray	1.20Å	0.25	0.14	Probable leucine/isoleucine/valine-binding protein
4evq.1.A	13.51	monomer	HHblits	X-ray	1.40Å	0.27	0.14	Putative ABC transporter subunit, substrate-binding component
2lbp.1.A	13.51	monomer	HHblits	X-ray	2.40Å	0.26	0.14	LEUCINE-BINDING PROTEIN
3sg0.1.A	10.81	monomer	HHblits	X-ray	1.20Å	0.26	0.14	Extracellular ligand-binding receptor
4f06.1.A	5.41	monomer	HHblits	X-ray	1.30Å	0.26	0.14	Extracellular ligand-binding receptor
4obb.1.A	13.89	monomer	HHblits	X-ray	1.53Å	0.28	0.14	Amino acid/amide ABC transporter substrate-binding protein, HAAT family
3ijd.1.A	22.86	homo-dimer	HHblits	X-ray	2.00Å	0.30	0.13	uncharacterized protein
4maa.1.A	5.26	monomer	HHblits	X-ray	2.00Å	0.24	0.14	Putative branched-chain amino acid ABC transporter, periplasmic amino acid-binding protein
3td9.1.A	8.11	homo-dimer	HHblits	X-ray	1.90Å	0.25	0.14	Branched chain amino acid ABC transporter, periplasmic amino acid-binding protein
3ipa.1.A	11.11	monomer	HHblits	X-ray	1.55Å	0.27	0.14	ABC transporter, substrate binding protein (Amino acid)
3hut.1.A	20.59	monomer	HHblits	X-ray	1.93Å	0.31	0.13	putative branched-chain amino acid ABC transporter
3h5v.2.A	8.11	homo-dimer	HHblits	X-ray	2.33Å	0.24	0.14	Glutamate receptor 2
3h5v.1.B	8.11	homo-dimer	HHblits	X-ray	2.33Å	0.24	0.14	Glutamate receptor 2
3h5v.1.A	8.11	homo-dimer	HHblits	X-ray	2.33Å	0.24	0.14	Glutamate receptor 2
3h5w.1.A	8.11	homo-dimer	HHblits	X-ray	2.69Å	0.24	0.14	Glutamate receptor 2
3h5w.1.B	8.11	homo-dimer	HHblits	X-ray	2.69Å	0.24	0.14	Glutamate receptor 2
4ivm.1.A	18.18	monomer	HHblits	X-ray	2.77Å	0.32	0.12	Protoporphyrinogen oxidase
3hly.1.A	20.59	monomer	HHblits	X-ray	2.40Å	0.29	0.13	Flavodoxin-like domain
3hly.2.A	20.59	monomer	HHblits	X-ray	2.40Å	0.29	0.13	Flavodoxin-like domain
3hly.3.A	20.59	monomer	HHblits	X-ray	2.40Å	0.29	0.13	Flavodoxin-like domain
1ka9.1.A	21.21	hetero-oligomer	HHblits	X-ray	2.30Å	0.31	0.12	imidazole glycerol phosphate synthase
5f1u.1.A	17.14	homo-tetramer	HHblits	X-ray	2.35Å	0.26	0.13	4-hydroxy-tetrahydrodipicolinate synthase
4ry9.1.A	18.18	monomer	HHblits	X-ray	1.40Å	0.30	0.12	Periplasmic binding protein/LacI transcriptional regulator
2rdm.1.A	27.27	homo-hexamer	HHblits	X-ray	1.76Å	0.30	0.12	Response regulator receiver protein
2rdm.1.B	27.27	homo-hexamer	HHblits	X-ray	1.76Å	0.30	0.12	Response regulator receiver protein
2rdm.1.C	27.27	homo-hexamer	HHblits	X-ray	1.76Å	0.30	0.12	Response regulator receiver protein
3nks.1.A	18.75	monomer	HHblits	X-ray	1.90Å	0.32	0.12	Protoporphyrinogen oxidase
3o2j.1.A	8.57	homo-dimer	HHblits	X-ray	1.95Å	0.24	0.13	Glutamate receptor 2
3o2j.1.B	8.57	homo-dimer	HHblits	X-ray	1.95Å	0.24	0.13	Glutamate receptor 2
5fwy.1.B	5.56	hetero-oligomer	HHblits	X-ray	2.12Å	0.22	0.14	GLUTAMATE RECEPTOR 3
4gpa.1.A	11.43	homo-dimer	HHblits	X-ray	2.25Å	0.24	0.13	Glutamate receptor 4
5fwx.1.B	11.43	hetero-oligomer	HHblits	X-ray	2.50Å	0.24	0.13	GLUTAMATE RECEPTOR 4
1usi.1.A	27.59	monomer	HHblits	X-ray	1.80Å	0.32	0.11	LEUCINE-SPECIFIC BINDING PROTEIN
1usg.1.A	27.59	homo-dimer	HHblits	X-ray	1.53Å	0.32	0.11	LEUCINE-SPECIFIC BINDING PROTEIN
5dkv.1.A	16.67	monomer	HHblits	X-ray	1.68Å	0.28	0.11	ABC transporter substrate binding protein (Ribose)
5dkv.4.A	16.67	monomer	HHblits	X-ray	1.68Å	0.28	0.11	ABC transporter substrate binding protein (Ribose)
5fwy.1.A	9.68	hetero-oligomer	HHblits	X-ray	2.12Å	0.25	0.12	GLUTAMATE RECEPTOR 2
5fwx.2.A	9.68	hetero-oligomer	HHblits	X-ray	2.50Å	0.25	0.12	GLUTAMATE RECEPTOR 2
5fwx.1.A	9.68	hetero-oligomer	HHblits	X-ray	2.50Å	0.25	0.12	GLUTAMATE RECEPTOR 2
4kqc.1.A	13.79	monomer	HHblits	X-ray	1.62Å	0.26	0.11	Periplasmic binding protein/LacI transcriptional regulator
2liv.1.A	30.77	monomer	HHblits	X-ray	2.40Å	0.35	0.10	LEUCINE
3i09.1.A	14.29	monomer	HHblits	X-ray	1.80Å	0.29	0.11	Periplasmic branched-chain amino acid-binding protein
5tic.1.A	7.14	monomer	HHblits	X-ray	1.65Å	0.27	0.11	Acyl-CoA thioesterase I
5tic.2.A	7.14	monomer	HHblits	X-ray	1.65Å	0.27	0.11	Acyl-CoA thioesterase I
2lle.1.A	32.00	monomer	HHblits	NMR	NA	0.35	0.09	Chemotaxis protein CheY, Imidazole glycerol phosphate synthase subunit HisF chimera
5kp9.1.A	19.23	homo-60-mer	HHblits	EM	NA	0.29	0.10	EPN-01*
1cl0.1.A	24.00	homo-dimer	HHblits	X-ray	2.50Å	0.31	0.09	THIOREDOXIN REDUCTASE
4mld.1.A	24.00	homo-dimer	HHblits	X-ray	2.88Å	0.30	0.09	Response regulator
4mld.1.B	24.00	homo-dimer	HHblits	X-ray	2.88Å	0.30	0.09	Response regulator
4mld.2.A	24.00	homo-dimer	HHblits	X-ray	2.88Å	0.30	0.09	Response regulator
4mld.2.B	24.00	homo-dimer	HHblits	X-ray	2.88Å	0.30	0.09	Response regulator
3vcr.1.A	16.00	homo-trimer	HHblits	X-ray	1.84Å	0.29	0.09	putative Kdpg (2-keto-3-deoxy-6-phosphogluconate) aldolase
2pug.1.B	20.83	homo-dimer	HHblits	X-ray	2.70Å	0.33	0.09	PROTEIN (PURINE REPRESSOR)
4y9t.1.A	11.54	monomer	HHblits	X-ray	1.80Å	0.26	0.10	ABC transporter, solute binding protein
5ufh.1.A	16.67	homo-dimer	HHblits	X-ray	1.45Å	0.32	0.09	LacI-type transcriptional regulator
4zpj.1.A	7.69	monomer	HHblits	X-ray	2.24Å	0.23	0.10	Extracellular ligand-binding receptor
4rs3.1.A	12.00	monomer	HHblits	X-ray	1.40Å	0.26	0.09	ABC transporter, carbohydrate uptake transporter-2 (CUT2) family, periplasmic sugar-binding protein
1qnl.1.A	17.39	homo-tetramer	HHblits	X-ray	2.70Å	0.32	0.09	ALIPHATIC AMIDASE EXPRESSION-REGULATING PROTEIN
4evs.1.A	8.00	monomer	HHblits	X-ray	1.45Å	0.25	0.09	PUTATIVE ABC TRANSPORTER SUBUNIT, SUBSTRATE-BINDING COMPONENT
2uyy.1.A	22.73	homo-tetramer	HHblits	X-ray	2.50Å	0.35	0.08	N-PAC PROTEIN
4n0q.1.A	8.70	monomer	HHblits	X-ray	2.30Å	0.31	0.09	Leu/Ile/Val-binding protein homolog 3
3d02.1.A	4.00	monomer	HHblits	X-ray	1.30Å	0.24	0.09	Putative LACI-type transcriptional regulator
3ic5.1.A	27.27	monomer	HHblits	X-ray	2.08Å	0.34	0.08	putative saccharopine dehydrogenase
1qo0.1.A	18.18	hetero-oligomer	HHblits	X-ray	2.25Å	0.33	0.08	AMIC
1pea.1.A	18.18	homo-dimer	HHblits	X-ray	2.10Å	0.33	0.08	AMIDASE OPERON
1tm2.1.A	17.39	monomer	HHblits	X-ray	1.90Å	0.30	0.09	sugar transport protein
1tjy.1.A	17.39	monomer	HHblits	X-ray	1.30Å	0.30	0.09	sugar transport protein
5gta.1.A	17.39	monomer	HHblits	X-ray	3.00Å	0.30	0.09	Autoinducer 2-binding protein LsrB
5bra.1.A	8.00	monomer	HHblits	X-ray	2.97Å	0.23	0.09	Putative periplasmic binding protein with substrate ribose
4rk0.1.A	13.04	homo-dimer	HHblits	X-ray	1.80Å	0.28	0.09	LacI family sugar-binding transcriptional regulator
4rk0.1.B	13.04	homo-dimer	HHblits	X-ray	1.80Å	0.28	0.09	LacI family sugar-binding transcriptional regulator
1glg.1.A	0.00	monomer	HHblits	X-ray	2.00Å	0.21	0.09	GALACTOSE/GLUCOSE-BINDING PROTEIN
2qw1.1.A	0.00	monomer	HHblits	X-ray	1.70Å	0.21	0.09	D-galactose-binding periplasmic protein
2fvy.1.A	0.00	monomer	HHblits	X-ray	0.92Å	0.21	0.09	D-galactose-binding periplasmic protein
1z16.1.A	28.57	monomer	HHblits	X-ray	1.72Å	0.35	0.08	Leu/Ile/Val-binding protein
1z15.1.A	28.57	monomer	HHblits	X-ray	1.70Å	0.35	0.08	Leu/Ile/Val-binding protein
4zjp.1.A	4.17	monomer	HHblits	X-ray	1.63Å	0.24	0.09	Monosaccharide-transporting ATPase
3eul.1.A	13.04	monomer	HHblits	X-ray	1.90Å	0.27	0.09	POSSIBLE NITRATE/NITRITE RESPONSE TRANSCRIPTIONAL REGULATORY PROTEIN NARL (DNA-binding response regulator, LuxR family)
1drk.1.A	4.17	monomer	HHblits	X-ray	2.00Å	0.23	0.09	D-RIBOSE-BINDING PROTEIN
4o5a.1.A	8.33	homo-dimer	HHblits	X-ray	1.78Å	0.23	0.09	LacI family transcription regulator
3ma0.1.A	8.70	monomer	HHblits	X-ray	2.20Å	0.26	0.09	D-xylose-binding periplasmic protein
3m9w.1.A	8.70	monomer	HHblits	X-ray	2.15Å	0.26	0.09	D-xylose-binding periplasmic protein
1jhz.1.A	13.64	homo-dimer	HHblits	X-ray	2.40Å	0.29	0.08	PURINE NUCLEOTIDE SYNTHESIS REPRESSOR
1jhz.1.B	13.64	homo-dimer	HHblits	X-ray	2.40Å	0.29	0.08	PURINE NUCLEOTIDE SYNTHESIS REPRESSOR
1dbq.1.A	13.64	homo-dimer	HHblits	X-ray	2.20Å	0.29	0.08	PURINE REPRESSOR
1dbq.1.B	13.64	homo-dimer	HHblits	X-ray	2.20Å	0.29	0.08	PURINE REPRESSOR
4ezb.1.A	18.18	homo-dimer	HHblits	X-ray	2.10Å	0.28	0.08	uncharacterized conserved protein
2ipm.1.A	0.00	monomer	HHblits	X-ray	1.12Å	0.21	0.09	D-galactose-binding periplasmic protein
2hph.1.A	0.00	monomer	HHblits	X-ray	1.33Å	0.21	0.09	D-galactose-binding periplasmic protein
3ejw.1.A	13.64	monomer	HHblits	X-ray	1.80Å	0.28	0.08	SmLsrB
3tq0.1.A	23.81	homo-dimer	HHblits	X-ray	1.90Å	0.30	0.08	Dihydroorotate dehydrogenase
3gg2.1.A	28.57	homo-tetramer	HHblits	X-ray	1.70Å	0.30	0.08	Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family
2ipl.1.A	0.00	monomer	HHblits	X-ray	1.20Å	0.21	0.09	D-galactose-binding periplasmic protein
5bq3.1.A	0.00	monomer	HHblits	X-ray	2.60Å	0.25	0.08	Rhamnose ABC transporter, rhamnose-binding protein
5bq3.4.A	0.00	monomer	HHblits	X-ray	2.60Å	0.25	0.08	Rhamnose ABC transporter, rhamnose-binding protein
2w0u.1.A	10.00	homo-tetramer	HHblits	X-ray	2.84Å	0.30	0.08	HYDROXYACID OXIDASE 1
3iwp.1.B	10.00	homo-tetramer	HHblits	X-ray	2.50Å	0.29	0.08	Copper homeostasis protein cutC homolog
3iwp.1.A	10.00	homo-tetramer	HHblits	X-ray	2.50Å	0.29	0.08	Copper homeostasis protein cutC homolog
3iwp.2.B	10.00	homo-tetramer	HHblits	X-ray	2.50Å	0.29	0.08	Copper homeostasis protein cutC homolog
3iwp.2.C	10.00	homo-tetramer	HHblits	X-ray	2.50Å	0.29	0.08	Copper homeostasis protein cutC homolog
3iwp.2.D	10.00	homo-tetramer	HHblits	X-ray	2.50Å	0.29	0.08	Copper homeostasis protein cutC homolog
3iwp.3.A	10.00	homo-tetramer	HHblits	X-ray	2.50Å	0.29	0.08	Copper homeostasis protein cutC homolog
3iwp.3.B	10.00	homo-tetramer	HHblits	X-ray	2.50Å	0.29	0.08	Copper homeostasis protein cutC homolog
3iwp.3.C	10.00	homo-tetramer	HHblits	X-ray	2.50Å	0.29	0.08	Copper homeostasis protein cutC homolog
3iwp.3.D	10.00	homo-tetramer	HHblits	X-ray	2.50Å	0.29	0.08	Copper homeostasis protein cutC homolog
3sgz.1.A	21.05	homo-tetramer	HHblits	X-ray	1.35Å	0.33	0.07	Hydroxyacid oxidase 2
4z0n.1.A	5.00	monomer	HHblits	X-ray	1.26Å	0.28	0.08	Periplasmic binding protein/LacI transcriptional regulator
1rvk.1.A	15.00	monomer	HHblits	X-ray	1.70Å	0.27	0.08	isomerase/lactonizing enzyme
3k9c.1.A	4.76	homo-dimer	HHblits	X-ray	2.14Å	0.23	0.08	Transcriptional regulator, LacI family protein
3sqs.1.A	0.00	homo-octamer	HHblits	X-ray	1.90Å	0.21	0.08	mandelate racemase/muconate lactonizing protein
3nzg.1.A	5.00	homo-octamer	HHblits	X-ray	2.00Å	0.22	0.08	Putative racemase
3ipc.1.A	6.67	monomer	HHblits	X-ray	1.30Å	0.24	0.06	ABC transporter, substrate binding protein (Amino acid)