SWISS-MODEL | Workspace | Model Results

SWISS-MODEL Homology Modelling Report

Model Building Report

This document lists the results for the homology modelling project "Q02G12" submitted to SWISS-MODEL workspace on Oct. 18, 2017, 4:50 p.m..The submitted primary amino acid sequence is given in Table T1.

If you use any results in your research, please cite the relevant publications:

Marco Biasini; Stefan Bienert; Andrew Waterhouse; Konstantin Arnold; Gabriel Studer; Tobias Schmidt; Florian Kiefer; Tiziano Gallo Cassarino; Martino Bertoni; Lorenza Bordoli; Torsten Schwede. (2014). SWISS-MODEL: modelling protein tertiary and quaternary structure using evolutionary information. Nucleic Acids Research (1 July 2014) 42 (W1): W252-W258; doi: 10.1093/nar/gku340.
Arnold, K., Bordoli, L., Kopp, J. and Schwede, T. (2006) The SWISS-MODEL workspace: a web-based environment for protein structure homology modelling. Bioinformatics, 22, 195-201.
Benkert, P., Biasini, M. and Schwede, T. (2011) Toward the estimation of the absolute quality of individual protein structure models. Bioinformatics, 27, 343-350

Results

The SWISS-MODEL template library (SMTL version 2017-10-11, PDB release 2017-10-06) was searched with Blast (Altschul et al., 1997) and HHBlits (Remmert, et al., 2011) for evolutionary related structures matching the target sequence in Table T1. For details on the template search, see Materials and Methods. Overall 591 templates were found (Table T2).

Models

The following model was built (see Materials and Methods "Model Building"):

Model #01	File	Built with	Oligo-State	Ligands	GMQE	QMEAN
	PDB	ProMod3 Version 1.1.0.	MONOMER (matching prediction)	1 x DGL: D-GLUTAMIC ACID;	0.74	-1.73

QMEAN	-1.73
Cβ	-0.37
All Atom	0.59
Solvation	0.47
Torsion	-1.87

Template	Seq Identity	Oligo-state	Found by	Method	Resolution	Seq Similarity	Range	Coverage	Description
5ijw.1.B	39.84	homo-dimer	HHblits	X-ray	1.76Å	0.38		0.97	Glutamate racemase

Ligand	Added to Model	Description
DGL	✓	D-GLUTAMIC ACID
DGL	✕ - Binding site not conserved.	D-GLUTAMIC ACID
IOD	✕ - Not biologically relevant.	IODIDE ION
IOD	✕ - Not biologically relevant.	IODIDE ION
IOD	✕ - Not biologically relevant.	IODIDE ION

Target    MAVESAAVGVFDSGVGGLSVLREIRARLPSESLLYVADNAHVPYGEKSAEYIRERCERIGDFLLEQGAKALVLACNTATA
5ijw.1.B  MSDRLAPIGIFDSGVGGLTVARAIIDQLPDEDIVYVGDTGNGPYGPLTIPQIRAHSLAIGDDLVSRGVKALVIACNTASS

Target    AAAAELRERYPQ-VQLVAM-EPAVKPAAAATRNGRVGVLATTGTLKSARFAALLDRFASDVQVFTQPCPGLVERIEAGDL
5ijw.1.B  ACLRDARERY-SPVPVVEVILPAVRRAVAATRNGRIGVIGTQATIASGAYQDAFAA-ARDTEVFTVACPRFVDFVERGVT

Target    YGPQTRALLERLLAPILEQGCDTLILGCTHYPFVKPLLAELIPAEMAVIDTGAAVARQLERVLSARALLASG--Q---AA
5ijw.1.B  SGRQVLGLAEGYLEPLQLAEVDTLVLGCTHYPMLSGLIQLAMGDNVTLVSSAEETAKDLLRVLTELDLLRPHPDDPSVTA

Target    TPRFWTSALPEEMERILPILWGSPESVGKLVV
5ijw.1.B  VRRFEATGDPEAFTALAARFLGPTL-------

Materials and Methods

Template Search

Template search with Blast and HHBlits has been performed against the SWISS-MODEL template library (SMTL, last update: 2017-10-11, last included PDB release: 2017-10-06).

The target sequence was searched with BLAST (Altschul et al., 1997) against the primary amino acid sequence contained in the SMTL. A total of 37 templates were found.

An initial HHblits profile has been built using the procedure outlined in (Remmert, et al., 2011), followed by 1 iteration of HHblits against NR20. The obtained profile has then be searched against all profiles of the SMTL. A total of 560 templates were found.

Template Selection

For each identified template, the template's quality has been predicted from features of the target-template alignment. The templates with the highest quality have then been selected for model building.

Model Building

Models are built based on the target-template alignment using ProMod3. Coordinates which are conserved between the target and the template are copied from the template to the model. Insertions and deletions are remodelled using a fragment library. Side chains are then rebuilt. Finally, the geometry of the resulting model is regularized by using a force field. In case loop modelling with ProMod3 fails, an alternative model is built with PROMOD-II (Guex, et al., 1997).

Model Quality Estimation

The global and per-residue model quality has been assessed using the QMEAN scoring function (Benkert, et al., 2011) . For improved performance, weights of the individual QMEAN terms have been trained specifically for SWISS-MODEL.

Ligand Modelling

Ligands present in the template structure are transferred by homology to the model when the following criteria are met (Gallo -Casserino, to be published): (a) The ligands are annotated as biologically relevant in the template library, (b) the ligand is in contact with the model, (c) the ligand is not clashing with the protein, (d) the residues in contact with the ligand are conserved between the target and the template. If any of these four criteria is not satisfied, a certain ligand will not be included in the model. The model summary includes information on why and which ligand has not been included.

Oligomeric State Conservation

Homo-oligomeric structure of the target protein is predicted based on the analysis of pairwise interfaces of the identified template structures. For each relevant interface between polypeptide chains (interfaces with more than 10 residue-residue interactions), the QscoreOligomer (Mariani et al., 2011) is predicted from features such as similarity to target and frequency of observing this interface in the identified templates (Kiefer, Bertoni, Biasini, to be published). The prediction is performed with a random forest regressor using these features as input parameters to predict the probability of conservation for each interface. The QscoreOligomer of the whole complex is then calculated as the weight-averaged QscoreOligomer of the interfaces. The oligomeric state of the target is predicted to be the same as in the template when QscoreOligomer is predicted to be higher or equal to 0.5.

References

Altschul, S.F., Madden, T.L., Schaffer, A.A., Zhang, J., Zhang, Z., Miller, W. and Lipman, D.J. (1997) Gapped BLAST and PSI-BLAST: a new generation of protein database search programs. Nucleic Acids Res, 25, 3389-3402.
Remmert, M., Biegert, A., Hauser, A. and Soding, J. (2012) HHblits: lightning-fast iterative protein sequence searching by HMM-HMM alignment. Nat Methods, 9, 173-175.
Guex, N. and Peitsch, M.C. (1997) SWISS-MODEL and the Swiss-PdbViewer: an environment for comparative protein modeling. Electrophoresis, 18, 2714-2723.
Sali, A. and Blundell, T.L. (1993) Comparative protein modelling by satisfaction of spatial restraints. J Mol Biol, 234, 779-815.
Benkert, P., Biasini, M. and Schwede, T. (2011) Toward the estimation of the absolute quality of individual protein structure models. Bioinformatics, 27, 343-350.
Mariani, V., Kiefer, F., Schmidt, T., Haas, J. and Schwede, T. (2011) Assessment of template based protein structure predictions in CASP9. Proteins, 79 Suppl 10, 37-58.

Table T1:

Primary amino acid sequence for which templates were searched and models were built.

MAVESAAVGVFDSGVGGLSVLREIRARLPSESLLYVADNAHVPYGEKSAEYIRERCERIGDFLLEQGAKALVLACNTATAAAAAELRERYPQVQLVAMEP
AVKPAAAATRNGRVGVLATTGTLKSARFAALLDRFASDVQVFTQPCPGLVERIEAGDLYGPQTRALLERLLAPILEQGCDTLILGCTHYPFVKPLLAELI
PAEMAVIDTGAAVARQLERVLSARALLASGQAATPRFWTSALPEEMERILPILWGSPESVGKLVV

Table T2:

Template	Seq Identity	Oligo-state	Found by	Method	Resolution	Seq Similarity	Coverage	Description
3hfr.1.A	33.98	homo-dimer	HHblits	X-ray	2.30Å	0.38	0.98	Glutamate racemase
3hfr.1.B	33.98	homo-dimer	HHblits	X-ray	2.30Å	0.38	0.98	Glutamate racemase
5ijw.1.A	39.84	homo-dimer	HHblits	X-ray	1.76Å	0.38	0.97	Glutamate racemase
5ijw.1.B	39.84	homo-dimer	HHblits	X-ray	1.76Å	0.38	0.97	Glutamate racemase
5hj7.1.A	38.67	homo-dimer	HHblits	X-ray	2.30Å	0.38	0.97	Glutamate racemase
2jfp.1.A	32.17	homo-dimer	HHblits	X-ray	1.98Å	0.37	0.97	GLUTAMATE RACEMASE
2jfo.1.B	32.17	homo-dimer	HHblits	X-ray	2.50Å	0.37	0.97	GLUTAMATE RACEMASE
2vvt.1.A	32.17	homo-dimer	HHblits	X-ray	1.65Å	0.37	0.97	GLUTAMATE RACEMASE
2vvt.1.B	32.17	homo-dimer	HHblits	X-ray	1.65Å	0.37	0.97	GLUTAMATE RACEMASE
2gzm.1.A	32.56	homo-dimer	HHblits	X-ray	1.99Å	0.37	0.97	Glutamate racemase
2gzm.1.B	32.56	homo-dimer	HHblits	X-ray	1.99Å	0.37	0.97	Glutamate racemase
2gzm.2.B	32.56	homo-dimer	HHblits	X-ray	1.99Å	0.37	0.97	Glutamate racemase
2jfw.1.A	32.68	homo-dimer	HHblits	X-ray	2.00Å	0.37	0.97	GLUTAMATE RACEMASE
1zuw.1.A	32.17	homo-dimer	HHblits	X-ray	1.75Å	0.37	0.97	glutamate racemase 1
1zuw.1.B	32.17	homo-dimer	HHblits	X-ray	1.75Å	0.37	0.97	glutamate racemase 1
2dwu.1.A	32.17	homo-dimer	HHblits	X-ray	1.60Å	0.36	0.97	Glutamate racemase
2dwu.2.A	32.17	homo-dimer	HHblits	X-ray	1.60Å	0.36	0.97	Glutamate racemase
2ohv.1.A	31.91	homo-dimer	HHblits	X-ray	2.50Å	0.37	0.97	Glutamate Racemase
2ohg.1.A	31.91	homo-dimer	HHblits	X-ray	2.50Å	0.37	0.97	Glutamate racemase
2oho.1.A	32.03	homo-dimer	HHblits	X-ray	2.25Å	0.37	0.97	Glutamate Racemase
2oho.1.B	32.03	homo-dimer	HHblits	X-ray	2.25Å	0.37	0.97	Glutamate Racemase
5hj7.1.A	40.49	homo-dimer	BLAST	X-ray	2.30Å	0.39	0.93	Glutamate racemase
2jfq.1.A	32.03	homo-dimer	HHblits	X-ray	2.15Å	0.36	0.97	GLUTAMATE RACEMASE
2jfq.1.B	32.03	homo-dimer	HHblits	X-ray	2.15Å	0.36	0.97	GLUTAMATE RACEMASE
2oho.1.A	33.60	homo-dimer	BLAST	X-ray	2.25Å	0.37	0.94	Glutamate Racemase
2oho.1.B	33.60	homo-dimer	BLAST	X-ray	2.25Å	0.37	0.94	Glutamate Racemase
2ohv.1.A	33.33	homo-dimer	BLAST	X-ray	2.50Å	0.37	0.94	Glutamate Racemase
2ohg.1.A	33.33	homo-dimer	BLAST	X-ray	2.50Å	0.37	0.94	Glutamate racemase
2jfn.1.A	38.96	monomer	HHblits	X-ray	1.90Å	0.37	0.94	GLUTAMATE RACEMASE
2jfn.1.A	41.98	monomer	BLAST	X-ray	1.90Å	0.39	0.92	GLUTAMATE RACEMASE
1zuw.1.A	33.06	homo-dimer	BLAST	X-ray	1.75Å	0.37	0.94	glutamate racemase 1
1zuw.1.B	33.06	homo-dimer	BLAST	X-ray	1.75Å	0.37	0.94	glutamate racemase 1
2vvt.1.A	34.57	homo-dimer	BLAST	X-ray	1.65Å	0.38	0.92	GLUTAMATE RACEMASE
2vvt.1.B	34.57	homo-dimer	BLAST	X-ray	1.65Å	0.38	0.92	GLUTAMATE RACEMASE
2jfp.1.A	34.57	homo-dimer	BLAST	X-ray	1.98Å	0.38	0.92	GLUTAMATE RACEMASE
2jfo.1.B	34.57	homo-dimer	BLAST	X-ray	2.50Å	0.38	0.92	GLUTAMATE RACEMASE
2jfw.1.A	34.30	homo-dimer	BLAST	X-ray	2.00Å	0.38	0.91	GLUTAMATE RACEMASE
1b73.1.A	33.61	homo-dimer	HHblits	X-ray	2.30Å	0.37	0.92	GLUTAMATE RACEMASE
2dwu.1.A	32.52	homo-dimer	BLAST	X-ray	1.60Å	0.36	0.93	Glutamate racemase
2dwu.2.A	32.52	homo-dimer	BLAST	X-ray	1.60Å	0.36	0.93	Glutamate racemase
3out.1.A	28.46	homo-hexamer	HHblits	X-ray	1.65Å	0.36	0.93	Glutamate racemase
2jfq.1.A	33.74	homo-dimer	BLAST	X-ray	2.15Å	0.36	0.92	GLUTAMATE RACEMASE
2jfq.1.B	33.74	homo-dimer	BLAST	X-ray	2.15Å	0.36	0.92	GLUTAMATE RACEMASE
1b73.1.A	34.87	homo-dimer	BLAST	X-ray	2.30Å	0.38	0.90	GLUTAMATE RACEMASE
3hfr.1.A	36.60	homo-dimer	BLAST	X-ray	2.30Å	0.39	0.89	Glutamate racemase
3hfr.1.B	36.60	homo-dimer	BLAST	X-ray	2.30Å	0.39	0.89	Glutamate racemase
2gzm.1.A	33.19	homo-dimer	BLAST	X-ray	1.99Å	0.37	0.89	Glutamate racemase
2gzm.1.B	33.19	homo-dimer	BLAST	X-ray	1.99Å	0.37	0.89	Glutamate racemase
2gzm.2.B	33.19	homo-dimer	BLAST	X-ray	1.99Å	0.37	0.89	Glutamate racemase
5ijw.1.A	43.75	homo-dimer	BLAST	X-ray	1.76Å	0.40	0.85	Glutamate racemase
5ijw.1.B	43.75	homo-dimer	BLAST	X-ray	1.76Å	0.40	0.85	Glutamate racemase
3uho.1.A	31.78	monomer	BLAST	X-ray	2.20Å	0.36	0.89	Glutamate racemase
3uhf.2.A	31.78	monomer	BLAST	X-ray	1.83Å	0.36	0.89	Glutamate racemase
3uhp.1.A	31.78	monomer	BLAST	X-ray	2.79Å	0.36	0.89	Glutamate racemase
3uho.1.A	28.10	monomer	HHblits	X-ray	2.20Å	0.34	0.91	Glutamate racemase
3uhf.2.A	28.10	monomer	HHblits	X-ray	1.83Å	0.34	0.91	Glutamate racemase
3uhp.1.A	28.10	monomer	HHblits	X-ray	2.79Å	0.34	0.91	Glutamate racemase
2jfy.1.B	25.71	homo-dimer	HHblits	X-ray	1.90Å	0.33	0.92	GLUTAMATE RACEMASE
2jfz.1.A	25.71	homo-dimer	HHblits	X-ray	1.86Å	0.33	0.92	GLUTAMATE RACEMASE
2jfx.1.A	25.71	homo-dimer	HHblits	X-ray	2.30Å	0.33	0.92	GLUTAMATE RACEMASE
2jfx.1.B	25.71	homo-dimer	HHblits	X-ray	2.30Å	0.33	0.92	GLUTAMATE RACEMASE
2jfy.1.A	25.71	homo-dimer	HHblits	X-ray	1.90Å	0.33	0.92	GLUTAMATE RACEMASE
4b1f.1.B	25.71	homo-dimer	HHblits	X-ray	2.05Å	0.33	0.92	GLUTAMATE RACEMASE
2w4i.1.A	25.71	homo-tetramer	HHblits	X-ray	1.87Å	0.33	0.92	GLUTAMATE RACEMASE
5w1q.1.A	25.71	homo-dimer	HHblits	X-ray	1.95Å	0.33	0.92	Glutamate racemase
3out.1.A	31.00	homo-hexamer	BLAST	X-ray	1.65Å	0.37	0.86	Glutamate racemase
2jfy.1.B	31.10	homo-dimer	BLAST	X-ray	1.90Å	0.35	0.79	GLUTAMATE RACEMASE
2jfz.1.A	31.10	homo-dimer	BLAST	X-ray	1.86Å	0.35	0.79	GLUTAMATE RACEMASE
2jfx.1.A	31.10	homo-dimer	BLAST	X-ray	2.30Å	0.35	0.79	GLUTAMATE RACEMASE
2jfx.1.B	31.10	homo-dimer	BLAST	X-ray	2.30Å	0.35	0.79	GLUTAMATE RACEMASE
2jfy.1.A	31.10	homo-dimer	BLAST	X-ray	1.90Å	0.35	0.79	GLUTAMATE RACEMASE
4b1f.1.B	31.10	homo-dimer	BLAST	X-ray	2.05Å	0.35	0.79	GLUTAMATE RACEMASE
2w4i.1.A	31.10	homo-tetramer	BLAST	X-ray	1.87Å	0.35	0.79	GLUTAMATE RACEMASE
5b19.1.A	22.12	homo-dimer	HHblits	X-ray	1.85Å	0.31	0.78	Aspartate racemase
5b19.1.B	22.12	homo-dimer	HHblits	X-ray	1.85Å	0.31	0.78	Aspartate racemase
1jfl.1.A	23.53	homo-dimer	HHblits	X-ray	1.90Å	0.32	0.77	ASPARTATE RACEMASE
2dx7.1.A	23.04	homo-dimer	HHblits	X-ray	2.00Å	0.32	0.77	aspartate racemase
2dx7.1.B	23.04	homo-dimer	HHblits	X-ray	2.00Å	0.32	0.77	aspartate racemase
3s81.1.A	20.59	homo-dimer	HHblits	X-ray	1.80Å	0.31	0.77	Putative aspartate racemase
5ell.1.A	18.36	homo-dimer	HHblits	X-ray	1.80Å	0.30	0.78	Asp/Glu_racemase family protein
5ell.1.B	18.36	homo-dimer	HHblits	X-ray	1.80Å	0.30	0.78	Asp/Glu_racemase family protein
5hqt.1.A	18.45	homo-dimer	HHblits	X-ray	1.60Å	0.29	0.78	aspartate/glutamate racemase
2eq5.1.A	20.00	homo-dimer	HHblits	X-ray	2.20Å	0.29	0.77	228aa long hypothetical hydantoin racemase
2eq5.2.B	20.00	homo-dimer	HHblits	X-ray	2.20Å	0.29	0.77	228aa long hypothetical hydantoin racemase
3ojc.1.A	18.23	homo-tetramer	HHblits	X-ray	1.75Å	0.30	0.77	Putative aspartate/glutamate racemase
3ojc.1.B	18.23	homo-tetramer	HHblits	X-ray	1.75Å	0.30	0.77	Putative aspartate/glutamate racemase
3ojc.1.C	18.23	homo-tetramer	HHblits	X-ray	1.75Å	0.30	0.77	Putative aspartate/glutamate racemase
3ojc.1.D	18.23	homo-tetramer	HHblits	X-ray	1.75Å	0.30	0.77	Putative aspartate/glutamate racemase
5elm.1.A	17.56	homo-dimer	HHblits	X-ray	2.00Å	0.29	0.77	Asp/Glu_racemase family protein
5elm.1.B	17.56	homo-dimer	HHblits	X-ray	2.00Å	0.29	0.77	Asp/Glu_racemase family protein
5elm.2.A	17.56	homo-dimer	HHblits	X-ray	2.00Å	0.29	0.77	Asp/Glu_racemase family protein
5elm.2.B	17.56	homo-dimer	HHblits	X-ray	2.00Å	0.29	0.77	Asp/Glu_racemase family protein
2zsk.1.A	18.81	homo-dimer	HHblits	X-ray	2.55Å	0.30	0.76	226aa long hypothetical aspartate racemase
4fq7.1.A	15.53	homo-tetramer	HHblits	X-ray	3.00Å	0.28	0.78	Maleate cis-trans isomerase
2dgd.1.A	14.49	homo-octamer	HHblits	X-ray	2.90Å	0.27	0.78	223aa long hypothetical arylmalonate decarboxylase
2xed.1.A	14.01	monomer	HHblits	X-ray	1.95Å	0.27	0.78	PUTATIVE MALEATE ISOMERASE
2xec.1.A	14.56	homo-dimer	HHblits	X-ray	2.20Å	0.28	0.78	PUTATIVE MALEATE ISOMERASE
4fq5.1.A	14.56	homo-tetramer	HHblits	X-ray	2.10Å	0.27	0.78	Maleate cis-trans isomerase
4fq5.1.B	14.56	homo-tetramer	HHblits	X-ray	2.10Å	0.27	0.78	Maleate cis-trans isomerase
3qvj.1.A	18.32	homo-hexamer	HHblits	X-ray	2.10Å	0.28	0.76	Putative hydantoin racemase
3qvl.1.A	17.33	homo-hexamer	HHblits	X-ray	1.82Å	0.28	0.76	Putative hydantoin racemase
4ix1.1.A	13.59	homo-dimer	HHblits	X-ray	2.80Å	0.26	0.78	hypothetical protein
4ix1.1.B	13.59	homo-dimer	HHblits	X-ray	2.80Å	0.26	0.78	hypothetical protein
5w1q.1.A	31.15	homo-dimer	BLAST	X-ray	1.95Å	0.35	0.69	Glutamate racemase
4rs3.1.A	15.00	monomer	HHblits	X-ray	1.40Å	0.27	0.75	ABC transporter, carbohydrate uptake transporter-2 (CUT2) family, periplasmic sugar-binding protein
4yv7.1.A	13.43	monomer	HHblits	X-ray	2.30Å	0.27	0.76	Periplasmic binding protein/LacI transcriptional regulator
5lfd.1.A	16.00	homo-hexamer	HHblits	X-ray	2.15Å	0.27	0.75	Allantoin racemase
4wzz.1.A	9.36	monomer	HHblits	X-ray	1.70Å	0.26	0.77	Putative sugar ABC transporter, substrate-binding protein
3ixm.1.A	17.09	monomer	HHblits	X-ray	1.90Å	0.27	0.75	Arylmalonate decarboxylase
5ix8.1.A	11.33	monomer	HHblits	X-ray	1.60Å	0.25	0.77	Putative sugar ABC transport system, substrate-binding protein
3dg9.1.A	16.58	monomer	HHblits	X-ray	1.50Å	0.26	0.75	Arylmalonate decarboxylase
3hzr.1.A	11.79	homo-dimer	HHblits	X-ray	3.00Å	0.28	0.74	Tryptophanyl-tRNA synthetase
3dtv.3.A	16.58	monomer	HHblits	X-ray	2.10Å	0.26	0.75	Arylmalonate decarboxylase
3dtv.2.A	16.58	monomer	HHblits	X-ray	2.10Å	0.26	0.75	Arylmalonate decarboxylase
3dtv.1.A	16.58	monomer	HHblits	X-ray	2.10Å	0.26	0.75	Arylmalonate decarboxylase
3dtv.4.A	16.58	monomer	HHblits	X-ray	2.10Å	0.26	0.75	Arylmalonate decarboxylase
3eis.1.A	16.58	monomer	HHblits	X-ray	2.10Å	0.26	0.75	Arylmalonate decarboxylase
3eis.2.A	16.58	monomer	HHblits	X-ray	2.10Å	0.26	0.75	Arylmalonate decarboxylase
2vlb.1.A	16.08	monomer	HHblits	X-ray	1.92Å	0.26	0.75	ARYLMALONATE DECARBOXYLASE
2vlb.2.A	16.08	monomer	HHblits	X-ray	1.92Å	0.26	0.75	ARYLMALONATE DECARBOXYLASE
2vlb.3.A	16.08	monomer	HHblits	X-ray	1.92Å	0.26	0.75	ARYLMALONATE DECARBOXYLASE
2vlb.4.A	16.08	monomer	HHblits	X-ray	1.92Å	0.26	0.75	ARYLMALONATE DECARBOXYLASE
3ixl.1.A	16.16	monomer	HHblits	X-ray	1.45Å	0.26	0.75	Arylmalonate decarboxylase
2q5c.1.A	10.12	monomer	HHblits	X-ray	1.49Å	0.26	0.63	NtrC family transcriptional regulator
1gpw.1.A	15.29	hetero-oligomer	HHblits	X-ray	2.40Å	0.29	0.59	HISF PROTEIN
1gpw.3.A	15.29	hetero-oligomer	HHblits	X-ray	2.40Å	0.29	0.59	HISF PROTEIN
4fx7.1.A	13.21	monomer	HHblits	X-ray	2.08Å	0.26	0.60	Imidazole glycerol phosphate synthase subunit HisF
4ccz.1.A	18.44	monomer	HHblits	X-ray	2.70Å	0.29	0.53	METHIONINE SYNTHASE
5dmm.1.A	17.39	monomer	HHblits	X-ray	1.78Å	0.26	0.52	Homocysteine S-methyltransferase
5dmn.1.A	17.39	homo-dimer	HHblits	X-ray	2.89Å	0.26	0.52	Homocysteine S-methyltransferase
2lbp.1.A	12.59	monomer	HHblits	X-ray	2.40Å	0.27	0.51	LEUCINE-BINDING PROTEIN
4f06.1.A	15.67	monomer	HHblits	X-ray	1.30Å	0.28	0.51	Extracellular ligand-binding receptor
4evs.1.A	13.53	monomer	HHblits	X-ray	1.45Å	0.28	0.50	PUTATIVE ABC TRANSPORTER SUBUNIT, SUBSTRATE-BINDING COMPONENT
2w8z.1.A	11.28	homo-dimer	HHblits	X-ray	2.30Å	0.26	0.50	6-PHOSPHOGLUCONATE DEHYDROGENASE, DECARBOXYLATING
3pef.1.A	13.85	homo-tetramer	HHblits	X-ray	2.07Å	0.27	0.49	6-phosphogluconate dehydrogenase, NAD-binding
3pef.2.C	13.85	homo-tetramer	HHblits	X-ray	2.07Å	0.27	0.49	6-phosphogluconate dehydrogenase, NAD-binding
5a9r.1.A	18.60	homo-dimer	HHblits	X-ray	1.55Å	0.28	0.49	IMINE REDUCTASE
5a9s.1.A	18.60	hetero-oligomer	HHblits	X-ray	2.06Å	0.28	0.49	IMINE REDUCTASE
5fwn.1.B	18.60	homo-dimer	HHblits	X-ray	2.14Å	0.28	0.49	IMINE REDUCTASE
3pdu.1.A	16.54	homo-tetramer	HHblits	X-ray	1.89Å	0.27	0.48	3-hydroxyisobutyrate dehydrogenase family protein
3tdn.1.A	12.80	homo-dimer	HHblits	X-ray	1.40Å	0.26	0.47	FLR SYMMETRIC ALPHA-BETA TIM BARREL
4wxe.1.A	15.70	monomer	HHblits	X-ray	1.50Å	0.28	0.46	Transcriptional regulator, LacI family
3gbv.1.A	9.68	homo-dimer	HHblits	X-ray	2.20Å	0.26	0.47	Putative LacI-family transcriptional regulator
3gbv.1.B	9.68	homo-dimer	HHblits	X-ray	2.20Å	0.26	0.47	Putative LacI-family transcriptional regulator
4axk.1.A	18.18	monomer	HHblits	X-ray	2.25Å	0.28	0.46	1-(5-PHOSPHORIBOSYL)-5-((5'-PHOSPHORIBOSYLAMINO) METHYLIDENEAMINO)IMIDAZOLE-4-CARBOXAMIDE ISOMERASE
4axk.2.A	18.18	monomer	HHblits	X-ray	2.25Å	0.28	0.46	1-(5-PHOSPHORIBOSYL)-5-((5'-PHOSPHORIBOSYLAMINO) METHYLIDENEAMINO)IMIDAZOLE-4-CARBOXAMIDE ISOMERASE
4rk5.1.A	15.70	homo-dimer	HHblits	X-ray	1.35Å	0.28	0.46	Transcriptional regulator, LacI family
2y88.1.A	17.21	monomer	HHblits	X-ray	1.33Å	0.26	0.46	PHOSPHORIBOSYL ISOMERASE A
2y89.1.A	17.21	monomer	HHblits	X-ray	2.50Å	0.26	0.46	PHOSPHORIBOSYL ISOMERASE A
2y85.1.A	17.21	monomer	HHblits	X-ray	2.40Å	0.26	0.46	PHOSPHORIBOSYL ISOMERASE A
3zs4.1.A	17.21	monomer	HHblits	X-ray	1.90Å	0.26	0.46	PHOSPHORIBOSYL ISOMERASE A
2x30.1.A	18.49	monomer	HHblits	X-ray	1.95Å	0.27	0.45	PHOSPHORIBOSYL ISOMERASE A
4u28.1.A	17.65	monomer	HHblits	X-ray	1.33Å	0.27	0.45	Phosphoribosyl isomerase A
5ide.1.B	9.09	hetero-oligomer	HHblits	EM	NA	0.25	0.46	Glutamate receptor 3
5ide.1.D	9.09	hetero-oligomer	HHblits	EM	NA	0.25	0.46	Glutamate receptor 3
5idf.1.B	9.09	hetero-oligomer	HHblits	EM	NA	0.25	0.46	Glutamate receptor 3
5idf.1.D	9.09	hetero-oligomer	HHblits	EM	NA	0.25	0.46	Glutamate receptor 3
3ctp.1.A	9.32	homo-dimer	HHblits	X-ray	1.41Å	0.26	0.45	Periplasmic binding protein/LacI transcriptional regulator
1z16.1.A	13.16	monomer	HHblits	X-ray	1.72Å	0.28	0.43	Leu/Ile/Val-binding protein
1z15.1.A	13.16	monomer	HHblits	X-ray	1.70Å	0.28	0.43	Leu/Ile/Val-binding protein
1iu9.1.A	25.00	monomer	HHblits	X-ray	2.04Å	0.33	0.39	aspartate racemase
1jfl.1.A	20.79	homo-dimer	HHblits	X-ray	1.90Å	0.31	0.38	ASPARTATE RACEMASE
3s81.1.A	15.69	homo-dimer	HHblits	X-ray	1.80Å	0.30	0.38	Putative aspartate racemase
2dx7.1.A	19.80	homo-dimer	HHblits	X-ray	2.00Å	0.30	0.38	aspartate racemase
2dx7.1.B	19.80	homo-dimer	HHblits	X-ray	2.00Å	0.30	0.38	aspartate racemase
2w90.1.A	11.32	homo-dimer	HHblits	X-ray	2.20Å	0.26	0.40	6-PHOSPHOGLUCONATE DEHYDROGENASE, DECARBOXYLATING
2w90.1.B	11.32	homo-dimer	HHblits	X-ray	2.20Å	0.26	0.40	6-PHOSPHOGLUCONATE DEHYDROGENASE, DECARBOXYLATING
2jfq.1.A	17.65	homo-dimer	HHblits	X-ray	2.15Å	0.29	0.38	GLUTAMATE RACEMASE
2jfq.1.B	17.65	homo-dimer	HHblits	X-ray	2.15Å	0.29	0.38	GLUTAMATE RACEMASE
3ojc.1.A	9.62	homo-tetramer	HHblits	X-ray	1.75Å	0.27	0.39	Putative aspartate/glutamate racemase
3ojc.1.B	9.62	homo-tetramer	HHblits	X-ray	1.75Å	0.27	0.39	Putative aspartate/glutamate racemase
3ojc.1.C	9.62	homo-tetramer	HHblits	X-ray	1.75Å	0.27	0.39	Putative aspartate/glutamate racemase
3ojc.1.D	9.62	homo-tetramer	HHblits	X-ray	1.75Å	0.27	0.39	Putative aspartate/glutamate racemase
5hj7.1.A	19.80	homo-dimer	HHblits	X-ray	2.30Å	0.30	0.38	Glutamate racemase
5hqt.1.A	12.62	homo-dimer	HHblits	X-ray	1.60Å	0.27	0.39	aspartate/glutamate racemase
3g0o.1.A	17.82	homo-dimer	HHblits	X-ray	1.80Å	0.29	0.38	3-hydroxyisobutyrate dehydrogenase
5elm.1.A	13.59	homo-dimer	HHblits	X-ray	2.00Å	0.27	0.39	Asp/Glu_racemase family protein
5elm.1.B	13.59	homo-dimer	HHblits	X-ray	2.00Å	0.27	0.39	Asp/Glu_racemase family protein
5elm.2.A	13.59	homo-dimer	HHblits	X-ray	2.00Å	0.27	0.39	Asp/Glu_racemase family protein
5elm.2.B	13.59	homo-dimer	HHblits	X-ray	2.00Å	0.27	0.39	Asp/Glu_racemase family protein
2pn1.1.A	11.43	homo-dimer	HHblits	X-ray	2.00Å	0.25	0.40	Carbamoylphosphate synthase large subunit
3qvl.1.A	17.48	homo-hexamer	HHblits	X-ray	1.82Å	0.27	0.39	Putative hydantoin racemase
5ijw.1.A	18.81	homo-dimer	HHblits	X-ray	1.76Å	0.28	0.38	Glutamate racemase
5ijw.1.B	18.81	homo-dimer	HHblits	X-ray	1.76Å	0.28	0.38	Glutamate racemase
5ell.1.A	11.65	homo-dimer	HHblits	X-ray	1.80Å	0.27	0.39	Asp/Glu_racemase family protein
5ell.1.B	11.65	homo-dimer	HHblits	X-ray	1.80Å	0.27	0.39	Asp/Glu_racemase family protein
1zuw.1.A	13.86	homo-dimer	HHblits	X-ray	1.75Å	0.28	0.38	glutamate racemase 1
1zuw.1.B	13.86	homo-dimer	HHblits	X-ray	1.75Å	0.28	0.38	glutamate racemase 1
5lfd.1.A	19.19	homo-hexamer	HHblits	X-ray	2.15Å	0.29	0.37	Allantoin racemase
3q3c.1.A	17.00	homo-tetramer	HHblits	X-ray	2.30Å	0.28	0.38	Probable 3-hydroxyisobutyrate dehydrogenase
3out.1.A	15.00	homo-hexamer	HHblits	X-ray	1.65Å	0.28	0.38	Glutamate racemase
3hfr.1.A	12.87	homo-dimer	HHblits	X-ray	2.30Å	0.27	0.38	Glutamate racemase
3hfr.1.B	12.87	homo-dimer	HHblits	X-ray	2.30Å	0.27	0.38	Glutamate racemase
2zsk.1.A	7.84	homo-dimer	HHblits	X-ray	2.55Å	0.26	0.38	226aa long hypothetical aspartate racemase
2jfp.1.A	10.89	homo-dimer	HHblits	X-ray	1.98Å	0.27	0.38	GLUTAMATE RACEMASE
2jfo.1.B	10.89	homo-dimer	HHblits	X-ray	2.50Å	0.27	0.38	GLUTAMATE RACEMASE
2dwu.1.A	13.86	homo-dimer	HHblits	X-ray	1.60Å	0.27	0.38	Glutamate racemase
2dwu.2.A	13.86	homo-dimer	HHblits	X-ray	1.60Å	0.27	0.38	Glutamate racemase
2gzm.1.A	14.00	homo-dimer	HHblits	X-ray	1.99Å	0.27	0.38	Glutamate racemase
2gzm.1.B	14.00	homo-dimer	HHblits	X-ray	1.99Å	0.27	0.38	Glutamate racemase
2gzm.2.B	14.00	homo-dimer	HHblits	X-ray	1.99Å	0.27	0.38	Glutamate racemase
2jfw.1.A	14.00	homo-dimer	HHblits	X-ray	2.00Å	0.27	0.38	GLUTAMATE RACEMASE
2oho.1.A	13.86	homo-dimer	HHblits	X-ray	2.25Å	0.27	0.38	Glutamate Racemase
2oho.1.B	13.86	homo-dimer	HHblits	X-ray	2.25Å	0.27	0.38	Glutamate Racemase
2vvt.1.A	11.88	homo-dimer	HHblits	X-ray	1.65Å	0.26	0.38	GLUTAMATE RACEMASE
2vvt.1.B	11.88	homo-dimer	HHblits	X-ray	1.65Å	0.26	0.38	GLUTAMATE RACEMASE
3lp8.1.A	15.15	monomer	HHblits	X-ray	2.15Å	0.28	0.37	Phosphoribosylamine-glycine ligase
5b19.1.A	11.88	homo-dimer	HHblits	X-ray	1.85Å	0.26	0.38	Aspartate racemase
5b19.1.B	11.88	homo-dimer	HHblits	X-ray	1.85Å	0.26	0.38	Aspartate racemase
2ohv.1.A	14.00	homo-dimer	HHblits	X-ray	2.50Å	0.27	0.38	Glutamate Racemase
2ohg.1.A	14.00	homo-dimer	HHblits	X-ray	2.50Å	0.27	0.38	Glutamate racemase
3uho.1.A	15.00	monomer	HHblits	X-ray	2.20Å	0.25	0.38	Glutamate racemase
3uhf.2.A	15.00	monomer	HHblits	X-ray	1.83Å	0.25	0.38	Glutamate racemase
3uhp.1.A	15.00	monomer	HHblits	X-ray	2.79Å	0.25	0.38	Glutamate racemase
5w1q.1.A	10.00	homo-dimer	HHblits	X-ray	1.95Å	0.25	0.38	Glutamate racemase
2vlb.1.A	15.31	monomer	HHblits	X-ray	1.92Å	0.27	0.37	ARYLMALONATE DECARBOXYLASE
2vlb.2.A	15.31	monomer	HHblits	X-ray	1.92Å	0.27	0.37	ARYLMALONATE DECARBOXYLASE
2vlb.3.A	15.31	monomer	HHblits	X-ray	1.92Å	0.27	0.37	ARYLMALONATE DECARBOXYLASE
2vlb.4.A	15.31	monomer	HHblits	X-ray	1.92Å	0.27	0.37	ARYLMALONATE DECARBOXYLASE
3dg9.1.A	15.31	monomer	HHblits	X-ray	1.50Å	0.27	0.37	Arylmalonate decarboxylase
2gpw.1.A	6.80	monomer	HHblits	X-ray	2.20Å	0.22	0.39	Biotin carboxylase
2gpw.4.A	6.80	monomer	HHblits	X-ray	2.20Å	0.22	0.39	Biotin carboxylase
5h80.1.A	11.22	homo-dimer	HHblits	X-ray	1.70Å	0.25	0.37	Carboxylase
2jfn.1.A	13.68	monomer	HHblits	X-ray	1.90Å	0.27	0.36	GLUTAMATE RACEMASE
3mjf.1.A	9.38	monomer	HHblits	X-ray	1.47Å	0.26	0.36	Phosphoribosylamine--glycine ligase
2dgd.1.A	13.54	homo-octamer	HHblits	X-ray	2.90Å	0.26	0.36	223aa long hypothetical arylmalonate decarboxylase
3dtv.3.A	13.68	monomer	HHblits	X-ray	2.10Å	0.26	0.36	Arylmalonate decarboxylase
3dtv.2.A	13.68	monomer	HHblits	X-ray	2.10Å	0.26	0.36	Arylmalonate decarboxylase
3dtv.1.A	13.68	monomer	HHblits	X-ray	2.10Å	0.26	0.36	Arylmalonate decarboxylase
3dtv.4.A	13.68	monomer	HHblits	X-ray	2.10Å	0.26	0.36	Arylmalonate decarboxylase
3eis.1.A	13.68	monomer	HHblits	X-ray	2.10Å	0.26	0.36	Arylmalonate decarboxylase
3eis.2.A	13.68	monomer	HHblits	X-ray	2.10Å	0.26	0.36	Arylmalonate decarboxylase
3ixl.1.A	11.34	monomer	HHblits	X-ray	1.45Å	0.24	0.37	Arylmalonate decarboxylase
3ixm.1.A	13.68	monomer	HHblits	X-ray	1.90Å	0.26	0.36	Arylmalonate decarboxylase
2xec.1.A	9.38	homo-dimer	HHblits	X-ray	2.20Å	0.25	0.36	PUTATIVE MALEATE ISOMERASE
2bdq.1.A	20.88	homo-dimer	HHblits	X-ray	2.30Å	0.29	0.34	copper homeostasis protein CutC
5mlk.1.A	18.68	homo-dimer	HHblits	X-ray	1.94Å	0.28	0.34	Acetyl-COA carboxylase
5dou.1.A	16.85	homo-dimer	HHblits	X-ray	2.60Å	0.30	0.34	Carbamoyl-phosphate synthase [ammonia], mitochondrial
5dot.1.A	16.85	homo-dimer	HHblits	X-ray	2.40Å	0.30	0.34	Carbamoyl-phosphate synthase [ammonia], mitochondrial
2yl2.1.A	15.38	monomer	HHblits	X-ray	2.30Å	0.28	0.34	ACETYL-COA CARBOXYLASE 1
2yl2.2.A	15.38	monomer	HHblits	X-ray	2.30Å	0.28	0.34	ACETYL-COA CARBOXYLASE 1
3d4o.1.A	20.88	homo-dimer	HHblits	X-ray	2.10Å	0.28	0.34	Dipicolinate synthase subunit A
3d4o.1.B	20.88	homo-dimer	HHblits	X-ray	2.10Å	0.28	0.34	Dipicolinate synthase subunit A
3gid.1.A	15.38	monomer	HHblits	X-ray	2.30Å	0.27	0.34	Acetyl-CoA carboxylase 2
3gid.2.A	15.38	monomer	HHblits	X-ray	2.30Å	0.27	0.34	Acetyl-CoA carboxylase 2
3glk.1.A	15.38	monomer	HHblits	X-ray	2.10Å	0.27	0.34	Acetyl-CoA carboxylase 2
5kkn.2.A	15.38	monomer	HHblits	X-ray	2.60Å	0.27	0.34	Acetyl-CoA carboxylase 2
5kkn.1.A	15.38	monomer	HHblits	X-ray	2.60Å	0.27	0.34	Acetyl-CoA carboxylase 2
3u9s.1.A	22.47	hetero-oligomer	HHblits	X-ray	3.50Å	0.29	0.34	Methylcrotonyl-CoA carboxylase, alpha-subunit
3u9t.1.A	22.47	hetero-oligomer	HHblits	X-ray	2.90Å	0.29	0.34	Methylcrotonyl-CoA carboxylase, alpha-subunit
2c00.1.A	17.39	monomer	HHblits	X-ray	2.50Å	0.26	0.35	BIOTIN CARBOXYLASE
2c00.2.A	17.39	monomer	HHblits	X-ray	2.50Å	0.26	0.35	BIOTIN CARBOXYLASE
2vqd.1.A	17.39	monomer	HHblits	X-ray	2.41Å	0.26	0.35	BIOTIN CARBOXYLASE
1ulz.1.A	16.85	homo-dimer	HHblits	X-ray	2.20Å	0.29	0.34	pyruvate carboxylase n-terminal domain
1gso.1.A	9.78	monomer	HHblits	X-ray	1.60Å	0.26	0.35	PROTEIN (GLYCINAMIDE RIBONUCLEOTIDE SYNTHETASE)
1iu9.1.A	17.44	monomer	HHblits	X-ray	2.04Å	0.31	0.32	aspartate racemase
1nvm.1.B	13.33	hetero-oligomer	HHblits	X-ray	1.70Å	0.27	0.34	acetaldehyde dehydrogenase (acylating)
1nvm.2.B	13.33	hetero-oligomer	HHblits	X-ray	1.70Å	0.27	0.34	acetaldehyde dehydrogenase (acylating)
2qk4.1.A	14.29	monomer	HHblits	X-ray	2.45Å	0.26	0.34	Trifunctional purine biosynthetic protein adenosine-3
1ez1.1.A	9.57	homo-dimer	HHblits	X-ray	1.75Å	0.23	0.35	PHOSPHORIBOSYLGLYCINAMIDE FORMYLTRANSFERASE 2
1ez1.1.B	9.57	homo-dimer	HHblits	X-ray	1.75Å	0.23	0.35	PHOSPHORIBOSYLGLYCINAMIDE FORMYLTRANSFERASE 2
3rv4.1.A	17.98	homo-dimer	HHblits	X-ray	1.98Å	0.27	0.34	Biotin carboxylase
2gpw.1.A	17.98	monomer	HHblits	X-ray	2.20Å	0.27	0.34	Biotin carboxylase
2gpw.4.A	17.98	monomer	HHblits	X-ray	2.20Å	0.27	0.34	Biotin carboxylase
3lp8.1.A	15.73	monomer	HHblits	X-ray	2.15Å	0.27	0.34	Phosphoribosylamine-glycine ligase
2yya.1.A	13.64	monomer	HHblits	X-ray	2.40Å	0.28	0.33	Phosphoribosylamine--glycine ligase
2vpq.1.A	13.64	homo-dimer	HHblits	X-ray	2.10Å	0.28	0.33	ACETYL-COA CARBOXYLASE
4mv4.2.A	19.10	monomer	HHblits	X-ray	1.61Å	0.27	0.34	Biotin carboxylase
2ip4.1.A	16.85	monomer	HHblits	X-ray	2.80Å	0.27	0.34	Phosphoribosylamine--glycine ligase
2ip4.2.A	16.85	monomer	HHblits	X-ray	2.80Å	0.27	0.34	Phosphoribosylamine--glycine ligase
3g8d.1.A	16.85	monomer	HHblits	X-ray	1.90Å	0.27	0.34	Biotin carboxylase
3ouu.1.A	12.36	homo-dimer	HHblits	X-ray	2.25Å	0.27	0.34	Biotin carboxylase
2gps.1.A	17.98	monomer	HHblits	X-ray	2.80Å	0.27	0.34	Biotin carboxylase
3wgi.1.B	14.77	homo-dimer	HHblits	X-ray	3.25Å	0.27	0.33	Redox-sensing transcriptional repressor rex
3wg9.2.A	14.77	homo-dimer	HHblits	X-ray	1.97Å	0.27	0.33	Redox-sensing transcriptional repressor rex
3wg9.2.B	14.77	homo-dimer	HHblits	X-ray	1.97Å	0.27	0.33	Redox-sensing transcriptional repressor rex
3wgh.1.B	14.77	homo-dimer	HHblits	X-ray	2.05Å	0.27	0.33	Redox-sensing transcriptional repressor rex
3wgg.1.A	14.77	homo-dimer	HHblits	X-ray	2.10Å	0.27	0.33	Redox-sensing transcriptional repressor rex
3wgg.1.B	14.77	homo-dimer	HHblits	X-ray	2.10Å	0.27	0.33	Redox-sensing transcriptional repressor rex
3g8c.1.A	17.05	monomer	HHblits	X-ray	2.00Å	0.27	0.33	Biotin carboxylase
3g8c.2.A	17.05	monomer	HHblits	X-ray	2.00Å	0.27	0.33	Biotin carboxylase
2ys6.1.A	13.48	monomer	HHblits	X-ray	2.21Å	0.26	0.34	Phosphoribosylglycinamide synthetase
2w6m.1.A	17.05	monomer	HHblits	X-ray	2.00Å	0.27	0.33	BIOTIN CARBOXYLASE
1bnc.1.B	17.05	homo-dimer	HHblits	X-ray	2.40Å	0.27	0.33	BIOTIN CARBOXYLASE
1bnc.1.A	17.05	homo-dimer	HHblits	X-ray	2.40Å	0.27	0.33	BIOTIN CARBOXYLASE
4hr7.1.A	17.05	hetero-oligomer	HHblits	X-ray	2.50Å	0.27	0.33	Biotin carboxylase
4hr7.1.C	17.05	hetero-oligomer	HHblits	X-ray	2.50Å	0.27	0.33	Biotin carboxylase
4hr7.1.E	17.05	hetero-oligomer	HHblits	X-ray	2.50Å	0.27	0.33	Biotin carboxylase
4hr7.1.F	17.05	hetero-oligomer	HHblits	X-ray	2.50Å	0.27	0.33	Biotin carboxylase
2j9g.2.A	17.05	monomer	HHblits	X-ray	2.05Å	0.27	0.33	BIOTIN CARBOXYLASE
2vr1.2.A	17.05	monomer	HHblits	X-ray	2.60Å	0.27	0.33	BIOTIN CARBOXYLASE
1dv2.1.A	16.85	monomer	HHblits	X-ray	2.50Å	0.26	0.34	BIOTIN CARBOXYLASE
3ktd.1.A	14.44	homo-dimer	HHblits	X-ray	2.60Å	0.25	0.34	Prephenate dehydrogenase
5e38.1.B	24.39	homo-tetramer	HHblits	X-ray	3.00Å	0.32	0.31	Uracil phosphoribosyltransferase
5e38.1.A	24.39	homo-tetramer	HHblits	X-ray	3.00Å	0.32	0.31	Uracil phosphoribosyltransferase
5e38.1.D	24.39	homo-tetramer	HHblits	X-ray	3.00Å	0.32	0.31	Uracil phosphoribosyltransferase
2ehj.1.A	24.39	homo-tetramer	HHblits	X-ray	2.80Å	0.32	0.31	Uracil phosphoribosyltransferase
2ehj.1.C	24.39	homo-tetramer	HHblits	X-ray	2.80Å	0.32	0.31	Uracil phosphoribosyltransferase
1h7x.1.A	16.28	homo-dimer	HHblits	X-ray	2.01Å	0.28	0.32	DIHYDROPYRIMIDINE DEHYDROGENASE
1xtu.1.A	8.05	homo-tetramer	HHblits	X-ray	2.80Å	0.27	0.33	Probable uracil phosphoribosyltransferase
3g6w.1.A	8.05	homo-tetramer	HHblits	X-ray	2.90Å	0.27	0.33	Uracil phosphoribosyltransferase
3g6w.1.B	8.05	homo-tetramer	HHblits	X-ray	2.90Å	0.27	0.33	Uracil phosphoribosyltransferase
1xtv.1.B	8.05	homo-tetramer	HHblits	X-ray	2.60Å	0.27	0.33	Probable uracil phosphoribosyltransferase
1xtv.1.C	8.05	homo-tetramer	HHblits	X-ray	2.60Å	0.27	0.33	Probable uracil phosphoribosyltransferase
1xtt.1.A	8.05	homo-tetramer	HHblits	X-ray	1.80Å	0.27	0.33	Probable uracil phosphoribosyltransferase
1xtt.1.B	8.05	homo-tetramer	HHblits	X-ray	1.80Å	0.27	0.33	Probable uracil phosphoribosyltransferase
1vst.1.A	8.05	homo-tetramer	HHblits	X-ray	2.80Å	0.27	0.33	Uracil phosphoribosyltransferase
3rv3.1.A	14.94	homo-dimer	HHblits	X-ray	1.91Å	0.27	0.33	Biotin carboxylase
2xcl.1.A	7.87	monomer	HHblits	X-ray	2.10Å	0.25	0.34	PHOSPHORIBOSYLAMINE--GLYCINE LIGASE
1ez1.1.A	13.95	homo-dimer	HHblits	X-ray	1.75Å	0.27	0.32	PHOSPHORIBOSYLGLYCINAMIDE FORMYLTRANSFERASE 2
1ez1.1.B	13.95	homo-dimer	HHblits	X-ray	1.75Å	0.27	0.32	PHOSPHORIBOSYLGLYCINAMIDE FORMYLTRANSFERASE 2
1o5o.1.A	21.69	homo-tetramer	HHblits	X-ray	2.30Å	0.30	0.31	Uracil phosphoribosyltransferase
2pn1.1.A	11.63	homo-dimer	HHblits	X-ray	2.00Å	0.27	0.32	Carbamoylphosphate synthase large subunit
1i5e.1.A	18.29	homo-dimer	HHblits	X-ray	3.00Å	0.30	0.31	URACIL PHOSPHORIBOSYLTRANSFERASE
1v9s.1.B	19.28	homo-tetramer	HHblits	X-ray	2.10Å	0.29	0.31	uracil phosphoribosyltransferase
1v9s.1.A	19.28	homo-tetramer	HHblits	X-ray	2.10Å	0.29	0.31	uracil phosphoribosyltransferase
1v9s.1.D	19.28	homo-tetramer	HHblits	X-ray	2.10Å	0.29	0.31	uracil phosphoribosyltransferase
3gdo.1.A	9.41	homo-dimer	HHblits	X-ray	2.03Å	0.26	0.32	Uncharacterized oxidoreductase yvaA
4iil.1.A	13.10	monomer	HHblits	X-ray	1.30Å	0.27	0.32	Membrane lipoprotein TpN38(b)
5ere.1.A	20.99	monomer	HHblits	X-ray	2.00Å	0.29	0.31	Extracellular ligand-binding receptor
5kws.1.A	20.99	monomer	HHblits	X-ray	1.32Å	0.29	0.31	Galactose-binding protein
2jfy.1.B	9.41	homo-dimer	HHblits	X-ray	1.90Å	0.25	0.32	GLUTAMATE RACEMASE
2jfz.1.A	9.41	homo-dimer	HHblits	X-ray	1.86Å	0.25	0.32	GLUTAMATE RACEMASE
2jfx.1.A	9.41	homo-dimer	HHblits	X-ray	2.30Å	0.25	0.32	GLUTAMATE RACEMASE
2jfx.1.B	9.41	homo-dimer	HHblits	X-ray	2.30Å	0.25	0.32	GLUTAMATE RACEMASE
2jfy.1.A	9.41	homo-dimer	HHblits	X-ray	1.90Å	0.25	0.32	GLUTAMATE RACEMASE
4b1f.1.B	9.41	homo-dimer	HHblits	X-ray	2.05Å	0.25	0.32	GLUTAMATE RACEMASE
2w4i.1.A	9.41	homo-tetramer	HHblits	X-ray	1.87Å	0.25	0.32	GLUTAMATE RACEMASE
2e55.1.A	13.41	homo-tetramer	HHblits	X-ray	2.15Å	0.27	0.31	Uracil phosphoribosyltransferase
3cea.1.A	10.98	homo-tetramer	HHblits	X-ray	2.40Å	0.27	0.31	Myo-inositol 2-dehydrogenase
2ipl.1.A	22.50	monomer	HHblits	X-ray	1.20Å	0.29	0.30	D-galactose-binding periplasmic protein
3rc1.1.A	17.50	monomer	HHblits	X-ray	1.71Å	0.29	0.30	Sugar 3-ketoreductase
1glg.1.A	22.50	monomer	HHblits	X-ray	2.00Å	0.29	0.30	GALACTOSE/GLUCOSE-BINDING PROTEIN
2qw1.1.A	22.50	monomer	HHblits	X-ray	1.70Å	0.29	0.30	D-galactose-binding periplasmic protein
2fvy.1.A	22.50	monomer	HHblits	X-ray	0.92Å	0.29	0.30	D-galactose-binding periplasmic protein
2ipm.1.A	22.50	monomer	HHblits	X-ray	1.12Å	0.29	0.30	D-galactose-binding periplasmic protein
5ktk.1.A	13.41	monomer	HHblits	X-ray	1.98Å	0.27	0.31	Polyketide synthase PksJ
2ipn.1.A	22.50	monomer	HHblits	X-ray	1.15Å	0.28	0.30	D-galactose-binding periplasmic protein
2hph.1.A	21.25	monomer	HHblits	X-ray	1.33Å	0.28	0.30	D-galactose-binding periplasmic protein
2hqb.1.A	16.25	monomer	HHblits	X-ray	2.70Å	0.28	0.30	Transcriptional activator of comK gene
4iil.1.A	18.99	monomer	HHblits	X-ray	1.30Å	0.29	0.30	Membrane lipoprotein TpN38(b)
4z0n.1.A	12.50	monomer	HHblits	X-ray	1.26Å	0.27	0.30	Periplasmic binding protein/LacI transcriptional regulator
4iq0.1.A	10.00	homo-dimer	HHblits	X-ray	2.00Å	0.27	0.30	Oxidoreductase, Gfo/Idh/MocA family
4iq0.2.B	10.00	homo-dimer	HHblits	X-ray	2.00Å	0.27	0.30	Oxidoreductase, Gfo/Idh/MocA family
5a02.1.A	8.75	homo-dimer	HHblits	X-ray	2.00Å	0.27	0.30	ALDOSE-ALDOSE OXIDOREDUCTASE
3q2k.1.A	16.67	homo-octamer	HHblits	X-ray	2.13Å	0.29	0.29	oxidoreductase
3q2k.1.B	16.67	homo-octamer	HHblits	X-ray	2.13Å	0.29	0.29	oxidoreductase
5dn1.1.A	20.78	monomer	HHblits	X-ray	1.95Å	0.29	0.29	Phosphoribosyl isomerase A
3q2i.1.A	18.18	homo-octamer	HHblits	X-ray	1.50Å	0.29	0.29	dehydrogenase
3mjf.1.A	16.46	monomer	HHblits	X-ray	1.47Å	0.26	0.30	Phosphoribosylamine--glycine ligase
1qh1.1.B	14.29	hetero-oligomer	HHblits	X-ray	1.60Å	0.28	0.29	PROTEIN (NITROGENASE MOLYBDENUM IRON PROTEIN)
3x43.1.A	18.42	homo-tetramer	HHblits	X-ray	2.25Å	0.29	0.29	O-ureido-L-serine synthase
3x43.1.B	18.42	homo-tetramer	HHblits	X-ray	2.25Å	0.29	0.29	O-ureido-L-serine synthase
4iq0.1.A	15.58	homo-dimer	HHblits	X-ray	2.00Å	0.28	0.29	Oxidoreductase, Gfo/Idh/MocA family
4iq0.2.B	15.58	homo-dimer	HHblits	X-ray	2.00Å	0.28	0.29	Oxidoreductase, Gfo/Idh/MocA family
2pgn.1.A	15.19	homo-tetramer	HHblits	X-ray	1.20Å	0.25	0.30	Cyclohexane-1,2-dione Hydrolase (Cdh)
5eqv.1.A	12.82	monomer	HHblits	X-ray	1.45Å	0.25	0.29	bifunctional 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase periplasmic precursor protein
2lle.1.A	11.84	monomer	HHblits	NMR	NA	0.27	0.29	Chemotaxis protein CheY, Imidazole glycerol phosphate synthase subunit HisF chimera
3x44.1.A	14.29	homo-tetramer	HHblits	X-ray	1.90Å	0.26	0.29	O-ureido-L-serine synthase
5vev.1.A	10.39	monomer	HHblits	X-ray	1.90Å	0.26	0.29	Phosphoribosylamine--glycine ligase
3lft.1.A	13.16	monomer	HHblits	X-ray	1.35Å	0.27	0.29	uncharacterized protein
3cwo.1.A	9.21	homo-dimer	HHblits	X-ray	3.10Å	0.26	0.29	beta/alpha-barrel protein based on 1THF and 1TMY
2qk4.1.A	14.67	monomer	HHblits	X-ray	2.45Å	0.27	0.28	Trifunctional purine biosynthetic protein adenosine-3
2rdm.1.A	13.16	homo-hexamer	HHblits	X-ray	1.76Å	0.26	0.29	Response regulator receiver protein
2rdm.1.B	13.16	homo-hexamer	HHblits	X-ray	1.76Å	0.26	0.29	Response regulator receiver protein
2rdm.1.C	13.16	homo-hexamer	HHblits	X-ray	1.76Å	0.26	0.29	Response regulator receiver protein
4egj.1.A	20.55	monomer	HHblits	X-ray	2.30Å	0.28	0.28	D-alanine--D-alanine ligase
4nas.1.A	24.64	homo-dimer	HHblits	X-ray	1.92Å	0.31	0.26	Ribulose-bisphosphate carboxylase
3gka.1.A	9.21	monomer	HHblits	X-ray	2.30Å	0.23	0.29	N-ethylmaleimide reductase
4by9.1.D	10.96	hetero-oligomer	HHblits	NMR	NA	0.26	0.28	50S RIBOSOMAL PROTEIN L7AE
4by9.1.G	10.96	hetero-oligomer	HHblits	NMR	NA	0.26	0.28	50S RIBOSOMAL PROTEIN L7AE
4by9.1.J	10.96	hetero-oligomer	HHblits	NMR	NA	0.26	0.28	50S RIBOSOMAL PROTEIN L7AE
4by9.1.M	10.96	hetero-oligomer	HHblits	NMR	NA	0.26	0.28	50S RIBOSOMAL PROTEIN L7AE
3ec7.1.A	14.71	homo-tetramer	HHblits	X-ray	2.15Å	0.31	0.26	Putative Dehydrogenase
2oek.1.A	23.19	homo-dimer	HHblits	X-ray	1.80Å	0.30	0.26	2,3-diketo-5-methylthiopentyl-1-phosphate enolase
3nvi.2.B	12.50	hetero-oligomer	HHblits	X-ray	2.71Å	0.26	0.27	50S ribosomal protein L7Ae
3nmu.1.D	12.50	hetero-oligomer	HHblits	X-ray	2.73Å	0.26	0.27	50S ribosomal protein L7Ae
3nvk.1.C	12.50	hetero-oligomer	HHblits	X-ray	3.21Å	0.26	0.27	50S ribosomal protein L7Ae
3nvk.1.D	12.50	hetero-oligomer	HHblits	X-ray	3.21Å	0.26	0.27	50S ribosomal protein L7Ae
3nmu.2.B	12.50	hetero-oligomer	HHblits	X-ray	2.73Å	0.26	0.27	50S ribosomal protein L7Ae
4mkx.1.A	14.49	homo-tetramer	HHblits	X-ray	1.60Å	0.29	0.26	Inositol dehydrogenase
3t9p.1.A	14.08	homo-dimer	HHblits	X-ray	1.97Å	0.27	0.27	Mandelate racemase/muconate lactonizing enzyme family protein
3i23.1.A	9.72	homo-dimer	HHblits	X-ray	2.30Å	0.26	0.27	Oxidoreductase, Gfo/Idh/MocA family
3nkl.1.A	15.94	homo-dimer	HHblits	X-ray	1.90Å	0.29	0.26	UDP-D-quinovosamine 4-dehydrogenase
3nkl.1.B	15.94	homo-dimer	HHblits	X-ray	1.90Å	0.29	0.26	UDP-D-quinovosamine 4-dehydrogenase
3i05.1.A	6.94	homo-dimer	HHblits	X-ray	2.80Å	0.25	0.27	Tryptophanyl-tRNA synthetase
3rcb.1.A	20.59	monomer	HHblits	X-ray	2.49Å	0.30	0.26	Sugar 3-ketoreductase
4n54.1.A	14.71	homo-tetramer	HHblits	X-ray	2.05Å	0.29	0.26	Inositol dehydrogenase
4n54.1.C	14.71	homo-tetramer	HHblits	X-ray	2.05Å	0.29	0.26	Inositol dehydrogenase
4n54.1.D	14.71	homo-tetramer	HHblits	X-ray	2.05Å	0.29	0.26	Inositol dehydrogenase
1o5t.1.A	5.56	homo-dimer	HHblits	X-ray	2.50Å	0.25	0.27	Tryptophanyl-tRNA synthetase
1ulh.1.A	5.56	homo-dimer	HHblits	X-ray	2.31Å	0.25	0.27	Tryptophanyl-tRNA synthetase
1ulh.1.B	5.56	homo-dimer	HHblits	X-ray	2.31Å	0.25	0.27	Tryptophanyl-tRNA synthetase
2qui.1.B	5.56	homo-dimer	HHblits	X-ray	2.40Å	0.25	0.27	Tryptophanyl-tRNA synthetase
2quk.1.A	5.56	homo-dimer	HHblits	X-ray	2.80Å	0.25	0.27	Tryptophanyl-tRNA synthetase
2qui.1.A	5.56	homo-dimer	HHblits	X-ray	2.40Å	0.25	0.27	Tryptophanyl-tRNA synthetase
1r6u.1.A	5.56	homo-dimer	HHblits	X-ray	2.00Å	0.25	0.27	Tryptophanyl-tRNA synthetase
1r6u.1.B	5.56	homo-dimer	HHblits	X-ray	2.00Å	0.25	0.27	Tryptophanyl-tRNA synthetase
1r6t.1.A	5.56	homo-dimer	HHblits	X-ray	2.10Å	0.25	0.27	Tryptophanyl-tRNA synthetase
1r6t.1.B	5.56	homo-dimer	HHblits	X-ray	2.10Å	0.25	0.27	Tryptophanyl-tRNA synthetase
2azx.1.B	5.56	homo-dimer	HHblits	X-ray	2.80Å	0.25	0.27	Tryptophanyl-tRNA synthetase
2eq5.1.A	20.59	homo-dimer	HHblits	X-ray	2.20Å	0.29	0.26	228aa long hypothetical hydantoin racemase
2eq5.2.B	20.59	homo-dimer	HHblits	X-ray	2.20Å	0.29	0.26	228aa long hypothetical hydantoin racemase
1g21.1.B	11.59	hetero-oligomer	HHblits	X-ray	3.00Å	0.27	0.26	NITROGENASE MOLYBDENUM-IRON PROTEIN BETA CHAIN
3rc9.1.A	19.40	monomer	HHblits	X-ray	1.91Å	0.29	0.25	Sugar 3-ketoreductase
4hf7.1.A	11.94	homo-dimer	HHblits	X-ray	1.77Å	0.28	0.25	Putative acylhydrolase
1ofg.1.A	10.45	homo-tetramer	HHblits	X-ray	2.70Å	0.27	0.25	GLUCOSE-FRUCTOSE OXIDOREDUCTASE
3q2k.1.A	23.44	homo-octamer	HHblits	X-ray	2.13Å	0.31	0.24	oxidoreductase
3q2k.1.B	23.44	homo-octamer	HHblits	X-ray	2.13Å	0.31	0.24	oxidoreductase
1evj.1.A	11.94	homo-dimer	HHblits	X-ray	2.70Å	0.27	0.25	GLUCOSE-FRUCTOSE OXIDOREDUCTASE
1ryd.1.A	10.45	homo-tetramer	HHblits	X-ray	2.20Å	0.27	0.25	glucose-fructose oxidoreductase
1rye.1.B	10.45	homo-tetramer	HHblits	X-ray	2.30Å	0.27	0.25	glucose-fructose oxidoreductase
1rye.1.A	10.45	homo-tetramer	HHblits	X-ray	2.30Å	0.27	0.25	glucose-fructose oxidoreductase
5b5s.1.A	13.43	monomer	HHblits	X-ray	1.50Å	0.26	0.25	Acetic acid
3q2i.1.A	15.63	homo-octamer	HHblits	X-ray	1.50Å	0.29	0.24	dehydrogenase
2ho5.1.A	12.50	homo-dimer	HHblits	X-ray	2.56Å	0.28	0.24	Oxidoreductase, Gfo/Idh/MocA family
3lft.1.A	12.70	monomer	HHblits	X-ray	1.35Å	0.28	0.24	uncharacterized protein
2p2b.1.A	12.90	monomer	HHblits	X-ray	2.20Å	0.26	0.23	Acetyl-coenzyme A synthetase
2p2f.1.A	11.29	monomer	HHblits	X-ray	2.58Å	0.26	0.23	Acetyl-coenzyme A synthetase
1pg3.1.A	11.29	monomer	HHblits	X-ray	2.30Å	0.26	0.23	acetyl-CoA synthetase
1wau.1.A	17.54	homo-trimer	HHblits	X-ray	2.80Å	0.27	0.22	KHG/KDPG ALDOLASE
1fq0.1.A	17.54	homo-trimer	HHblits	X-ray	2.10Å	0.27	0.22	KDPG ALDOLASE
1eua.1.C	17.54	homo-trimer	HHblits	X-ray	1.95Å	0.27	0.22	KDPG ALDOLASE
1b73.1.A	10.53	homo-dimer	HHblits	X-ray	2.30Å	0.27	0.22	GLUTAMATE RACEMASE
2p2m.1.A	10.34	monomer	HHblits	X-ray	2.11Å	0.25	0.22	Acetyl-coenzyme A synthetase
3bol.1.A	22.22	homo-dimer	HHblits	X-ray	1.85Å	0.31	0.20	5-methyltetrahydrofolate S-homocysteine methyltransferase
1q7m.2.A	22.22	monomer	HHblits	X-ray	2.10Å	0.31	0.20	5-methyltetrahydrofolate S-homocysteine methyltransferase
1q7q.1.A	22.22	monomer	HHblits	X-ray	3.10Å	0.31	0.20	5-methyltetrahydrofolate S-homocysteine methyltransferase
1q8a.2.A	22.22	monomer	HHblits	X-ray	1.70Å	0.31	0.20	5-methyltetrahydrofolate S-homocysteine methyltransferase
1yht.1.A	15.09	monomer	HHblits	X-ray	2.00Å	0.29	0.20	DspB
1fq0.1.A	16.98	homo-trimer	HHblits	X-ray	2.10Å	0.29	0.20	KDPG ALDOLASE
1eua.1.C	16.98	homo-trimer	HHblits	X-ray	1.95Å	0.29	0.20	KDPG ALDOLASE
3qvj.1.A	20.75	homo-hexamer	HHblits	X-ray	2.10Å	0.29	0.20	Putative hydantoin racemase
1wau.1.A	19.23	homo-trimer	HHblits	X-ray	2.80Å	0.30	0.20	KHG/KDPG ALDOLASE
4fq5.1.A	13.21	homo-tetramer	HHblits	X-ray	2.10Å	0.28	0.20	Maleate cis-trans isomerase
4fq5.1.B	13.21	homo-tetramer	HHblits	X-ray	2.10Å	0.28	0.20	Maleate cis-trans isomerase
4mg4.1.A	23.53	homo-dimer	HHblits	X-ray	1.70Å	0.29	0.19	Phosphonomutase
4mg4.2.B	23.53	homo-dimer	HHblits	X-ray	1.70Å	0.29	0.19	Phosphonomutase
4fq7.1.A	11.54	homo-tetramer	HHblits	X-ray	3.00Å	0.27	0.20	Maleate cis-trans isomerase
2ake.1.B	3.77	homo-dimer	HHblits	X-ray	3.10Å	0.24	0.20	Tryptophanyl-tRNA synthetase
1wbh.1.A	20.00	homo-trimer	HHblits	X-ray	1.55Å	0.28	0.19	KHG/KDPG ALDOLASE
1fwr.1.A	20.00	homo-trimer	HHblits	X-ray	2.70Å	0.28	0.19	KDPG ALDOLASE
3fph.1.A	16.33	homo-dimer	HHblits	X-ray	1.80Å	0.29	0.18	Putative uncharacterized protein
3fph.1.B	16.33	homo-dimer	HHblits	X-ray	1.80Å	0.29	0.18	Putative uncharacterized protein
3fpj.1.B	16.33	homo-dimer	HHblits	X-ray	1.80Å	0.29	0.18	Putative uncharacterized protein
3fpg.1.A	16.33	homo-dimer	HHblits	X-ray	2.00Å	0.29	0.18	Putative uncharacterized protein
1fui.1.A	14.00	homo-trimer	HHblits	X-ray	2.50Å	0.25	0.19	L-FUCOSE ISOMERASE
4c22.1.A	8.00	homo-hexamer	HHblits	X-ray	2.70Å	0.25	0.19	L-FUCOSE ISOMERASE
2xed.1.A	8.00	monomer	HHblits	X-ray	1.95Å	0.25	0.19	PUTATIVE MALEATE ISOMERASE
4c20.1.A	6.00	monomer	HHblits	X-ray	2.41Å	0.25	0.19	L-FUCOSE ISOMERASE
4c21.1.A	6.00	homo-hexamer	HHblits	X-ray	2.55Å	0.25	0.19	L-FUCOSE ISOMERASE
2ip4.1.A	16.67	monomer	HHblits	X-ray	2.80Å	0.27	0.18	Phosphoribosylamine--glycine ligase
2ip4.2.A	16.67	monomer	HHblits	X-ray	2.80Å	0.27	0.18	Phosphoribosylamine--glycine ligase
4ix1.1.A	6.12	homo-dimer	HHblits	X-ray	2.80Å	0.24	0.18	hypothetical protein
4ix1.1.B	6.12	homo-dimer	HHblits	X-ray	2.80Å	0.24	0.18	hypothetical protein
3a9t.1.A	12.77	homo-hexamer	HHblits	X-ray	2.61Å	0.26	0.18	D-arabinose isomerase
5vev.1.A	6.38	monomer	HHblits	X-ray	1.90Å	0.25	0.18	Phosphoribosylamine--glycine ligase
4qwv.1.A	9.09	monomer	HHblits	X-ray	2.45Å	0.30	0.17	High-affinity leucine-specific transport system periplasmic binding protein, Chemotaxis protein CheY
1gso.1.A	15.56	monomer	HHblits	X-ray	1.60Å	0.28	0.17	PROTEIN (GLYCINAMIDE RIBONUCLEOTIDE SYNTHETASE)
3bol.1.A	28.57	homo-dimer	HHblits	X-ray	1.85Å	0.33	0.16	5-methyltetrahydrofolate S-homocysteine methyltransferase
1q7m.2.A	28.57	monomer	HHblits	X-ray	2.10Å	0.33	0.16	5-methyltetrahydrofolate S-homocysteine methyltransferase
1q7q.1.A	28.57	monomer	HHblits	X-ray	3.10Å	0.33	0.16	5-methyltetrahydrofolate S-homocysteine methyltransferase
1q8a.2.A	28.57	monomer	HHblits	X-ray	1.70Å	0.33	0.16	5-methyltetrahydrofolate S-homocysteine methyltransferase
2ys6.1.A	10.64	monomer	HHblits	X-ray	2.21Å	0.24	0.18	Phosphoribosylglycinamide synthetase
4fdc.1.A	26.83	monomer	HHblits	X-ray	2.40Å	0.34	0.15	Apoptosis-inducing factor 1, mitochondrial
5fs9.1.A	26.83	monomer	HHblits	X-ray	1.75Å	0.34	0.15	APOPTOSIS-INDUCING FACTOR 1, MITOCHONDRIAL
5fs6.1.A	26.83	monomer	HHblits	X-ray	1.90Å	0.34	0.15	APOPTOSIS-INDUCING FACTOR 1, MITOCHONDRIAL
5fs8.1.A	26.83	monomer	HHblits	X-ray	1.40Å	0.34	0.15	APOPTOSIS-INDUCING FACTOR 1, MITOCHONDRIAL
5fmh.1.A	26.83	monomer	HHblits	X-ray	1.80Å	0.34	0.15	APOPTOSIS-INDUCING FACTOR 1, MITOCHONDRIAL
3ef6.1.A	27.50	monomer	HHblits	X-ray	1.80Å	0.36	0.15	Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase
4emi.1.A	27.50	monomer	HHblits	X-ray	1.81Å	0.36	0.15	TodA
4emj.1.A	27.50	hetero-oligomer	HHblits	X-ray	2.40Å	0.36	0.15	TodA
4ru1.1.A	13.64	monomer	HHblits	X-ray	1.50Å	0.28	0.17	Monosaccharide ABC transporter substrate-binding protein, CUT2 family
4h4v.1.A	29.27	homo-dimer	HHblits	X-ray	1.40Å	0.33	0.15	Biphenyl dioxygenase ferredoxin reductase subunit
4h4x.1.A	29.27	homo-dimer	HHblits	X-ray	1.50Å	0.33	0.15	Biphenyl dioxygenase ferredoxin reductase subunit
2gr3.1.A	29.27	homo-dimer	HHblits	X-ray	1.50Å	0.33	0.15	ferredoxin reductase
4h4z.1.A	29.27	homo-dimer	HHblits	X-ray	1.95Å	0.33	0.15	Biphenyl dioxygenase ferredoxin reductase subunit
4h4p.1.A	29.27	homo-dimer	HHblits	X-ray	1.50Å	0.33	0.15	Biphenyl dioxygenase ferredoxin reductase subunit
2yya.1.A	11.11	monomer	HHblits	X-ray	2.40Å	0.25	0.17	Phosphoribosylamine--glycine ligase
4bur.1.A	27.50	monomer	HHblits	X-ray	2.88Å	0.34	0.15	APOPTOSIS INDUCING FACTOR 1, MITOCHONDRIAL
4bur.3.A	27.50	monomer	HHblits	X-ray	2.88Å	0.34	0.15	APOPTOSIS INDUCING FACTOR 1, MITOCHONDRIAL
5fs7.1.A	27.50	monomer	HHblits	X-ray	1.85Å	0.34	0.15	APOPTOSIS-INDUCING FACTOR 1, MITOCHONDRIAL
4lii.1.A	27.50	monomer	HHblits	X-ray	1.88Å	0.34	0.15	Apoptosis-inducing factor 1, mitochondrial
1m6i.1.A	27.50	monomer	HHblits	X-ray	1.80Å	0.34	0.15	Programmed cell death protein 8
3gd4.1.A	27.50	homo-dimer	HHblits	X-ray	2.24Å	0.34	0.15	Apoptosis-inducing factor 1, mitochondrial
3gd4.1.B	27.50	homo-dimer	HHblits	X-ray	2.24Å	0.34	0.15	Apoptosis-inducing factor 1, mitochondrial
5kvh.1.A	27.50	homo-dimer	HHblits	X-ray	2.27Å	0.34	0.15	Apoptosis-inducing factor 1, mitochondrial
3gd3.1.A	27.50	monomer	HHblits	X-ray	2.95Å	0.34	0.15	Apoptosis-inducing factor 1, mitochondrial
3gd3.2.A	27.50	monomer	HHblits	X-ray	2.95Å	0.34	0.15	Apoptosis-inducing factor 1, mitochondrial
3gd3.4.A	27.50	monomer	HHblits	X-ray	2.95Å	0.34	0.15	Apoptosis-inducing factor 1, mitochondrial
5miu.1.A	27.50	monomer	HHblits	X-ray	3.50Å	0.34	0.15	Apoptosis-inducing factor 1, mitochondrial
5miv.1.A	27.50	homo-dimer	HHblits	X-ray	3.10Å	0.34	0.15	Apoptosis-inducing factor 1, mitochondrial
5miv.1.B	27.50	homo-dimer	HHblits	X-ray	3.10Å	0.34	0.15	Apoptosis-inducing factor 1, mitochondrial
2gps.1.A	13.33	monomer	HHblits	X-ray	2.80Å	0.25	0.17	Biotin carboxylase
4h4r.1.A	30.00	homo-dimer	HHblits	X-ray	1.40Å	0.34	0.15	Biphenyl dioxygenase ferredoxin reductase subunit
2yvg.1.A	30.00	homo-dimer	HHblits	X-ray	1.60Å	0.34	0.15	Ferredoxin reductase
2yvj.1.A	30.00	hetero-oligomer	HHblits	X-ray	1.90Å	0.34	0.15	Ferredoxin reductase
2yvj.1.C	30.00	hetero-oligomer	HHblits	X-ray	1.90Å	0.34	0.15	Ferredoxin reductase
1d7y.1.A	30.00	homo-dimer	HHblits	X-ray	2.10Å	0.34	0.15	FERREDOXIN REDUCTASE
4h4t.1.A	30.00	homo-dimer	HHblits	X-ray	1.50Å	0.34	0.15	Biphenyl dioxygenase ferredoxin reductase subunit
2xcl.1.A	10.87	monomer	HHblits	X-ray	2.10Å	0.23	0.17	PHOSPHORIBOSYLAMINE--GLYCINE LIGASE
3g8d.1.A	11.11	monomer	HHblits	X-ray	1.90Å	0.24	0.17	Biotin carboxylase
3lxd.1.A	21.95	monomer	HHblits	X-ray	2.50Å	0.31	0.15	FAD-dependent pyridine nucleotide-disulphide oxidoreductase
3ics.1.A	17.07	homo-dimer	HHblits	X-ray	1.94Å	0.31	0.15	Coenzyme A-Disulfide Reductase
2v3a.1.A	21.95	monomer	HHblits	X-ray	2.40Å	0.31	0.15	RUBREDOXIN REDUCTASE
2v3b.1.A	21.95	hetero-oligomer	HHblits	X-ray	2.45Å	0.31	0.15	RUBREDOXIN REDUCTASE
5kvi.1.A	28.21	monomer	HHblits	X-ray	2.00Å	0.35	0.15	Apoptosis-inducing factor 1, mitochondrial
1gv4.1.A	28.21	monomer	HHblits	X-ray	2.00Å	0.35	0.15	PROGRAMED CELL DEATH PROTEIN 8
1q1r.1.A	21.95	monomer	HHblits	X-ray	1.91Å	0.30	0.15	Putidaredoxin reductase
1q1w.2.A	21.95	monomer	HHblits	X-ray	2.60Å	0.30	0.15	Putidaredoxin reductase
3lb8.1.A	21.95	hetero-oligomer	HHblits	X-ray	2.60Å	0.30	0.15	Putidaredoxin reductase
3lb8.2.A	21.95	hetero-oligomer	HHblits	X-ray	2.60Å	0.30	0.15	Putidaredoxin reductase
3ga5.1.A	9.30	monomer	HHblits	X-ray	1.87Å	0.26	0.16	D-galactose-binding periplasmic protein
4fx9.1.A	14.63	homo-dimer	HHblits	X-ray	2.70Å	0.29	0.15	Coenzyme A disulfide reductase
3kd9.1.A	14.63	homo-dimer	HHblits	X-ray	2.75Å	0.29	0.15	Coenzyme A disulfide reductase
3hyv.1.A	23.68	homo-trimer	HHblits	X-ray	2.30Å	0.35	0.14	Sulfide-quinone reductase
2y85.1.A	17.07	monomer	HHblits	X-ray	2.40Å	0.28	0.15	PHOSPHORIBOSYL ISOMERASE A
3zs4.1.A	17.07	monomer	HHblits	X-ray	1.90Å	0.28	0.15	PHOSPHORIBOSYL ISOMERASE A
2o14.1.A	17.07	monomer	HHblits	X-ray	2.10Å	0.28	0.15	Hypothetical protein yxiM
5l1n.1.A	15.00	homo-dimer	HHblits	X-ray	3.60Å	0.30	0.15	Coenzyme A disulfide reductase
3ipc.1.A	15.00	monomer	HHblits	X-ray	1.30Å	0.29	0.15	ABC transporter, substrate binding protein (Amino acid)
3cge.1.A	9.76	homo-dimer	HHblits	X-ray	2.26Å	0.27	0.15	Pyridine nucleotide-disulfide oxidoreductase, class I
3nta.1.A	12.50	homo-dimer	HHblits	X-ray	2.01Å	0.29	0.15	FAD-dependent pyridine nucleotide-disulphide oxidoreductase
1usi.1.A	10.26	monomer	HHblits	X-ray	1.80Å	0.31	0.15	LEUCINE-SPECIFIC BINDING PROTEIN
1usg.1.A	10.26	homo-dimer	HHblits	X-ray	1.53Å	0.31	0.15	LEUCINE-SPECIFIC BINDING PROTEIN
5ere.1.A	20.00	monomer	HHblits	X-ray	2.00Å	0.28	0.15	Extracellular ligand-binding receptor
2pk8.1.A	20.51	homo-dimer	HHblits	X-ray	1.85Å	0.30	0.15	Uncharacterized protein PF0899
2liv.1.A	10.26	monomer	HHblits	X-ray	2.40Å	0.30	0.15	LEUCINE
2c7g.1.A	10.00	homo-dimer	HHblits	X-ray	1.80Å	0.28	0.15	NADPH-FERREDOXIN REDUCTASE FPRA
4kv7.1.A	20.00	monomer	HHblits	X-ray	1.20Å	0.28	0.15	Probable leucine/isoleucine/valine-binding protein
3cgb.1.A	10.00	homo-dimer	HHblits	X-ray	1.90Å	0.28	0.15	Pyridine nucleotide-disulfide oxidoreductase, class I
3ipa.1.A	15.38	monomer	HHblits	X-ray	1.55Å	0.30	0.15	ABC transporter, substrate binding protein (Amino acid)
4n0q.1.A	20.51	monomer	HHblits	X-ray	2.30Å	0.29	0.15	Leu/Ile/Val-binding protein homolog 3
4eqr.1.A	12.82	homo-dimer	HHblits	X-ray	1.80Å	0.29	0.15	Coenzyme A disulfide reductase
1gpw.1.A	12.50	hetero-oligomer	HHblits	X-ray	2.40Å	0.26	0.15	HISF PROTEIN
1gpw.3.A	12.50	hetero-oligomer	HHblits	X-ray	2.40Å	0.26	0.15	HISF PROTEIN
1e1m.1.A	15.38	monomer	HHblits	X-ray	1.85Å	0.28	0.15	ADRENODOXIN REDUCTASE
1e1l.1.A	15.38	monomer	HHblits	X-ray	2.30Å	0.28	0.15	ADRENODOXIN REDUCTASE
1e6e.2.A	15.38	hetero-oligomer	HHblits	X-ray	2.30Å	0.28	0.15	NADPH\:ADRENODOXIN OXIDOREDUCTASE
1e6e.1.A	15.38	hetero-oligomer	HHblits	X-ray	2.30Å	0.28	0.15	NADPH\:ADRENODOXIN OXIDOREDUCTASE
4fx7.1.A	12.50	monomer	HHblits	X-ray	2.08Å	0.26	0.15	Imidazole glycerol phosphate synthase subunit HisF
1x7i.1.A	15.79	homo-dimer	HHblits	X-ray	1.70Å	0.29	0.14	Copper homeostasis protein cutC
1x7i.1.B	15.79	homo-dimer	HHblits	X-ray	1.70Å	0.29	0.14	Copper homeostasis protein cutC
1twd.1.A	15.79	homo-dimer	HHblits	X-ray	1.70Å	0.29	0.14	Copper homeostasis protein cutC
1twd.1.B	15.79	homo-dimer	HHblits	X-ray	1.70Å	0.29	0.14	Copper homeostasis protein cutC
3ipa.1.A	12.82	monomer	HHblits	X-ray	1.55Å	0.26	0.15	ABC transporter, substrate binding protein (Amino acid)
4kv7.1.A	17.95	monomer	HHblits	X-ray	1.20Å	0.26	0.15	Probable leucine/isoleucine/valine-binding protein
3vrd.1.B	25.00	hetero-oligomer	HHblits	X-ray	1.50Å	0.32	0.14	Flavocytochrome c flavin subunit
2czw.1.A	13.16	monomer	HHblits	X-ray	1.90Å	0.28	0.14	50S ribosomal protein L7Ae
2hqb.1.A	5.13	monomer	HHblits	X-ray	2.70Å	0.25	0.15	Transcriptional activator of comK gene
2zvi.1.A	24.32	homo-dimer	HHblits	X-ray	2.30Å	0.29	0.14	2,3-diketo-5-methylthiopentyl-1-phosphate enolase
2zvi.1.B	24.32	homo-dimer	HHblits	X-ray	2.30Å	0.29	0.14	2,3-diketo-5-methylthiopentyl-1-phosphate enolase
2zvi.2.A	24.32	homo-dimer	HHblits	X-ray	2.30Å	0.29	0.14	2,3-diketo-5-methylthiopentyl-1-phosphate enolase
4f06.1.A	10.53	monomer	HHblits	X-ray	1.30Å	0.26	0.14	Extracellular ligand-binding receptor
4n0q.1.A	16.22	monomer	HHblits	X-ray	2.30Å	0.28	0.14	Leu/Ile/Val-binding protein homolog 3
3lkv.1.A	13.51	homo-dimer	HHblits	X-ray	2.20Å	0.27	0.14	uncharacterized CONSERVED DOMAIN PROTEIN
2lbp.1.A	7.89	monomer	HHblits	X-ray	2.40Å	0.24	0.14	LEUCINE-BINDING PROTEIN
3ipc.1.A	14.29	monomer	HHblits	X-ray	1.30Å	0.28	0.13	ABC transporter, substrate binding protein (Amino acid)
4evs.1.A	11.43	monomer	HHblits	X-ray	1.45Å	0.28	0.13	PUTATIVE ABC TRANSPORTER SUBUNIT, SUBSTRATE-BINDING COMPONENT
3ijd.1.A	17.65	homo-dimer	HHblits	X-ray	2.00Å	0.28	0.13	uncharacterized protein
4mg4.1.A	14.71	homo-dimer	HHblits	X-ray	1.70Å	0.25	0.13	Phosphonomutase
4mg4.2.B	14.71	homo-dimer	HHblits	X-ray	1.70Å	0.25	0.13	Phosphonomutase
5dmm.1.A	15.63	monomer	HHblits	X-ray	1.78Å	0.26	0.12	Homocysteine S-methyltransferase
5dmn.1.A	15.63	homo-dimer	HHblits	X-ray	2.89Å	0.26	0.12	Homocysteine S-methyltransferase
3dfu.1.A	22.22	homo-dimer	HHblits	X-ray	2.07Å	0.34	0.10	Uncharacterized Protein from 6-Phosphogluconate Dehydrogenase-Like Family
3dfu.1.B	22.22	homo-dimer	HHblits	X-ray	2.07Å	0.34	0.10	Uncharacterized Protein from 6-Phosphogluconate Dehydrogenase-Like Family
1glg.1.A	10.34	monomer	HHblits	X-ray	2.00Å	0.26	0.11	GALACTOSE/GLUCOSE-BINDING PROTEIN
2qw1.1.A	10.34	monomer	HHblits	X-ray	1.70Å	0.26	0.11	D-galactose-binding periplasmic protein
2fvy.1.A	10.34	monomer	HHblits	X-ray	0.92Å	0.26	0.11	D-galactose-binding periplasmic protein
1usi.1.A	18.52	monomer	HHblits	X-ray	1.80Å	0.31	0.10	LEUCINE-SPECIFIC BINDING PROTEIN
1usg.1.A	18.52	homo-dimer	HHblits	X-ray	1.53Å	0.31	0.10	LEUCINE-SPECIFIC BINDING PROTEIN
5a9r.1.A	28.00	homo-dimer	HHblits	X-ray	1.55Å	0.34	0.09	IMINE REDUCTASE
5a9s.1.A	28.00	hetero-oligomer	HHblits	X-ray	2.06Å	0.34	0.09	IMINE REDUCTASE
5fwn.1.B	28.00	homo-dimer	HHblits	X-ray	2.14Å	0.34	0.09	IMINE REDUCTASE
3pn9.1.A	11.11	homo-tetramer	HHblits	X-ray	2.00Å	0.27	0.10	Proline dipeptidase
3p94.1.A	7.41	monomer	HHblits	X-ray	1.93Å	0.26	0.10	GDSL-like Lipase
3lkv.1.A	18.52	homo-dimer	HHblits	X-ray	2.20Å	0.26	0.10	uncharacterized CONSERVED DOMAIN PROTEIN
5kp9.1.A	16.00	homo-60-mer	HHblits	EM	NA	0.30	0.09	EPN-01*
5cx1.1.B	12.50	hetero-oligomer	HHblits	X-ray	1.75Å	0.31	0.09	Nitrogenase molybdenum-iron protein beta chain
4rs3.1.A	17.39	monomer	HHblits	X-ray	1.40Å	0.31	0.09	ABC transporter, carbohydrate uptake transporter-2 (CUT2) family, periplasmic sugar-binding protein
4xpi.1.B	13.04	hetero-oligomer	HHblits	X-ray	1.97Å	0.31	0.09	Nitrogenase molybdenum-iron protein beta chain
4yv7.1.A	8.70	monomer	HHblits	X-ray	2.30Å	0.28	0.09	Periplasmic binding protein/LacI transcriptional regulator
2ipm.1.A	13.04	monomer	HHblits	X-ray	1.12Å	0.27	0.09	D-galactose-binding periplasmic protein
2ipn.1.A	13.04	monomer	HHblits	X-ray	1.15Å	0.27	0.09	D-galactose-binding periplasmic protein
2hph.1.A	13.04	monomer	HHblits	X-ray	1.33Å	0.27	0.09	D-galactose-binding periplasmic protein
2ipl.1.A	13.64	monomer	HHblits	X-ray	1.20Å	0.28	0.08	D-galactose-binding periplasmic protein
5kws.1.A	13.64	monomer	HHblits	X-ray	1.32Å	0.27	0.08	Galactose-binding protein
2liv.1.A	14.29	monomer	HHblits	X-ray	2.40Å	0.30	0.08	LEUCINE
3tq0.1.A	14.29	homo-dimer	HHblits	X-ray	1.90Å	0.28	0.08	Dihydroorotate dehydrogenase
3pid.1.A	30.00	homo-dimer	HHblits	X-ray	1.40Å	0.31	0.08	UDP-glucose 6-dehydrogenase
3mw8.1.A	31.25	monomer	HHblits	X-ray	1.65Å	0.30	0.06	Uroporphyrinogen-III synthase