SWISS-MODEL | Workspace | Model Results

SWISS-MODEL Homology Modelling Report

Model Building Report

This document lists the results for the homology modelling project "O26027-MurE-H-pylori" submitted to SWISS-MODEL workspace on Oct. 17, 2017, 6:23 p.m..The submitted primary amino acid sequence is given in Table T1.

If you use any results in your research, please cite the relevant publications:

Marco Biasini; Stefan Bienert; Andrew Waterhouse; Konstantin Arnold; Gabriel Studer; Tobias Schmidt; Florian Kiefer; Tiziano Gallo Cassarino; Martino Bertoni; Lorenza Bordoli; Torsten Schwede. (2014). SWISS-MODEL: modelling protein tertiary and quaternary structure using evolutionary information. Nucleic Acids Research (1 July 2014) 42 (W1): W252-W258; doi: 10.1093/nar/gku340.
Arnold, K., Bordoli, L., Kopp, J. and Schwede, T. (2006) The SWISS-MODEL workspace: a web-based environment for protein structure homology modelling. Bioinformatics, 22, 195-201.
Benkert, P., Biasini, M. and Schwede, T. (2011) Toward the estimation of the absolute quality of individual protein structure models. Bioinformatics, 27, 343-350

Results

The SWISS-MODEL template library (SMTL version 2017-10-11, PDB release 2017-10-06) was searched with Blast (Altschul et al., 1997) and HHBlits (Remmert, et al., 2011) for evolutionary related structures matching the target sequence in Table T1. For details on the template search, see Materials and Methods. Overall 568 templates were found (Table T2).

Models

The following models were built (see Materials and Methods "Model Building"):

Model #01	File	Built with	Oligo-State	Ligands	GMQE	QMEAN
	PDB	ProMod3 Version 1.0.2.	MONOMER	1 x MG: MAGNESIUM ION;	0.66	-4.94

QMEAN	-4.94
Cβ	-1.43
All Atom	-0.96
Solvation	-0.56
Torsion	-4.77

Template	Seq Identity	Oligo-state	Found by	Method	Resolution	Seq Similarity	Range	Coverage	Description
4bub.2.A	32.30	monomer	HHblits	X-ray	2.90Å	0.36	11 - 444	0.94	UDP-N-ACETYLMURAMOYL-L-ALANYL-D-GLUTAMATE--LD-LYSINE LIGASE

Ligand	Added to Model	Description
MG	✓	MAGNESIUM ION
ADP	✕ - Binding site not conserved.	ADENOSINE-5'-DIPHOSPHATE

Target    MKLKKTLTYQNHTYSFLSDNTHEVLENPKEILFVKTP----LNEKYSHLIAEKNLA-ILD------------FNELK---
4bub.2.A  ----------DLEITGVSNHSSKV---KKGDLFICRRGEKFDSHEIIPEVMEKGAVAVVVEREIDLDFPYIQVFDSRYFE

Target    -----NYFDF---KIKIVGITGTNGKTTTASLMYSLLLDLNKKTALLGTRGFFINNERIKEKGLTTPTLLELYSDLEEAV
4bub.2.A  AKVASLFFEDPWKDVLTFGVTGTNGKTTTTMMIYHMLTSLGERGSVLTTAVKRILGNSY-YDDITTPDAITILSAMKENR

Target    RLKCEYFIMEVSSHAIVQKRIAGLDFALKILTNITSDHLDFHQSIENYRDAKNSFFKD---EGLKVINRDETN-ALFN-P
4bub.2.A  EGGGKFFALEVSSHALVQQRVEGVRFDVGIFTNISRDHLDFHGTFENYLKAKLHLFDLLKDDGVAVLNES--LADAFNRK

Target    VNAHTYALDKKAHLNVQAF--SLNPSISASLCYQQDLRDPNFKEIALMHSPLLGRYNLYNILAGVLGVKLLTQLPLETIV
4bub.2.A  SRKITFGTSKNADYRLGNIEVSWE-GTQFVLETPD--------GLLKVFTRAIGDFNAYNAAAAIAALHQL-GYDPKDLA

Target    PLLENFYGVKGRLEIVHS----KPLVVVDFAHTIDGMQQVFESFK---NQKITALFGAGGDRDKTKRPEMGAIASYYAHK
4bub.2.A  SSLETFTGVEGRFEVVRGAKKIGLNVVVDFAHSPDALEKLLKNVRKISQGRVIVVFGAGGNSDRGKRPMMSEVASKLADV

Target    IILTSDNPRSENEEDIIKDILKGINDSSKVIVEKDRKKAILNALENLKDDEVLLILGKGDENIQIFKD-KTIFFSDQEVV
4bub.2.A  VILTTDDPRGEDPEQIMEDLIKGIDKRKPYLVLFDRREAIETALTIANRGDSVVIAGRGHERYQIIDEEKKVPFQDREVV

Target    KSYYQHLKQG
4bub.2.A  EEIIRDK---

Model #02	File	Built with	Oligo-State	Ligands	GMQE	QMEAN
	PDB	ProMod3 Version 1.0.2.	MONOMER	None	0.50	-6.48

QMEAN	-6.48
Cβ	-4.20
All Atom	-3.00
Solvation	-1.97
Torsion	-5.56

Template	Seq Identity	Oligo-state	Found by	Method	Resolution	Seq Similarity	Range	Coverage	Description
3zm5.1.A	16.13	monomer	HHblits	X-ray	2.94Å	0.28	11 - 420	0.83	UDP-N-ACETYLMURAMOYL-TRIPEPTIDE--D-ALANYL-D-ALANINE LIGASE

Ligand	Added to Model	Description
IGM	✕ - Binding site not conserved.	2,4-BIS(CHLORANYL)-N-[3-CYANO-6-[(4-HYDROXYPHENYL)METHYL]-5,7-DIHYDRO-4H-THIENO[2,3-C]PYRIDIN-2-YL]-5-MORPHOLIN-4-YLSULFONYL-BENZAMIDE

Target    MKLKKTLTYQNHTYSFLSDNTHEVLENPKEILFVKTP---LNEKYSHLIAEKNLA-ILD-----------FNELK-----
3zm5.1.A  ----------DTQLEKAEFDSRLI---GTGDLFVPLKGARDGHDFIETAFENGAAVTLSEKEVSNHPYILVDDVLTAFQS

Target    --NYFD-F-KIKIVGITGTNGKTTTASLMYSLLLDLNKKTALLGTRGFFINNERIKEKGLTTPTLLELYSDLEEAVRLKC
3zm5.1.A  LASYYLEKTTVDVFAVTGSNGKTTTKDMLAHLLSTRYK---TYKTQGNYNNEIGL-PY--------TVL----H-MPEGT

Target    EYFIMEVS-SHAIVQKRIAG-LDFALKILTNITSDHLDFHQSIENYRDAKNSFFKD---EGLKVINRDETNALF--NPVN
3zm5.1.A  EKLVLEMGQDHLGDIHLLSELARPKTAIVTLVGEAHLAFFKDRSEIAKGKMQIADGMASGSLLLAPADPIVEDYLPIDKK

Target    AHTYALDKKAHLNVQAFSLNPSISASLCYQQDLRDPNFKEIALMHSPLLGRYNLYNILAGVLGVKLLTQLPLETIVPLLE
3zm5.1.A  VVRFGQGAELEITDLVERKD-SLTFKANFLE----------QALDLPVTGKYNATNAMIASYVALQE-GVSEEQIRLAFQ

Target    NFYGVKGRLEIVHS--KPLVVVD-FAHTIDGMQQVFESFK-N-----QKITALFGAG---GDRDKTKRPEMGAIASYY-A
3zm5.1.A  HLELTRNRTEWKKAANGADILSDVYNANPTAMKLILETFSAIPANEGGKKIAVLADMKELGDQSVQLHNQMILSLSPDVL

Target    HKIILTSDNPRSENEEDIIKDILKGINDSSKVIVEKD------RKKAILNALENLKDDEVLLILGKGDENIQIFKDKTIF
3zm5.1.A  DIVIFYGED-----IAQLAQLASQMFPI-GHVYYFKKTEDQDQFEDLVKQVKESLGAHDQILLKGSNSMN----------

Target    FSDQEVVKSYYQHLKQG
3zm5.1.A  -----------------

Model #03	File	Built with	Oligo-State	Ligands	GMQE	QMEAN
	PDB	ProMod3 Version 1.0.2.	MONOMER	None	0.46	-6.22

QMEAN	-6.22
Cβ	-4.04
All Atom	-3.09
Solvation	-1.52
Torsion	-5.36

Template	Seq Identity	Oligo-state	Found by	Method	Resolution	Seq Similarity	Range	Coverage	Description
1eeh.1.A	17.40	monomer	HHblits	X-ray	1.90Å	0.29	28 - 418	0.76	UDP-N-ACETYLMURAMOYL-L-ALANINE:D-GLUTAMATE LIGASE

Ligand	Added to Model	Description
UMA	✕ - Binding site not conserved.	URIDINE-5'-DIPHOSPHATE-N-ACETYLMURAMOYL-L-ALANINE

Target    MKLKKTLTYQNHTYSFLSDNTHEVLENPKEILFVKTP---LNEKYSHLIAEKNLAILDFNELKNYFDF-KIKIVGITGTN
1eeh.1.A  ---------------------------MAADLIVASPGIALAHPSLSAAADAGIEIVGDIEL--FCREAQAPIVAITGSN

Target    GKTTTASLMYSLLLDLNKKTALLGTRGFFINNERIKEKGLTTPTLLELYSDLEEAVRLKCEYFIMEVSSHAIVQKRIAGL
1eeh.1.A  GKSTVTTLVGEMAKAAGVNVGVGGNIGLPAL----------------------MLLDDECELYVLELSSFQLE--TTSSL

Target    DFALKILTNITSDHLDFHQ-SIENYRDAKNSFFKDEGLKVINRDETN-ALFN--PVNAHTYALDKKAHLNVQAFSLNPSI
1eeh.1.A  QAVAATILNVTEDHMDRYPFGLQQYRAAKLRIYENAKVCVVNADDALTMPIRGADERCVSFGVNM-GDYHLNHQQGE-TW

Target    SASLCYQQDLRDPNFKE-IALMHSPLLGRYNLYNILAGVLGVKLLTQLPLETIVPLLENFYGVKGRLEIVHS--KPLVVV
1eeh.1.A  -LR--VKGE-------KVLNVKEMKLSGQHNYTNALAALALADAA-GLPRASSLKALTTFTGLPHRFEVVLEHNGVRWIN

Target    DF-AHTIDGMQQVFESFK-NQKITALFGAGGDRDKTKRPEMGAIASYYAHKIILTSDNPRSENEEDIIKDILKGINDSSK
1eeh.1.A  DSKATNVGSTEAALNGLHVDGTLHLLLGGD-GKSADFSP-LARYLNGDNVRLYCFGRD-----GAQLAALRPE------V

Target    VIVEKDRKKAILNALENLKDDEVLLILGKGDENIQIFKDKTIFFSDQEVVKSYYQHLKQG
1eeh.1.A  AEQTETMEQAMRLLAPRVQPGDMVLLSPACA-----------------------------

Materials and Methods

Template Search

Template search with Blast and HHBlits has been performed against the SWISS-MODEL template library (SMTL, last update: 2017-10-11, last included PDB release: 2017-10-06).

The target sequence was searched with BLAST (Altschul et al., 1997) against the primary amino acid sequence contained in the SMTL. A total of 12 templates were found.

An initial HHblits profile has been built using the procedure outlined in (Remmert, et al., 2011), followed by 1 iteration of HHblits against NR20. The obtained profile has then be searched against all profiles of the SMTL. A total of 556 templates were found.

Template Selection

For each identified template, the template's quality has been predicted from features of the target-template alignment. The templates with the highest quality have then been selected for model building.

Model Building

Models are built based on the target-template alignment using ProMod3. Coordinates which are conserved between the target and the template are copied from the template to the model. Insertions and deletions are remodelled using a fragment library. Side chains are then rebuilt. Finally, the geometry of the resulting model is regularized by using a force field. In case loop modelling with ProMod3 fails, an alternative model is built with PROMOD-II (Guex, et al., 1997).

Model Quality Estimation

The global and per-residue model quality has been assessed using the QMEAN scoring function (Benkert, et al., 2011) . For improved performance, weights of the individual QMEAN terms have been trained specifically for SWISS-MODEL.

Ligand Modelling

Ligands present in the template structure are transferred by homology to the model when the following criteria are met (Gallo -Casserino, to be published): (a) The ligands are annotated as biologically relevant in the template library, (b) the ligand is in contact with the model, (c) the ligand is not clashing with the protein, (d) the residues in contact with the ligand are conserved between the target and the template. If any of these four criteria is not satisfied, a certain ligand will not be included in the model. The model summary includes information on why and which ligand has not been included.

Oligomeric State Conservation

Homo-oligomeric structure of the target protein is predicted based on the analysis of pairwise interfaces of the identified template structures. For each relevant interface between polypeptide chains (interfaces with more than 10 residue-residue interactions), the QscoreOligomer (Mariani et al., 2011) is predicted from features such as similarity to target and frequency of observing this interface in the identified templates (Kiefer, Bertoni, Biasini, to be published). The prediction is performed with a random forest regressor using these features as input parameters to predict the probability of conservation for each interface. The QscoreOligomer of the whole complex is then calculated as the weight-averaged QscoreOligomer of the interfaces. The oligomeric state of the target is predicted to be the same as in the template when QscoreOligomer is predicted to be higher or equal to 0.5.

References

Altschul, S.F., Madden, T.L., Schaffer, A.A., Zhang, J., Zhang, Z., Miller, W. and Lipman, D.J. (1997) Gapped BLAST and PSI-BLAST: a new generation of protein database search programs. Nucleic Acids Res, 25, 3389-3402.
Remmert, M., Biegert, A., Hauser, A. and Soding, J. (2012) HHblits: lightning-fast iterative protein sequence searching by HMM-HMM alignment. Nat Methods, 9, 173-175.
Guex, N. and Peitsch, M.C. (1997) SWISS-MODEL and the Swiss-PdbViewer: an environment for comparative protein modeling. Electrophoresis, 18, 2714-2723.
Sali, A. and Blundell, T.L. (1993) Comparative protein modelling by satisfaction of spatial restraints. J Mol Biol, 234, 779-815.
Benkert, P., Biasini, M. and Schwede, T. (2011) Toward the estimation of the absolute quality of individual protein structure models. Bioinformatics, 27, 343-350.
Mariani, V., Kiefer, F., Schmidt, T., Haas, J. and Schwede, T. (2011) Assessment of template based protein structure predictions in CASP9. Proteins, 79 Suppl 10, 37-58.

Table T1:

Primary amino acid sequence for which templates were searched and models were built.

MKLKKTLTYQNHTYSFLSDNTHEVLENPKEILFVKTPLNEKYSHLIAEKNLAILDFNELKNYFDFKIKIVGITGTNGKTTTASLMYSLLLDLNKKTALLG
TRGFFINNERIKEKGLTTPTLLELYSDLEEAVRLKCEYFIMEVSSHAIVQKRIAGLDFALKILTNITSDHLDFHQSIENYRDAKNSFFKDEGLKVINRDE
TNALFNPVNAHTYALDKKAHLNVQAFSLNPSISASLCYQQDLRDPNFKEIALMHSPLLGRYNLYNILAGVLGVKLLTQLPLETIVPLLENFYGVKGRLEI
VHSKPLVVVDFAHTIDGMQQVFESFKNQKITALFGAGGDRDKTKRPEMGAIASYYAHKIILTSDNPRSENEEDIIKDILKGINDSSKVIVEKDRKKAILN
ALENLKDDEVLLILGKGDENIQIFKDKTIFFSDQEVVKSYYQHLKQG

Table T2:

Template	Seq Identity	Oligo-state	Found by	Method	Resolution	Seq Similarity	Coverage	Description
4c12.1.A	29.52	homo-dimer	HHblits	X-ray	1.80Å	0.36	0.94	UDP-N-ACETYLMURAMOYL-L-ALANYL-D-GLUTAMATE--L-LYSINE LIGASE
4bub.1.A	32.30	monomer	HHblits	X-ray	2.90Å	0.36	0.94	UDP-N-ACETYLMURAMOYL-L-ALANYL-D-GLUTAMATE--LD-LYSINE LIGASE
4bub.2.A	32.30	monomer	HHblits	X-ray	2.90Å	0.36	0.94	UDP-N-ACETYLMURAMOYL-L-ALANYL-D-GLUTAMATE--LD-LYSINE LIGASE
1e8c.1.A	30.71	monomer	HHblits	X-ray	2.00Å	0.35	0.94	UDP-N-ACETYLMURAMOYLALANYL-D-GLUTAMATE--2,6-DIAMINOPIMELATE LIGASE
2xja.1.A	29.45	monomer	HHblits	X-ray	3.00Å	0.34	0.94	UDP-N-ACETYLMURAMOYL-L-ALANYL-D-GLUTAMATE--2,6-DIAMINOPIMELATE LIGASE
2wtz.1.A	29.45	monomer	HHblits	X-ray	3.00Å	0.34	0.94	UDP-N-ACETYLMURAMOYL-L-ALANYL-D-GLUTAMATE--2,6-DIAMINOPIMELATE LIGASE
4c12.1.A	35.43	homo-dimer	BLAST	X-ray	1.80Å	0.39	0.78	UDP-N-ACETYLMURAMOYL-L-ALANYL-D-GLUTAMATE--L-LYSINE LIGASE
4cvl.1.A	19.84	monomer	HHblits	X-ray	2.98Å	0.29	0.83	UDP-N-ACETYLMURAMOYL-TRIPEPTIDE--D-ALANYL-D-ALANINE LIGASE
4cvm.1.A	19.84	monomer	HHblits	X-ray	2.06Å	0.29	0.83	UDP-N-ACETYLMURAMOYL-TRIPEPTIDE--D-ALANYL-D- ALANINE LIGASE
2am2.1.A	16.09	monomer	HHblits	X-ray	2.80Å	0.28	0.83	UDP-N-acetylmuramoylalanine-D-glutamyl-lysine-D-alanyl-D-alanine ligase, MurF protein
3zl8.1.A	19.29	monomer	HHblits	X-ray	1.65Å	0.29	0.82	UDP-N-ACETYLMURAMOYL-TRIPEPTIDE--D-ALANYL-D-ALANINE LIGASE
3zm5.1.A	16.13	monomer	HHblits	X-ray	2.94Å	0.28	0.83	UDP-N-ACETYLMURAMOYL-TRIPEPTIDE--D-ALANYL-D-ALANINE LIGASE
1gg4.1.A	16.30	monomer	HHblits	X-ray	2.30Å	0.29	0.82	UDP-N-ACETYLMURAMOYLALANYL-D-GLUTAMYL-2,6-DIAMINOPIMELATE-D-ALANYL-D-ALANYL LIGASE
3hn7.1.A	15.99	monomer	HHblits	X-ray	1.65Å	0.29	0.83	UDP-N-acetylmuramate-L-alanine ligase
4ziy.1.A	17.98	monomer	HHblits	X-ray	1.85Å	0.29	0.82	UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase
4qf5.1.A	17.49	monomer	HHblits	X-ray	2.80Å	0.29	0.82	UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase
4qdi.1.A	17.49	monomer	HHblits	X-ray	1.80Å	0.29	0.82	UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase
2f00.1.A	18.46	homo-dimer	HHblits	X-ray	2.50Å	0.29	0.81	UDP-N-acetylmuramate--L-alanine ligase
4hv4.1.A	17.36	monomer	HHblits	X-ray	2.25Å	0.29	0.81	UDP-N-acetylmuramate--L-alanine ligase
4hv4.2.A	17.36	monomer	HHblits	X-ray	2.25Å	0.29	0.81	UDP-N-acetylmuramate--L-alanine ligase
1p3d.1.A	15.15	monomer	HHblits	X-ray	1.70Å	0.28	0.81	UDP-N-acetylmuramate--alanine ligase
1gqq.1.A	15.15	homo-dimer	HHblits	X-ray	3.10Å	0.28	0.81	UDP-N-ACETYLMURAMATE-L-ALANINE LIGASE
1gqq.1.B	15.15	homo-dimer	HHblits	X-ray	3.10Å	0.28	0.81	UDP-N-ACETYLMURAMATE-L-ALANINE LIGASE
1p31.1.A	15.15	monomer	HHblits	X-ray	1.85Å	0.28	0.81	UDP-N-acetylmuramate--alanine ligase
1gqy.1.B	15.15	homo-dimer	HHblits	X-ray	1.80Å	0.28	0.81	UDP-N-ACETYLMURAMATE-L-ALANINE LIGASE
1gqy.1.A	15.15	homo-dimer	HHblits	X-ray	1.80Å	0.28	0.81	UDP-N-ACETYLMURAMATE-L-ALANINE LIGASE
2xja.1.A	35.08	monomer	BLAST	X-ray	3.00Å	0.36	0.73	UDP-N-ACETYLMURAMOYL-L-ALANYL-D-GLUTAMATE--2,6-DIAMINOPIMELATE LIGASE
2wtz.1.A	35.08	monomer	BLAST	X-ray	3.00Å	0.36	0.73	UDP-N-ACETYLMURAMOYL-L-ALANYL-D-GLUTAMATE--2,6-DIAMINOPIMELATE LIGASE
1j6u.1.A	19.10	monomer	HHblits	X-ray	2.30Å	0.29	0.80	UDP-N-acetylmuramate-alanine ligase MurC
4bub.1.A	36.83	monomer	BLAST	X-ray	2.90Å	0.38	0.70	UDP-N-ACETYLMURAMOYL-L-ALANYL-D-GLUTAMATE--LD-LYSINE LIGASE
4bub.2.A	36.83	monomer	BLAST	X-ray	2.90Å	0.38	0.70	UDP-N-ACETYLMURAMOYL-L-ALANYL-D-GLUTAMATE--LD-LYSINE LIGASE
1e8c.1.A	35.35	monomer	BLAST	X-ray	2.00Å	0.38	0.70	UDP-N-ACETYLMURAMOYLALANYL-D-GLUTAMATE--2,6-DIAMINOPIMELATE LIGASE
3lk7.1.A	21.99	monomer	HHblits	X-ray	1.50Å	0.31	0.76	UDP-N-acetylmuramoylalanine--D-glutamate ligase
5a5f.1.A	17.40	monomer	HHblits	X-ray	1.90Å	0.29	0.76	UDP-N-ACETYLMURAMOYLALANINE--D-GLUTAMATE LIGASE
1uag.1.A	17.40	monomer	HHblits	X-ray	1.95Å	0.29	0.76	UDP-N-ACETYLMURAMOYL-L-ALANINE/:D-GLUTAMATE LIGASE
1eeh.1.A	17.40	monomer	HHblits	X-ray	1.90Å	0.29	0.76	UDP-N-ACETYLMURAMOYL-L-ALANINE:D-GLUTAMATE LIGASE
2uag.1.A	17.40	monomer	HHblits	X-ray	1.70Å	0.29	0.76	PROTEIN (UDP-N-ACETYLMURAMOYL-L-ALANINE:D-GLUTAMATE LIGASE)
1e0d.1.A	17.40	monomer	HHblits	X-ray	2.40Å	0.29	0.76	UDP-N-ACETYLMURAMOYLALANINE--D-GLUTAMATE LIGASE
5a5e.1.A	17.40	monomer	HHblits	X-ray	1.84Å	0.29	0.76	UDP-N-ACETYLMURAMOYLALANINE--D-GLUTAMATE LIGASE
2xpc.1.A	17.40	monomer	HHblits	X-ray	1.49Å	0.29	0.76	UDP-N-ACETYLMURAMOYLALANINE--D-GLUTAMATE LIGASE
2y67.1.A	17.40	monomer	HHblits	X-ray	1.85Å	0.29	0.76	UDP-N-ACETYLMURAMOYLALANINE--D-GLUTAMATE LIGASE
2vor.1.A	17.70	monomer	HHblits	X-ray	2.30Å	0.29	0.76	FOLYLPOLYGLUTAMATE SYNTHASE PROTEIN FOLC
4buc.1.A	20.67	monomer	HHblits	X-ray	2.17Å	0.30	0.74	UDP-N-ACETYLMURAMOYLALANINE--D-GLUTAMATE LIGASE
4buc.2.A	20.67	monomer	HHblits	X-ray	2.17Å	0.30	0.74	UDP-N-ACETYLMURAMOYLALANINE--D-GLUTAMATE LIGASE
1o5z.1.A	17.23	monomer	HHblits	X-ray	2.10Å	0.30	0.73	folylpolyglutamate synthase/dihydrofolate synthase
2gcb.1.A	20.68	monomer	HHblits	X-ray	2.30Å	0.30	0.72	Folylpolyglutamate synthase
3nrs.1.A	18.77	monomer	HHblits	X-ray	1.80Å	0.29	0.73	Dihydrofolate:folylpolyglutamate synthetase
3pyz.1.A	18.77	monomer	HHblits	X-ray	2.10Å	0.29	0.73	Bifunctional folylpolyglutamate synthase/dihydrofolate synthase
2gc5.1.A	20.12	monomer	HHblits	X-ray	1.85Å	0.29	0.72	Folylpolyglutamate synthase
1fgs.1.A	20.12	monomer	HHblits	X-ray	2.40Å	0.29	0.72	FOLYLPOLYGLUTAMATE SYNTHETASE
1jbw.1.A	20.12	monomer	HHblits	X-ray	1.85Å	0.29	0.72	FOLYLPOLYGLUTAMATE SYNTHASE
1jbv.1.A	20.12	monomer	HHblits	X-ray	1.95Å	0.29	0.72	FOLYLPOLYGLUTAMATE SYNTHASE
2gca.1.A	20.12	monomer	HHblits	X-ray	2.40Å	0.29	0.72	Folylpolyglutamate synthase
2gc6.1.A	19.81	monomer	HHblits	X-ray	1.90Å	0.29	0.72	Folylpolyglutamate synthase
1w7k.1.A	17.55	monomer	HHblits	X-ray	2.10Å	0.29	0.71	FOLC BIFUNCTIONAL PROTEIN
1w78.1.A	17.55	monomer	HHblits	X-ray	1.82Å	0.29	0.71	FOLC BIFUNCTIONAL PROTEIN
3lk7.1.A	28.67	monomer	BLAST	X-ray	1.50Å	0.35	0.64	UDP-N-acetylmuramoylalanine--D-glutamate ligase
4qf5.1.A	28.13	monomer	BLAST	X-ray	2.80Å	0.35	0.57	UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase
4qdi.1.A	28.13	monomer	BLAST	X-ray	1.80Å	0.35	0.57	UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase
4ziy.1.A	28.13	monomer	BLAST	X-ray	1.85Å	0.35	0.57	UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase
3eag.1.A	18.11	homo-dimer	HHblits	X-ray	2.55Å	0.29	0.54	UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-meso-diaminopimelate ligase
3eag.1.B	18.11	homo-dimer	HHblits	X-ray	2.55Å	0.29	0.54	UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-meso-diaminopimelate ligase
5vvw.1.A	18.33	homo-tetramer	HHblits	X-ray	2.30Å	0.28	0.54	UDP-N-acetylmuramate--L-alanine ligase
3mvn.1.A	16.24	monomer	HHblits	X-ray	1.90Å	0.30	0.26	UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-medo-diaminopimelate ligase
4buc.1.A	39.60	monomer	BLAST	X-ray	2.17Å	0.39	0.23	UDP-N-ACETYLMURAMOYLALANINE--D-GLUTAMATE LIGASE
4buc.2.A	39.60	monomer	BLAST	X-ray	2.17Å	0.39	0.23	UDP-N-ACETYLMURAMOYLALANINE--D-GLUTAMATE LIGASE
2obn.1.A	11.97	homo-dimer	HHblits	X-ray	2.30Å	0.26	0.26	Hypothetical protein
2obn.1.B	11.97	homo-dimer	HHblits	X-ray	2.30Å	0.26	0.26	Hypothetical protein
2mr6.1.A	16.28	monomer	HHblits	NMR	NA	0.29	0.19	De novo designed Protein OR462
1qzw.1.B	18.18	monomer	HHblits	X-ray	4.10Å	0.30	0.17	Signal recognition 54 kDa protein
1qzx.1.A	18.18	monomer	HHblits	X-ray	4.00Å	0.30	0.17	Signal recognition 54 kDa protein
4ue5.1.D	20.78	hetero-oligomer	HHblits	EM	9.00Å	0.30	0.17	SIGNAL RECOGNITION PARTICLE 54 KDA PROTEIN
5l3q.1.A	20.78	hetero-oligomer	HHblits	X-ray	3.20Å	0.30	0.17	Signal recognition particle 54 kDa protein
2j37.1.G	20.78	hetero-oligomer	HHblits	EM	8.00Å	0.29	0.17	SIGNAL RECOGNITION PARTICLE 54 KDA PROTEIN (SRP54)
3dm5.1.A	13.16	homo-tetramer	HHblits	X-ray	2.51Å	0.28	0.17	Signal recognition 54 kDa protein
3md0.1.A	19.70	homo-dimer	HHblits	X-ray	2.45Å	0.27	0.15	Arginine/ornithine transport system ATPase
2g0t.1.A	42.11	homo-dimer	HHblits	X-ray	2.67Å	0.38	0.09	conserved hypothetical protein
5l3s.1.B	29.73	hetero-oligomer	HHblits	X-ray	1.90Å	0.35	0.08	Signal recognition particle receptor FtsY
5l3s.2.B	29.73	hetero-oligomer	HHblits	X-ray	1.90Å	0.35	0.08	Signal recognition particle receptor FtsY
5l3s.3.B	29.73	hetero-oligomer	HHblits	X-ray	1.90Å	0.35	0.08	Signal recognition particle receptor FtsY
5l3s.4.B	29.73	hetero-oligomer	HHblits	X-ray	1.90Å	0.35	0.08	Signal recognition particle receptor FtsY
5l3w.1.A	29.73	monomer	HHblits	X-ray	2.40Å	0.35	0.08	Signal recognition particle receptor FtsY
1zu5.1.A	27.78	monomer	HHblits	X-ray	2.40Å	0.36	0.08	ftsY
1zu4.1.A	27.78	monomer	HHblits	X-ray	1.95Å	0.36	0.08	ftsY
5l3r.1.B	27.03	hetero-oligomer	HHblits	X-ray	2.50Å	0.34	0.08	Cell division protein FtsY homolog, chloroplastic
3b9q.1.A	27.03	monomer	HHblits	X-ray	1.75Å	0.34	0.08	Chloroplast SRP receptor homolog, alpha subunit CPFTSY
1vma.1.A	25.00	monomer	HHblits	X-ray	1.60Å	0.36	0.08	cell division protein FtsY
3dm9.1.A	24.32	homo-hexamer	HHblits	X-ray	2.20Å	0.33	0.08	Signal recognition particle receptor
3e70.1.A	24.32	monomer	HHblits	X-ray	1.97Å	0.33	0.08	Signal recognition particle receptor
3dmd.1.F	24.32	homo-hexamer	HHblits	X-ray	2.21Å	0.33	0.08	Signal recognition particle receptor
3dmd.1.E	24.32	homo-hexamer	HHblits	X-ray	2.21Å	0.33	0.08	Signal recognition particle receptor
4ak9.1.A	24.32	homo-dimer	HHblits	X-ray	1.80Å	0.33	0.08	CPFTSY
2v3c.1.B	27.78	hetero-oligomer	HHblits	X-ray	2.50Å	0.35	0.08	SIGNAL RECOGNITION 54 KDA PROTEIN
2v3c.2.B	27.78	hetero-oligomer	HHblits	X-ray	2.50Å	0.35	0.08	SIGNAL RECOGNITION 54 KDA PROTEIN
3syn.2.A	31.43	hetero-oligomer	HHblits	X-ray	3.06Å	0.37	0.08	Flagellar biosynthesis protein flhF
2px0.1.B	31.43	homo-dimer	HHblits	X-ray	3.00Å	0.37	0.08	Flagellar biosynthesis protein flhF
2px0.3.B	31.43	homo-dimer	HHblits	X-ray	3.00Å	0.37	0.08	Flagellar biosynthesis protein flhF
2px0.4.A	31.43	homo-dimer	HHblits	X-ray	3.00Å	0.37	0.08	Flagellar biosynthesis protein flhF
2px3.1.A	31.43	homo-dimer	HHblits	X-ray	3.20Å	0.37	0.08	Flagellar biosynthesis protein flhF
2px0.1.A	31.43	homo-dimer	HHblits	X-ray	3.00Å	0.37	0.08	Flagellar biosynthesis protein flhF
3ndb.1.B	27.78	hetero-oligomer	HHblits	X-ray	3.00Å	0.35	0.08	Signal recognition 54 kDa protein
1j8m.1.A	27.78	monomer	HHblits	X-ray	2.00Å	0.34	0.08	SIGNAL RECOGNITION 54 KDA PROTEIN
1xjc.1.A	15.79	monomer	HHblits	X-ray	2.10Å	0.29	0.09	MobB protein homolog
3nxs.1.A	34.29	homo-dimer	HHblits	X-ray	2.30Å	0.36	0.08	LAO/AO transport system ATPase
2og2.1.A	25.00	monomer	HHblits	X-ray	2.00Å	0.33	0.08	Putative signal recognition particle receptor
5l3s.1.A	27.78	hetero-oligomer	HHblits	X-ray	1.90Å	0.33	0.08	Signal recognition particle 54 kDa protein
5l3s.4.A	27.78	hetero-oligomer	HHblits	X-ray	1.90Å	0.33	0.08	Signal recognition particle 54 kDa protein
2bek.1.A	35.29	homo-dimer	HHblits	X-ray	1.80Å	0.37	0.08	SEGREGATION PROTEIN
1wcv.1.A	35.29	homo-dimer	HHblits	X-ray	1.60Å	0.37	0.08	SEGREGATION PROTEIN
2bej.1.A	35.29	homo-dimer	HHblits	X-ray	2.10Å	0.37	0.08	SEGREGATION PROTEIN
2qy9.1.A	25.00	monomer	HHblits	X-ray	1.90Å	0.32	0.08	Cell division protein ftsY
4c7o.1.A	25.00	hetero-oligomer	HHblits	X-ray	2.60Å	0.32	0.08	SIGNAL RECOGNITION PARTICLE PROTEIN
4c7o.2.A	25.00	hetero-oligomer	HHblits	X-ray	2.60Å	0.32	0.08	SIGNAL RECOGNITION PARTICLE PROTEIN
5nco.1.c	25.00	hetero-oligomer	HHblits	EM	4.80Å	0.32	0.08	Signal recognition particle receptor FtsY
1fts.1.A	25.00	monomer	HHblits	X-ray	2.20Å	0.32	0.08	FTSY
5j1j.1.A	29.41	homo-dimer	HHblits	X-ray	1.55Å	0.37	0.08	Site-determining protein
5j1j.1.B	29.41	homo-dimer	HHblits	X-ray	1.55Å	0.37	0.08	Site-determining protein
5jvf.1.A	29.41	monomer	HHblits	X-ray	1.66Å	0.37	0.08	Site-determining protein
2p67.1.A	31.43	homo-dimer	HHblits	X-ray	1.80Å	0.34	0.08	LAO/AO transport system kinase
1rj9.1.B	22.22	hetero-oligomer	HHblits	X-ray	1.90Å	0.32	0.08	Signal recognition particle protein
3io3.1.A	30.56	monomer	HHblits	X-ray	1.80Å	0.32	0.08	DEHA2D07832p
1j8y.1.A	25.71	monomer	HHblits	X-ray	2.00Å	0.34	0.08	SIGNAL RECOGNITION 54 KDA PROTEIN
3kl4.1.A	28.57	hetero-oligomer	HHblits	X-ray	3.50Å	0.34	0.08	Signal recognition 54 kDa protein
5l3v.1.A	28.57	monomer	HHblits	X-ray	2.30Å	0.34	0.08	Signal recognition particle 54 kDa protein
5l3v.2.A	28.57	monomer	HHblits	X-ray	2.30Å	0.34	0.08	Signal recognition particle 54 kDa protein
1p9n.1.A	18.92	homo-dimer	HHblits	X-ray	2.80Å	0.29	0.08	Molybdopterin-guanine dinucleotide biosynthesis protein B
1p9n.1.B	18.92	homo-dimer	HHblits	X-ray	2.80Å	0.29	0.08	Molybdopterin-guanine dinucleotide biosynthesis protein B
1np6.1.A	18.92	homo-dimer	HHblits	X-ray	1.90Å	0.29	0.08	Molybdopterin-guanine dinucleotide biosynthesis protein B
1np6.1.B	18.92	homo-dimer	HHblits	X-ray	1.90Å	0.29	0.08	Molybdopterin-guanine dinucleotide biosynthesis protein B
5l3r.1.A	22.22	hetero-oligomer	HHblits	X-ray	2.50Å	0.31	0.08	Signal recognition particle 54 kDa protein, chloroplastic
3cio.1.A	26.47	homo-dimer	HHblits	X-ray	2.50Å	0.36	0.08	Tyrosine-protein kinase etk
3cio.1.B	26.47	homo-dimer	HHblits	X-ray	2.50Å	0.36	0.08	Tyrosine-protein kinase etk
3adb.1.A	25.71	homo-dimer	HHblits	X-ray	2.80Å	0.33	0.08	L-seryl-tRNA(Sec) kinase
3adc.1.B	25.71	homo-dimer	HHblits	X-ray	2.90Å	0.33	0.08	L-seryl-tRNA(Sec) kinase
3adc.1.A	25.71	homo-dimer	HHblits	X-ray	2.90Å	0.33	0.08	L-seryl-tRNA(Sec) kinase
3adb.1.B	25.71	homo-dimer	HHblits	X-ray	2.80Å	0.33	0.08	L-seryl-tRNA(Sec) kinase
3add.1.B	25.71	homo-dimer	HHblits	X-ray	2.40Å	0.33	0.08	L-seryl-tRNA(Sec) kinase
4nkr.1.A	25.00	homo-dimer	HHblits	X-ray	2.41Å	0.31	0.08	Molybdopterin-guanine dinucleotide biosynthesis protein B
4nkr.2.A	25.00	homo-dimer	HHblits	X-ray	2.41Å	0.31	0.08	Molybdopterin-guanine dinucleotide biosynthesis protein B
4nkr.2.B	25.00	homo-dimer	HHblits	X-ray	2.41Å	0.31	0.08	Molybdopterin-guanine dinucleotide biosynthesis protein B
4nkr.3.A	25.00	homo-dimer	HHblits	X-ray	2.41Å	0.31	0.08	Molybdopterin-guanine dinucleotide biosynthesis protein B
4nkr.3.B	25.00	homo-dimer	HHblits	X-ray	2.41Å	0.31	0.08	Molybdopterin-guanine dinucleotide biosynthesis protein B
2ynm.1.A	29.41	hetero-oligomer	HHblits	X-ray	2.10Å	0.35	0.08	LIGHT-INDEPENDENT PROTOCHLOROPHYLLIDE REDUCTASE IRON-SULFUR ATP-BINDING PROTEIN
2gks.1.A	32.35	homo-dimer	HHblits	X-ray	2.31Å	0.35	0.08	Bifunctional SAT/APS kinase
2gks.1.B	32.35	homo-dimer	HHblits	X-ray	2.31Å	0.35	0.08	Bifunctional SAT/APS kinase
2cnw.1.B	32.35	hetero-oligomer	HHblits	X-ray	2.39Å	0.35	0.08	CELL DIVISION PROTEIN FTSY
2iyl.1.A	32.35	monomer	HHblits	X-ray	2.10Å	0.35	0.08	CELL DIVISION PROTEIN FTSY
2cnw.2.B	32.35	hetero-oligomer	HHblits	X-ray	2.39Å	0.35	0.08	CELL DIVISION PROTEIN FTSY
2j7p.1.B	32.35	hetero-oligomer	HHblits	X-ray	1.97Å	0.35	0.08	CELL DIVISION PROTEIN FTSY
1okk.1.B	32.35	hetero-oligomer	HHblits	X-ray	2.05Å	0.35	0.08	CELL DIVISION PROTEIN FTSY
2xkv.1.D	32.35	hetero-oligomer	HHblits	EM	13.50Å	0.35	0.08	CELL DIVISION PROTEIN FTSY
2q9a.1.A	32.35	monomer	HHblits	X-ray	2.24Å	0.35	0.08	Cell division protein ftsY
2q9a.2.A	32.35	monomer	HHblits	X-ray	2.24Å	0.35	0.08	Cell division protein ftsY
2xxa.1.B	25.71	hetero-oligomer	HHblits	X-ray	3.94Å	0.33	0.08	SRP RECEPTOR FTSY
5gad.1.9	25.71	hetero-oligomer	HHblits	EM	NA	0.33	0.08	Signal recognition particle receptor FtsY
2j7p.1.A	22.86	hetero-oligomer	HHblits	X-ray	1.97Å	0.33	0.08	SIGNAL RECOGNITION PARTICLE PROTEIN
3ng1.1.A	22.86	monomer	HHblits	X-ray	2.30Å	0.33	0.08	SIGNAL SEQUENCE RECOGNITION PROTEIN FFH
2cnw.1.A	22.86	hetero-oligomer	HHblits	X-ray	2.39Å	0.33	0.08	SIGNAL RECOGNITION PARTICLE PROTEIN
2cnw.3.A	22.86	hetero-oligomer	HHblits	X-ray	2.39Å	0.33	0.08	SIGNAL RECOGNITION PARTICLE PROTEIN
2xkv.1.A	22.86	hetero-oligomer	HHblits	EM	13.50Å	0.33	0.08	SIGNAL RECOGNITION PARTICLE PROTEIN
4c7o.1.B	22.22	hetero-oligomer	HHblits	X-ray	2.60Å	0.31	0.08	SIGNAL RECOGNITION PARTICLE RECEPTOR FTSY
5lc9.1.A	16.22	homo-tetramer	HHblits	X-ray	1.90Å	0.28	0.08	Polyphosphate:AMP phosphotransferase
5ld1.1.A	16.22	homo-tetramer	HHblits	X-ray	2.09Å	0.28	0.08	Polyphosphate:AMP phosphotransferase
2ffh.1.A	22.86	monomer	HHblits	X-ray	3.20Å	0.33	0.08	PROTEIN (FFH)
1rz3.1.A	25.71	monomer	HHblits	X-ray	1.90Å	0.33	0.08	hypothetical protein RBSTP0775
2ng1.1.A	22.86	monomer	HHblits	X-ray	2.02Å	0.32	0.08	SIGNAL SEQUENCE RECOGNITION PROTEIN FFH
1ls1.1.A	22.86	monomer	HHblits	X-ray	1.10Å	0.32	0.08	SIGNAL RECOGNITION PARTICLE PROTEIN
5a5g.1.A	39.39	homo-dimer	HHblits	X-ray	2.30Å	0.37	0.07	FORMATE--TETRAHYDROFOLATE LIGASE
3jaj.45.A	29.41	monomer	HHblits	EM	NA	0.35	0.08	SRP54
3jan.45.A	29.41	monomer	HHblits	EM	NA	0.35	0.08	SRP54
4f7w.1.B	32.35	homo-dimer	HHblits	X-ray	2.10Å	0.34	0.08	Pantothenate kinase
4f7w.1.A	32.35	homo-dimer	HHblits	X-ray	2.10Å	0.34	0.08	Pantothenate kinase
4f7w.3.A	32.35	homo-dimer	HHblits	X-ray	2.10Å	0.34	0.08	Pantothenate kinase
4f7w.4.B	32.35	homo-dimer	HHblits	X-ray	2.10Å	0.34	0.08	Pantothenate kinase
4ne2.2.A	32.35	homo-dimer	HHblits	X-ray	1.90Å	0.34	0.08	Pantothenate kinase
5k5z.1.A	33.33	homo-dimer	HHblits	X-ray	2.37Å	0.37	0.07	ParA
5k5z.2.A	33.33	homo-dimer	HHblits	X-ray	2.37Å	0.37	0.07	ParA
5k5z.2.B	33.33	homo-dimer	HHblits	X-ray	2.37Å	0.37	0.07	ParA
4v02.1.A	36.36	hetero-oligomer	HHblits	X-ray	2.70Å	0.36	0.07	SITE-DETERMINING PROTEIN
3la6.1.F	20.59	homo-octamer	HHblits	X-ray	3.20Å	0.34	0.08	Tyrosine-protein kinase wzc
3la6.1.B	20.59	homo-octamer	HHblits	X-ray	3.20Å	0.34	0.08	Tyrosine-protein kinase wzc
3la6.1.C	20.59	homo-octamer	HHblits	X-ray	3.20Å	0.34	0.08	Tyrosine-protein kinase wzc
3la6.1.D	20.59	homo-octamer	HHblits	X-ray	3.20Å	0.34	0.08	Tyrosine-protein kinase wzc
3la6.1.E	20.59	homo-octamer	HHblits	X-ray	3.20Å	0.34	0.08	Tyrosine-protein kinase wzc
3la6.1.A	20.59	homo-octamer	HHblits	X-ray	3.20Å	0.34	0.08	Tyrosine-protein kinase wzc
3la6.1.G	20.59	homo-octamer	HHblits	X-ray	3.20Å	0.34	0.08	Tyrosine-protein kinase wzc
3la6.1.H	20.59	homo-octamer	HHblits	X-ray	3.20Å	0.34	0.08	Tyrosine-protein kinase wzc
3la6.2.C	20.59	homo-octamer	HHblits	X-ray	3.20Å	0.34	0.08	Tyrosine-protein kinase wzc
3ua2.1.A	25.71	homo-hexamer	HHblits	X-ray	3.30Å	0.31	0.08	Circadian clock protein kinase kaiC
3ua2.1.B	25.71	homo-hexamer	HHblits	X-ray	3.30Å	0.31	0.08	Circadian clock protein kinase kaiC
3ua2.1.C	25.71	homo-hexamer	HHblits	X-ray	3.30Å	0.31	0.08	Circadian clock protein kinase kaiC
3ua2.1.D	25.71	homo-hexamer	HHblits	X-ray	3.30Å	0.31	0.08	Circadian clock protein kinase kaiC
3ua2.1.E	25.71	homo-hexamer	HHblits	X-ray	3.30Å	0.31	0.08	Circadian clock protein kinase kaiC
3ua2.1.F	25.71	homo-hexamer	HHblits	X-ray	3.30Å	0.31	0.08	Circadian clock protein kinase kaiC
3jzm.1.A	25.71	homo-hexamer	HHblits	X-ray	2.90Å	0.31	0.08	Circadian clock protein kinase kaiC
3jzm.1.F	25.71	homo-hexamer	HHblits	X-ray	2.90Å	0.31	0.08	Circadian clock protein kinase kaiC
3k0a.1.C	25.71	homo-hexamer	HHblits	X-ray	3.00Å	0.31	0.08	Circadian clock protein kinase KaiC
3k0a.1.B	25.71	homo-hexamer	HHblits	X-ray	3.00Å	0.31	0.08	Circadian clock protein kinase KaiC
3k0a.1.A	25.71	homo-hexamer	HHblits	X-ray	3.00Å	0.31	0.08	Circadian clock protein kinase KaiC
3k0a.1.F	25.71	homo-hexamer	HHblits	X-ray	3.00Å	0.31	0.08	Circadian clock protein kinase KaiC
1tf7.1.A	25.71	homo-hexamer	HHblits	X-ray	2.80Å	0.31	0.08	KaiC
1tf7.1.F	25.71	homo-hexamer	HHblits	X-ray	2.80Å	0.31	0.08	KaiC
1rj9.1.A	33.33	hetero-oligomer	HHblits	X-ray	1.90Å	0.36	0.07	Signal Recognition Protein
2yhs.1.A	26.47	monomer	HHblits	X-ray	1.60Å	0.34	0.08	CELL DIVISION PROTEIN FTSY
3fmi.1.A	26.47	homo-dimer	HHblits	X-ray	2.18Å	0.34	0.08	Dethiobiotin synthetase
3fmi.1.B	26.47	homo-dimer	HHblits	X-ray	2.18Å	0.34	0.08	Dethiobiotin synthetase
3fmf.2.A	26.47	homo-dimer	HHblits	X-ray	2.05Å	0.34	0.08	Dethiobiotin synthetase
3do6.1.A	29.41	homo-tetramer	HHblits	X-ray	1.85Å	0.34	0.08	Formate--tetrahydrofolate ligase
5it5.1.A	25.71	homo-hexamer	HHblits	X-ray	2.65Å	0.31	0.08	ATP binding motif-containing protein PilF
5it5.1.B	25.71	homo-hexamer	HHblits	X-ray	2.65Å	0.31	0.08	ATP binding motif-containing protein PilF
5it5.1.C	25.71	homo-hexamer	HHblits	X-ray	2.65Å	0.31	0.08	ATP binding motif-containing protein PilF
5it5.1.D	25.71	homo-hexamer	HHblits	X-ray	2.65Å	0.31	0.08	ATP binding motif-containing protein PilF
5it5.1.E	25.71	homo-hexamer	HHblits	X-ray	2.65Å	0.31	0.08	ATP binding motif-containing protein PilF
5it5.1.F	25.71	homo-hexamer	HHblits	X-ray	2.65Å	0.31	0.08	ATP binding motif-containing protein PilF
3fwy.1.A	26.47	homo-dimer	HHblits	X-ray	1.63Å	0.33	0.08	Light-independent protochlorophyllide reductase iron-sulfur ATP-binding protein
3fwy.1.B	26.47	homo-dimer	HHblits	X-ray	1.63Å	0.33	0.08	Light-independent protochlorophyllide reductase iron-sulfur ATP-binding protein
1ffh.1.A	23.53	monomer	HHblits	X-ray	2.05Å	0.33	0.08	FFH
5l3q.1.B	19.44	hetero-oligomer	HHblits	X-ray	3.20Å	0.29	0.08	Signal recognition particle receptor subunit alpha
2c03.1.A	23.53	monomer	HHblits	X-ray	1.24Å	0.33	0.08	SIGNAL RECOGNITION PARTICLE PROTEIN
2c03.2.A	23.53	monomer	HHblits	X-ray	1.24Å	0.33	0.08	SIGNAL RECOGNITION PARTICLE PROTEIN
2j45.1.A	23.53	monomer	HHblits	X-ray	1.14Å	0.33	0.08	SIGNAL RECOGNITION PARTICLE PROTEIN
2j45.2.A	23.53	monomer	HHblits	X-ray	1.14Å	0.33	0.08	SIGNAL RECOGNITION PARTICLE PROTEIN
2j46.1.A	23.53	monomer	HHblits	X-ray	1.14Å	0.33	0.08	SIGNAL RECOGNITION PARTICLE PROTEIN
2j46.2.A	23.53	monomer	HHblits	X-ray	1.14Å	0.33	0.08	SIGNAL RECOGNITION PARTICLE PROTEIN
1o87.1.A	23.53	monomer	HHblits	X-ray	2.10Å	0.33	0.08	SIGNAL RECOGNITION PARTICLE PROTEIN
1o87.2.A	23.53	monomer	HHblits	X-ray	2.10Å	0.33	0.08	SIGNAL RECOGNITION PARTICLE PROTEIN
2c04.1.A	23.53	monomer	HHblits	X-ray	1.15Å	0.33	0.08	SIGNAL RECOGNITION PARTICLE PROTEIN
2c04.2.A	23.53	monomer	HHblits	X-ray	1.15Å	0.33	0.08	SIGNAL RECOGNITION PARTICLE PROTEIN
1jpj.1.A	23.53	monomer	HHblits	X-ray	2.30Å	0.33	0.08	SIGNAL RECOGNITION PARTICLE PROTEIN
1jpn.1.A	23.53	monomer	HHblits	X-ray	1.90Å	0.33	0.08	SIGNAL RECOGNITION PARTICLE PROTEIN
1jpn.2.A	23.53	monomer	HHblits	X-ray	1.90Å	0.33	0.08	SIGNAL RECOGNITION PARTICLE PROTEIN
4jlv.1.A	23.53	monomer	HHblits	X-ray	2.20Å	0.33	0.08	C-terminal fragment of Membrane protein CapA1, Putative uncharacterized protein capB1
3bfv.1.A	23.53	monomer	HHblits	X-ray	1.80Å	0.33	0.08	Membrane protein CapA1, Protein tyrosine kinase
4jmp.1.A	23.53	monomer	HHblits	X-ray	1.30Å	0.33	0.08	C-terminal fragment of CapA, Protein tyrosine kinase
5u1j.1.A	30.30	homo-dimer	HHblits	X-ray	2.95Å	0.35	0.07	Uncharacterized protein
5u1j.1.B	30.30	homo-dimer	HHblits	X-ray	2.95Å	0.35	0.07	Uncharacterized protein
5u1j.2.A	30.30	homo-dimer	HHblits	X-ray	2.95Å	0.35	0.07	Uncharacterized protein
5u1j.2.B	30.30	homo-dimer	HHblits	X-ray	2.95Å	0.35	0.07	Uncharacterized protein
3zq6.1.A	26.47	homo-dimer	HHblits	X-ray	2.11Å	0.33	0.08	PUTATIVE ARSENICAL PUMP-DRIVING ATPASE
3zq6.1.B	26.47	homo-dimer	HHblits	X-ray	2.11Å	0.33	0.08	PUTATIVE ARSENICAL PUMP-DRIVING ATPASE
3zq6.2.A	26.47	homo-dimer	HHblits	X-ray	2.11Å	0.33	0.08	PUTATIVE ARSENICAL PUMP-DRIVING ATPASE
3zq6.2.B	26.47	homo-dimer	HHblits	X-ray	2.11Å	0.33	0.08	PUTATIVE ARSENICAL PUMP-DRIVING ATPASE
1e9f.1.A	20.00	homo-dimer	HHblits	X-ray	1.90Å	0.31	0.08	THYMIDYLATE KINASE
2xx3.1.A	20.00	homo-dimer	HHblits	X-ray	2.00Å	0.31	0.08	THYMIDYLATE KINASE
4pwx.1.A	22.86	hetero-oligomer	HHblits	X-ray	5.40Å	0.30	0.08	ATPase GET3
3idq.1.A	22.86	monomer	HHblits	X-ray	3.70Å	0.30	0.08	ATPase GET3
3vlc.1.A	22.86	hetero-oligomer	HHblits	X-ray	4.50Å	0.30	0.08	ATPase GET3
4v03.1.A	33.33	homo-dimer	HHblits	X-ray	1.90Å	0.35	0.07	SITE-DETERMINING PROTEIN
4zdi.1.A	25.71	homo-dimer	HHblits	X-ray	3.52Å	0.30	0.08	CTP synthase
4zdk.1.A	25.71	homo-tetramer	HHblits	X-ray	3.49Å	0.30	0.08	CTP synthase
5aun.1.B	20.59	hetero-oligomer	HHblits	X-ray	1.63Å	0.33	0.08	ATPase involved in chromosome partitioning, ParA/MinD family, Mrp homolog
3vx3.1.A	20.59	homo-dimer	HHblits	X-ray	2.10Å	0.33	0.08	ATPase involved in chromosome partitioning, ParA/MinD family, Mrp homolog
5auq.3.A	20.59	homo-dimer	HHblits	X-ray	2.53Å	0.33	0.08	ATPase involved in chromosome partitioning, ParA/MinD family, Mrp homolog
3vx3.1.B	20.59	homo-dimer	HHblits	X-ray	2.10Å	0.33	0.08	ATPase involved in chromosome partitioning, ParA/MinD family, Mrp homolog
3jc8.36.A	32.35	monomer	HHblits	EM	NA	0.33	0.08	Type IV-A pilus assembly ATPase PilB
3jc8.37.A	32.35	monomer	HHblits	EM	NA	0.33	0.08	Type IV-A pilus assembly ATPase PilB
3ibg.1.A	27.27	homo-dimer	HHblits	X-ray	3.20Å	0.35	0.07	ATPase, subunit of the Get complex
4oyh.1.A	22.86	homo-dimer	HHblits	X-ray	2.41Å	0.30	0.08	Molybdopterin-guanine dinucleotide biosynthesis protein B
4oyh.2.A	22.86	homo-dimer	HHblits	X-ray	2.41Å	0.30	0.08	Molybdopterin-guanine dinucleotide biosynthesis protein B
4oyh.2.B	22.86	homo-dimer	HHblits	X-ray	2.41Å	0.30	0.08	Molybdopterin-guanine dinucleotide biosynthesis protein B
4oyh.3.A	22.86	homo-dimer	HHblits	X-ray	2.41Å	0.30	0.08	Molybdopterin-guanine dinucleotide biosynthesis protein B
4oyh.3.B	22.86	homo-dimer	HHblits	X-ray	2.41Å	0.30	0.08	Molybdopterin-guanine dinucleotide biosynthesis protein B
5cb6.3.B	26.47	homo-dimer	HHblits	X-ray	2.79Å	0.32	0.08	Probable adenylyl-sulfate kinase
5cb6.2.B	26.47	homo-dimer	HHblits	X-ray	2.79Å	0.32	0.08	Probable adenylyl-sulfate kinase
3r9i.1.B	31.25	hetero-oligomer	HHblits	X-ray	2.60Å	0.37	0.07	Septum site-determining protein minD
3q9l.1.A	31.25	homo-dimer	HHblits	X-ray	2.34Å	0.37	0.07	Septum site-determining protein minD
5a4j.1.A	33.33	homo-dimer	HHblits	X-ray	2.15Å	0.35	0.07	FORMATE--TETRAHYDROFOLATE LIGASE
2oze.1.A	23.53	homo-dimer	HHblits	X-ray	1.83Å	0.32	0.08	Orf delta'
3gpl.1.A	30.30	monomer	HHblits	X-ray	2.50Å	0.34	0.07	Exodeoxyribonuclease V, subunit RecD, putative
3gp8.1.A	30.30	monomer	HHblits	X-ray	2.50Å	0.34	0.07	Exodeoxyribonuclease V, subunit RecD, putative
3e1s.1.A	30.30	monomer	HHblits	X-ray	2.20Å	0.34	0.07	Exodeoxyribonuclease V, subunit RecD
2ved.1.A	20.59	homo-octamer	HHblits	X-ray	2.60Å	0.32	0.08	MEMBRANE PROTEIN CAPA1, PROTEIN TYROSINE KINASE
2qq0.1.A	33.33	homo-tetramer	HHblits	X-ray	1.50Å	0.34	0.07	Thymidine kinase
2qpo.1.B	33.33	homo-tetramer	HHblits	X-ray	1.95Å	0.34	0.07	Thymidine kinase
2qpo.1.D	33.33	homo-tetramer	HHblits	X-ray	1.95Å	0.34	0.07	Thymidine kinase
2qpo.1.A	33.33	homo-tetramer	HHblits	X-ray	1.95Å	0.34	0.07	Thymidine kinase
2ph1.1.A	23.53	homo-dimer	HHblits	X-ray	2.70Å	0.32	0.08	Nucleotide-binding protein
3of5.1.A	29.41	homo-dimer	HHblits	X-ray	1.52Å	0.32	0.08	Dethiobiotin synthetase
3k0c.1.B	26.47	homo-hexamer	HHblits	X-ray	3.30Å	0.32	0.08	Circadian clock protein kinase KaiC
3k0c.1.A	26.47	homo-hexamer	HHblits	X-ray	3.30Å	0.32	0.08	Circadian clock protein kinase KaiC
3k0c.1.D	26.47	homo-hexamer	HHblits	X-ray	3.30Å	0.32	0.08	Circadian clock protein kinase KaiC
3k0c.1.F	26.47	homo-hexamer	HHblits	X-ray	3.30Å	0.32	0.08	Circadian clock protein kinase KaiC
4ijm.1.A	26.47	homo-hexamer	HHblits	X-ray	3.35Å	0.32	0.08	Circadian clock protein kinase KaiC
4ijm.1.C	26.47	homo-hexamer	HHblits	X-ray	3.35Å	0.32	0.08	Circadian clock protein kinase KaiC
4ijm.1.F	26.47	homo-hexamer	HHblits	X-ray	3.35Å	0.32	0.08	Circadian clock protein kinase KaiC
3k0e.1.A	26.47	homo-hexamer	HHblits	X-ray	3.20Å	0.32	0.08	Circadian clock protein kinase KaiC
3k0e.1.B	26.47	homo-hexamer	HHblits	X-ray	3.20Å	0.32	0.08	Circadian clock protein kinase KaiC
3k0e.1.C	26.47	homo-hexamer	HHblits	X-ray	3.20Å	0.32	0.08	Circadian clock protein kinase KaiC
3k0e.1.D	26.47	homo-hexamer	HHblits	X-ray	3.20Å	0.32	0.08	Circadian clock protein kinase KaiC
3k0e.1.E	26.47	homo-hexamer	HHblits	X-ray	3.20Å	0.32	0.08	Circadian clock protein kinase KaiC
3k0e.1.F	26.47	homo-hexamer	HHblits	X-ray	3.20Å	0.32	0.08	Circadian clock protein kinase KaiC
3s1a.1.A	26.47	homo-hexamer	HHblits	X-ray	3.00Å	0.32	0.08	Circadian clock protein kinase kaiC
3s1a.1.B	26.47	homo-hexamer	HHblits	X-ray	3.00Å	0.32	0.08	Circadian clock protein kinase kaiC
3s1a.1.E	26.47	homo-hexamer	HHblits	X-ray	3.00Å	0.32	0.08	Circadian clock protein kinase kaiC
3s1a.1.F	26.47	homo-hexamer	HHblits	X-ray	3.00Å	0.32	0.08	Circadian clock protein kinase kaiC
3k09.1.A	26.47	homo-hexamer	HHblits	X-ray	3.20Å	0.32	0.08	Circadian clock protein kinase kaiC
3k09.1.B	26.47	homo-hexamer	HHblits	X-ray	3.20Å	0.32	0.08	Circadian clock protein kinase kaiC
3k09.1.E	26.47	homo-hexamer	HHblits	X-ray	3.20Å	0.32	0.08	Circadian clock protein kinase kaiC
3k09.1.F	26.47	homo-hexamer	HHblits	X-ray	3.20Å	0.32	0.08	Circadian clock protein kinase kaiC
3k0f.1.A	26.47	homo-hexamer	HHblits	X-ray	3.00Å	0.32	0.08	Circadian clock protein kinase KaiC
3k0f.1.B	26.47	homo-hexamer	HHblits	X-ray	3.00Å	0.32	0.08	Circadian clock protein kinase KaiC
3k0f.1.E	26.47	homo-hexamer	HHblits	X-ray	3.00Å	0.32	0.08	Circadian clock protein kinase KaiC
3k0f.1.F	26.47	homo-hexamer	HHblits	X-ray	3.00Å	0.32	0.08	Circadian clock protein kinase KaiC
3dvl.1.A	26.47	homo-hexamer	HHblits	X-ray	2.80Å	0.32	0.08	Circadian clock protein kinase kaiC
3dvl.1.E	26.47	homo-hexamer	HHblits	X-ray	2.80Å	0.32	0.08	Circadian clock protein kinase kaiC
3dvl.1.F	26.47	homo-hexamer	HHblits	X-ray	2.80Å	0.32	0.08	Circadian clock protein kinase kaiC
5n8y.1.E	26.47	hetero-oligomer	HHblits	EM	NA	0.32	0.08	Circadian clock protein kinase KaiC
3fkq.1.A	23.53	homo-dimer	HHblits	X-ray	2.10Å	0.32	0.08	NtrC-like two-domain protein
1f48.1.A	23.53	monomer	HHblits	X-ray	2.30Å	0.32	0.08	ARSENITE-TRANSLOCATING ATPASE
1a7j.1.A	20.59	monomer	HHblits	X-ray	2.50Å	0.31	0.08	PHOSPHORIBULOKINASE
2vo1.1.A	23.53	homo-tetramer	HHblits	X-ray	2.80Å	0.31	0.08	CTP SYNTHASE 1
4wop.1.A	27.27	homo-dimer	HHblits	X-ray	2.39Å	0.34	0.07	ATP-dependent dethiobiotin synthetase BioD
1e9c.1.A	20.59	homo-dimer	HHblits	X-ray	1.60Å	0.31	0.08	THYMIDYLATE KINASE
1dts.1.A	26.47	homo-dimer	HHblits	X-ray	1.65Å	0.31	0.08	DETHIOBIOTIN SYNTHETASE
5tsg.1.A	20.00	homo-hexamer	HHblits	X-ray	3.40Å	0.29	0.08	Type IV pilus biogenesis ATPase PilB
5tsg.1.C	20.00	homo-hexamer	HHblits	X-ray	3.40Å	0.29	0.08	Type IV pilus biogenesis ATPase PilB
5tsh.1.C	20.00	homo-hexamer	HHblits	X-ray	2.30Å	0.29	0.08	Type IV pilus biogenesis ATPase PilB
5tsh.1.B	20.00	homo-hexamer	HHblits	X-ray	2.30Å	0.29	0.08	Type IV pilus biogenesis ATPase PilB
5tsh.1.F	20.00	homo-hexamer	HHblits	X-ray	2.30Å	0.29	0.08	Type IV pilus biogenesis ATPase PilB
2xit.1.A	27.27	homo-dimer	HHblits	X-ray	1.80Å	0.33	0.07	MIPZ
2xj4.1.A	27.27	monomer	HHblits	X-ray	1.60Å	0.33	0.07	MIPZ
2xj9.1.A	27.27	homo-dimer	HHblits	X-ray	2.80Å	0.33	0.07	MIPZ
2xj9.1.B	27.27	homo-dimer	HHblits	X-ray	2.80Å	0.33	0.07	MIPZ
5u1g.1.A	24.24	hetero-oligomer	HHblits	X-ray	3.64Å	0.33	0.07	ParA
5u1g.2.B	24.24	hetero-oligomer	HHblits	X-ray	3.64Å	0.33	0.07	ParA
1ion.1.A	28.13	monomer	HHblits	X-ray	2.30Å	0.36	0.07	PROBABLE CELL DIVISION INHIBITOR MIND
2www.1.A	27.27	homo-dimer	HHblits	X-ray	2.64Å	0.33	0.07	METHYLMALONIC ACIDURIA TYPE A PROTEIN, MITOCHONDRIAL
5bwk.1.A	23.53	hetero-oligomer	HHblits	X-ray	6.00Å	0.31	0.08	ATPase GET3
5bw8.1.B	23.53	hetero-oligomer	HHblits	X-ray	2.80Å	0.31	0.08	ATPase GET3
5bw8.1.A	23.53	hetero-oligomer	HHblits	X-ray	2.80Å	0.31	0.08	ATPase GET3
3a37.1.A	23.53	homo-dimer	HHblits	X-ray	3.00Å	0.31	0.08	ATPase GET3
3b2e.1.A	23.53	hetero-oligomer	HHblits	X-ray	3.00Å	0.31	0.08	ATPase GET3
3b2e.1.C	23.53	hetero-oligomer	HHblits	X-ray	3.00Å	0.31	0.08	ATPase GET3
3b2e.2.C	23.53	hetero-oligomer	HHblits	X-ray	3.00Å	0.31	0.08	ATPase GET3
3b2e.2.A	23.53	hetero-oligomer	HHblits	X-ray	3.00Å	0.31	0.08	ATPase GET3
1g3r.1.A	31.25	monomer	HHblits	X-ray	2.70Å	0.35	0.07	CELL DIVISION INHIBITOR
1g20.1.E	28.13	hetero-oligomer	HHblits	X-ray	2.20Å	0.35	0.07	NITROGENASE IRON PROTEIN
1g21.1.H	28.13	hetero-oligomer	HHblits	X-ray	3.00Å	0.35	0.07	NITROGENASE IRON PROTEIN
1g21.1.E	28.13	hetero-oligomer	HHblits	X-ray	3.00Å	0.35	0.07	NITROGENASE IRON PROTEIN
4wzb.1.F	28.13	hetero-oligomer	HHblits	X-ray	2.30Å	0.35	0.07	Nitrogenase iron protein 1
4wzb.1.E	28.13	hetero-oligomer	HHblits	X-ray	2.30Å	0.35	0.07	Nitrogenase iron protein 1
2f1r.1.A	35.48	homo-dimer	HHblits	X-ray	2.10Å	0.38	0.07	molybdopterin-guanine dinucleotide biosynthesis protein B (mobB)
2f1r.1.B	35.48	homo-dimer	HHblits	X-ray	2.10Å	0.38	0.07	molybdopterin-guanine dinucleotide biosynthesis protein B (mobB)
4jim.1.A	27.27	homo-dimer	HHblits	X-ray	2.10Å	0.33	0.07	Formate--tetrahydrofolate ligase
4jjz.1.A	27.27	homo-dimer	HHblits	X-ray	2.50Å	0.33	0.07	Formate--tetrahydrofolate ligase
1eg7.1.A	27.27	homo-tetramer	HHblits	X-ray	2.50Å	0.33	0.07	FORMYLTETRAHYDROFOLATE SYNTHETASE
1fp7.1.A	27.27	homo-tetramer	HHblits	X-ray	3.20Å	0.33	0.07	FORMATE--TETRAHYDROFOLATE LIGASE
3qus.1.A	27.27	homo-dimer	HHblits	X-ray	2.84Å	0.33	0.07	Formate--tetrahydrofolate ligase
4rz3.1.A	23.53	homo-dimer	HHblits	X-ray	1.90Å	0.30	0.08	Site-determining protein
4rz3.1.B	23.53	homo-dimer	HHblits	X-ray	1.90Å	0.30	0.08	Site-determining protein
3nva.1.A	23.53	homo-dimer	HHblits	X-ray	2.50Å	0.30	0.08	CTP synthase
1rw4.1.A	28.13	homo-dimer	HHblits	X-ray	2.50Å	0.35	0.07	Nitrogenase iron protein 1
3mle.1.A	37.50	homo-dimer	HHblits	X-ray	2.80Å	0.35	0.07	Dethiobiotin synthetase
3kb1.1.A	20.59	homo-dimer	HHblits	X-ray	2.90Å	0.30	0.08	Nucleotide-binding protein
2woo.1.A	20.59	homo-dimer	HHblits	X-ray	3.01Å	0.30	0.08	ATPASE GET3
4gmd.1.B	20.59	homo-dimer	HHblits	X-ray	1.98Å	0.30	0.08	Thymidylate kinase
4gmd.1.A	20.59	homo-dimer	HHblits	X-ray	1.98Å	0.30	0.08	Thymidylate kinase
4edh.1.A	20.59	homo-dimer	HHblits	X-ray	1.32Å	0.30	0.08	Thymidylate kinase
4e5u.1.A	20.59	homo-dimer	HHblits	X-ray	1.81Å	0.30	0.08	Thymidylate kinase
4e5u.1.B	20.59	homo-dimer	HHblits	X-ray	1.81Å	0.30	0.08	Thymidylate kinase
3czq.1.A	11.11	homo-tetramer	HHblits	X-ray	2.23Å	0.25	0.08	Putative polyphosphate kinase 2
1dah.1.A	27.27	homo-dimer	HHblits	X-ray	1.64Å	0.32	0.07	DETHIOBIOTIN SYNTHETASE
1byi.1.A	27.27	homo-dimer	HHblits	X-ray	0.97Å	0.32	0.07	DETHIOBIOTIN SYNTHASE
4rz2.1.A	20.59	monomer	HHblits	X-ray	2.80Å	0.29	0.08	Site-determining protein
1mrn.1.A	21.21	homo-dimer	HHblits	X-ray	2.45Å	0.32	0.07	Thymidylate Kinase
1w2h.1.A	21.21	homo-dimer	HHblits	X-ray	2.00Å	0.32	0.07	THYMIDYLATE KINASE TMK
4e07.1.A	25.00	monomer	HHblits	X-ray	2.90Å	0.34	0.07	Plasmid partitioning protein ParF
4e09.1.A	25.00	homo-dimer	HHblits	X-ray	2.99Å	0.34	0.07	Plasmid partitioning protein ParF
4e03.1.A	25.00	monomer	HHblits	X-ray	2.45Å	0.34	0.07	Plasmid partitioning protein ParF
4e03.2.A	25.00	monomer	HHblits	X-ray	2.45Å	0.34	0.07	Plasmid partitioning protein ParF
4dzz.1.A	25.00	monomer	HHblits	X-ray	1.80Å	0.34	0.07	Plasmid partitioning protein ParF
4dzz.2.A	25.00	monomer	HHblits	X-ray	1.80Å	0.34	0.07	Plasmid partitioning protein ParF
2yof.1.A	24.24	monomer	HHblits	X-ray	1.82Å	0.31	0.07	THYMIDYLATE KINASE
2yof.3.A	24.24	monomer	HHblits	X-ray	1.82Å	0.31	0.07	THYMIDYLATE KINASE
2yog.1.A	24.24	monomer	HHblits	X-ray	1.50Å	0.31	0.07	THYMIDYLATE KINASE
2yog.2.A	24.24	monomer	HHblits	X-ray	1.50Å	0.31	0.07	THYMIDYLATE KINASE
2wwg.2.B	24.24	homo-dimer	HHblits	X-ray	2.40Å	0.31	0.07	THYMIDILATE KINASE, PUTATIVE
2wwg.2.A	24.24	homo-dimer	HHblits	X-ray	2.40Å	0.31	0.07	THYMIDILATE KINASE, PUTATIVE
1hyq.1.A	18.18	monomer	HHblits	X-ray	2.60Å	0.31	0.07	CELL DIVISION INHIBITOR (MIND-1)
3c8u.1.A	18.18	monomer	HHblits	X-ray	1.95Å	0.31	0.07	Fructokinase
1e98.1.A	21.21	homo-dimer	HHblits	X-ray	1.90Å	0.31	0.07	THYMIDYLATE KINASE
1e2e.1.A	21.21	homo-dimer	HHblits	X-ray	2.00Å	0.31	0.07	THYMIDYLATE KINASE
1nmy.1.A	21.21	monomer	HHblits	X-ray	1.60Å	0.31	0.07	similar to THYMIDYLATE KINASE (DTMP KINASE)
1xnj.1.B	27.27	homo-dimer	HHblits	X-ray	1.98Å	0.31	0.07	Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthetase 1
1xnj.1.A	27.27	homo-dimer	HHblits	X-ray	1.98Å	0.31	0.07	Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthetase 1
2pey.1.A	24.24	homo-dimer	HHblits	X-ray	1.88Å	0.31	0.07	Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthetase 1 (PAPS synthetase 1) (PAPSS 1) (Sulfurylase kinase 1) (SK1) (SK 1)
2pey.1.B	24.24	homo-dimer	HHblits	X-ray	1.88Å	0.31	0.07	Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthetase 1 (PAPS synthetase 1) (PAPSS 1) (Sulfurylase kinase 1) (SK1) (SK 1)
1k6m.1.A	21.21	homo-dimer	HHblits	X-ray	2.40Å	0.31	0.07	6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 2-phosphatase
3uwk.1.A	21.21	monomer	HHblits	X-ray	1.91Å	0.30	0.07	Thymidylate kinase
3n2i.1.A	21.21	homo-dimer	HHblits	X-ray	2.25Å	0.30	0.07	Thymidylate kinase
3ihl.1.A	25.00	homo-tetramer	HHblits	X-ray	2.80Å	0.32	0.07	CTP synthase 2
3ihl.1.B	25.00	homo-tetramer	HHblits	X-ray	2.80Å	0.32	0.07	CTP synthase 2
2yvu.1.A	32.26	homo-dimer	HHblits	X-ray	2.10Å	0.35	0.07	Probable adenylyl-sulfate kinase
2yvu.1.B	32.26	homo-dimer	HHblits	X-ray	2.10Å	0.35	0.07	Probable adenylyl-sulfate kinase
4unq.1.A	21.88	monomer	HHblits	X-ray	2.30Å	0.32	0.07	THYMIDYLATE KINASE
4unq.2.A	21.88	monomer	HHblits	X-ray	2.30Å	0.32	0.07	THYMIDYLATE KINASE
4unp.1.A	21.88	monomer	HHblits	X-ray	2.30Å	0.32	0.07	THYMIDYLATE KINASE
4wia.1.A	11.76	homo-trimer	HHblits	X-ray	2.20Å	0.27	0.08	Putative flagella-related protein H
3ea0.1.A	11.76	homo-dimer	HHblits	X-ray	2.20Å	0.27	0.08	ATPase, ParA family
3ea0.1.B	11.76	homo-dimer	HHblits	X-ray	2.20Å	0.27	0.08	ATPase, ParA family
4rfv.1.A	32.26	homo-dimer	HHblits	X-ray	1.69Å	0.34	0.07	Bifunctional enzyme CysN/CysC
1f48.1.A	24.24	monomer	HHblits	X-ray	2.30Å	0.29	0.07	ARSENITE-TRANSLOCATING ATPASE
4ohv.1.A	15.15	monomer	HHblits	X-ray	2.30Å	0.29	0.07	Protein clpf-1
4bzq.1.A	32.26	homo-dimer	HHblits	X-ray	2.10Å	0.34	0.07	BIFUNCTIONAL ENZYME CYSN/CYSC
3pg5.1.A	18.75	monomer	HHblits	X-ray	3.30Å	0.31	0.07	Uncharacterized protein
3pg5.2.A	18.75	monomer	HHblits	X-ray	3.30Å	0.31	0.07	Uncharacterized protein
3pg5.3.A	18.75	monomer	HHblits	X-ray	3.30Å	0.31	0.07	Uncharacterized protein
3pg5.4.A	18.75	monomer	HHblits	X-ray	3.30Å	0.31	0.07	Uncharacterized protein
3uxm.1.A	21.88	monomer	HHblits	X-ray	1.95Å	0.31	0.07	Thymidylate kinase
3uxm.2.A	21.88	monomer	HHblits	X-ray	1.95Å	0.31	0.07	Thymidylate kinase
3ug7.1.A	21.21	homo-tetramer	HHblits	X-ray	2.90Å	0.28	0.07	arsenical pump-driving ATPase
3ug6.1.A	21.21	homo-tetramer	HHblits	X-ray	3.30Å	0.28	0.07	arsenical pump-driving ATPase
5lnk.1.Y	21.88	hetero-oligomer	HHblits	EM	3.90Å	0.31	0.07	Mitochondrial complex I, 42 kDa subunit
2qmo.1.A	40.00	homo-dimer	HHblits	X-ray	1.47Å	0.36	0.07	Dethiobiotin synthetase
1p9r.1.A	25.00	monomer	HHblits	X-ray	2.50Å	0.31	0.07	General secretion pathway protein E
3uwo.1.A	21.88	monomer	HHblits	X-ray	1.70Å	0.30	0.07	Thymidylate kinase
2ofx.1.A	25.00	homo-dimer	HHblits	X-ray	1.90Å	0.30	0.07	Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthetase 1
4hut.1.A	18.75	homo-dimer	HHblits	X-ray	1.95Å	0.30	0.07	Cob(I)yrinic acid a,c-diamide adenosyltransferase
4hut.1.B	18.75	homo-dimer	HHblits	X-ray	1.95Å	0.30	0.07	Cob(I)yrinic acid a,c-diamide adenosyltransferase
5xb5.1.A	30.00	homo-dimer	HHblits	X-ray	2.23Å	0.35	0.07	Thymidylate kinase
5xbh.1.A	30.00	homo-dimer	HHblits	X-ray	2.23Å	0.35	0.07	Thymidylate kinase
3a4l.1.A	22.58	homo-dimer	HHblits	X-ray	1.80Å	0.32	0.07	L-seryl-tRNA(Sec) kinase
3a4l.1.B	22.58	homo-dimer	HHblits	X-ray	1.80Å	0.32	0.07	L-seryl-tRNA(Sec) kinase
3am1.1.C	22.58	homo-dimer	HHblits	X-ray	2.40Å	0.32	0.07	L-seryl-tRNA(Sec) kinase
4unn.1.A	22.58	monomer	HHblits	X-ray	2.50Å	0.32	0.07	THYMIDYLATE KINASE
3hjn.1.A	30.00	homo-dimer	HHblits	X-ray	2.10Å	0.35	0.07	Thymidylate kinase
3hjn.1.B	30.00	homo-dimer	HHblits	X-ray	2.10Å	0.35	0.07	Thymidylate kinase
5bq5.1.A	21.88	monomer	HHblits	X-ray	2.10Å	0.29	0.07	Insertion sequence IS5376 putative ATP-binding protein
2w58.1.A	22.58	homo-dimer	HHblits	X-ray	2.50Å	0.31	0.07	PRIMOSOME COMPONENT (HELICASE LOADER)
2w58.1.B	22.58	homo-dimer	HHblits	X-ray	2.50Å	0.31	0.07	PRIMOSOME COMPONENT (HELICASE LOADER)
4bzp.1.A	33.33	homo-dimer	HHblits	X-ray	1.47Å	0.34	0.07	BIFUNCTIONAL ENZYME CYSN/CYSC
2ofw.1.B	22.58	homo-dimer	HHblits	X-ray	2.05Å	0.31	0.07	APS kinase domain of the PAPS synthetase 1
2ofw.1.A	22.58	homo-dimer	HHblits	X-ray	2.05Å	0.31	0.07	APS kinase domain of the PAPS synthetase 1
1de0.1.A	31.03	homo-dimer	HHblits	X-ray	2.40Å	0.36	0.06	NITROGENASE IRON PROTEIN
1xcp.1.A	31.03	homo-dimer	HHblits	X-ray	3.20Å	0.36	0.06	Nitrogenase iron protein 1
1xcp.2.A	31.03	homo-dimer	HHblits	X-ray	3.20Å	0.36	0.06	Nitrogenase iron protein 1
1m34.1.E	31.03	hetero-oligomer	HHblits	X-ray	2.30Å	0.36	0.06	Nitrogenase Iron Protein 1
1m1y.1.E	31.03	hetero-oligomer	HHblits	X-ray	3.20Å	0.36	0.06	nitrogenase IRON protein 1
1m1y.1.F	31.03	hetero-oligomer	HHblits	X-ray	3.20Å	0.36	0.06	nitrogenase IRON protein 1
2afi.1.E	31.03	hetero-oligomer	HHblits	X-ray	3.10Å	0.36	0.06	Nitrogenase iron protein 1
2afh.1.E	31.03	hetero-oligomer	HHblits	X-ray	2.10Å	0.36	0.06	Nitrogenase iron protein 1
2afh.1.F	31.03	hetero-oligomer	HHblits	X-ray	2.10Å	0.36	0.06	Nitrogenase iron protein 1
1g5p.1.A	31.03	homo-dimer	HHblits	X-ray	2.20Å	0.36	0.06	NITROGENASE IRON PROTEIN
1g5p.1.B	31.03	homo-dimer	HHblits	X-ray	2.20Å	0.36	0.06	NITROGENASE IRON PROTEIN
1g1m.1.A	31.03	homo-dimer	HHblits	X-ray	2.25Å	0.36	0.06	NITROGENASE IRON PROTEIN
1g1m.1.B	31.03	homo-dimer	HHblits	X-ray	2.25Å	0.36	0.06	NITROGENASE IRON PROTEIN
1fp6.1.A	31.03	homo-dimer	HHblits	X-ray	2.15Å	0.36	0.06	NITROGENASE IRON PROTEIN
1nip.1.A	31.03	homo-dimer	HHblits	X-ray	2.90Å	0.36	0.06	NITROGENASE IRON PROTEIN
1nip.1.B	31.03	homo-dimer	HHblits	X-ray	2.90Å	0.36	0.06	NITROGENASE IRON PROTEIN
2ax4.1.A	25.81	homo-dimer	HHblits	X-ray	2.50Å	0.30	0.07	Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthetase 2
2pbr.1.B	27.59	homo-dimer	HHblits	X-ray	1.96Å	0.35	0.06	Thymidylate kinase
2pbr.1.A	27.59	homo-dimer	HHblits	X-ray	1.96Å	0.35	0.06	Thymidylate kinase
4s35.1.B	27.59	homo-dimer	HHblits	X-ray	1.55Å	0.35	0.06	Thymidylate kinase
5xb2.1.B	27.59	homo-dimer	HHblits	X-ray	2.16Å	0.35	0.06	Thymidylate kinase
5xtc.1.2	16.13	hetero-oligomer	HHblits	EM	NA	0.29	0.07	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial
4pfs.1.A	23.33	monomer	HHblits	X-ray	2.30Å	0.32	0.07	Cobyrinic Acid a,c-diamide synthase
4pfs.2.A	23.33	monomer	HHblits	X-ray	2.30Å	0.32	0.07	Cobyrinic Acid a,c-diamide synthase
5if9.1.A	23.33	monomer	HHblits	X-ray	1.80Å	0.32	0.07	Cobyrinic Acid a,c-diamide synthase
1nks.1.C	26.67	homo-trimer	HHblits	X-ray	2.57Å	0.32	0.07	ADENYLATE KINASE
1nks.1.B	26.67	homo-trimer	HHblits	X-ray	2.57Å	0.32	0.07	ADENYLATE KINASE
1nks.1.A	26.67	homo-trimer	HHblits	X-ray	2.57Å	0.32	0.07	ADENYLATE KINASE
2kjq.1.A	20.00	monomer	HHblits	NMR	NA	0.31	0.07	DnaA-related protein
1ki9.1.A	26.67	homo-trimer	HHblits	X-ray	2.76Å	0.31	0.07	adenylate kinase
1ki9.1.B	26.67	homo-trimer	HHblits	X-ray	2.76Å	0.31	0.07	adenylate kinase
1ki9.1.C	26.67	homo-trimer	HHblits	X-ray	2.76Å	0.31	0.07	adenylate kinase
3iqx.1.A	35.71	homo-dimer	HHblits	X-ray	3.50Å	0.36	0.06	Tail-anchored protein targeting factor Get3
3uie.1.A	28.57	homo-dimer	HHblits	X-ray	1.79Å	0.35	0.06	Adenylyl-sulfate kinase 1, chloroplastic
1xdb.1.A	28.57	homo-dimer	HHblits	X-ray	2.80Å	0.35	0.06	Nitrogenase iron protein 1
4wza.1.E	28.57	hetero-oligomer	HHblits	X-ray	1.90Å	0.35	0.06	Nitrogenase iron protein 1
4wza.1.F	28.57	hetero-oligomer	HHblits	X-ray	1.90Å	0.35	0.06	Nitrogenase iron protein 1
1xd9.1.A	28.57	homo-dimer	HHblits	X-ray	2.80Å	0.35	0.06	Nitrogenase iron protein 1
2c8v.1.A	28.57	monomer	HHblits	X-ray	2.50Å	0.35	0.06	NITROGENASE IRON PROTEIN 1
4kss.1.A	27.59	homo-hexamer	HHblits	X-ray	7.58Å	0.32	0.06	Type II secretion system protein E, hemolysin-coregulated protein
4kss.1.B	27.59	homo-hexamer	HHblits	X-ray	7.58Å	0.32	0.06	Type II secretion system protein E, hemolysin-coregulated protein
4kss.1.C	27.59	homo-hexamer	HHblits	X-ray	7.58Å	0.32	0.06	Type II secretion system protein E, hemolysin-coregulated protein
4kss.1.D	27.59	homo-hexamer	HHblits	X-ray	7.58Å	0.32	0.06	Type II secretion system protein E, hemolysin-coregulated protein
4kss.1.E	27.59	homo-hexamer	HHblits	X-ray	7.58Å	0.32	0.06	Type II secretion system protein E, hemolysin-coregulated protein
4kss.1.F	27.59	homo-hexamer	HHblits	X-ray	7.58Å	0.32	0.06	Type II secretion system protein E, hemolysin-coregulated protein
3h84.1.A	28.57	homo-dimer	HHblits	X-ray	2.30Å	0.34	0.06	ATPase GET3
3h84.1.B	28.57	homo-dimer	HHblits	X-ray	2.30Å	0.34	0.06	ATPase GET3
2woj.1.A	28.57	homo-dimer	HHblits	X-ray	1.99Å	0.34	0.06	ATPASE GET3
2woj.1.B	28.57	homo-dimer	HHblits	X-ray	1.99Å	0.34	0.06	ATPASE GET3
3zs9.1.A	28.57	hetero-oligomer	HHblits	X-ray	2.10Å	0.34	0.06	ATPASE GET3
3zs8.1.A	28.57	hetero-oligomer	HHblits	X-ray	3.00Å	0.34	0.06	ATPASE GET3
3zs8.1.B	28.57	hetero-oligomer	HHblits	X-ray	3.00Å	0.34	0.06	ATPASE GET3
2v54.1.A	16.67	homo-dimer	HHblits	X-ray	2.40Å	0.29	0.07	THYMIDYLATE KINASE
2eyu.1.A	29.63	monomer	HHblits	X-ray	1.87Å	0.36	0.06	twitching motility protein PilT
2eyu.2.A	29.63	monomer	HHblits	X-ray	1.87Å	0.36	0.06	twitching motility protein PilT
2eww.1.A	29.63	homo-hexamer	HHblits	X-ray	3.20Å	0.36	0.06	twitching motility protein PilT
3igf.1.A	24.14	homo-dimer	HHblits	X-ray	2.00Å	0.31	0.06	All4481 protein
3igf.1.B	24.14	homo-dimer	HHblits	X-ray	2.00Å	0.31	0.06	All4481 protein
3upu.1.A	28.57	monomer	HHblits	X-ray	3.30Å	0.33	0.06	ATP-dependent DNA helicase dda
3upu.3.A	28.57	monomer	HHblits	X-ray	3.30Å	0.33	0.06	ATP-dependent DNA helicase dda
2xzl.1.A	33.33	monomer	HHblits	X-ray	2.40Å	0.35	0.06	ATP-DEPENDENT HELICASE NAM7
1kht.1.A	33.33	homo-trimer	HHblits	X-ray	2.50Å	0.34	0.06	adenylate kinase
1kht.1.B	33.33	homo-trimer	HHblits	X-ray	2.50Å	0.34	0.06	adenylate kinase
1kht.1.C	33.33	homo-trimer	HHblits	X-ray	2.50Å	0.34	0.06	adenylate kinase
1cp2.1.A	28.57	homo-dimer	HHblits	X-ray	1.93Å	0.31	0.06	NITROGENASE IRON PROTEIN
1cp2.1.B	28.57	homo-dimer	HHblits	X-ray	1.93Å	0.31	0.06	NITROGENASE IRON PROTEIN
3tqc.1.A	38.46	homo-dimer	HHblits	X-ray	2.30Å	0.37	0.06	Pantothenate kinase
3h86.2.A	29.63	homo-trimer	HHblits	X-ray	2.50Å	0.34	0.06	Adenylate kinase
3h86.1.B	29.63	homo-trimer	HHblits	X-ray	2.50Å	0.34	0.06	Adenylate kinase
3h86.1.C	29.63	homo-trimer	HHblits	X-ray	2.50Å	0.34	0.06	Adenylate kinase
3h86.1.A	29.63	homo-trimer	HHblits	X-ray	2.50Å	0.34	0.06	Adenylate kinase
2xzp.1.A	33.33	homo-trimer	HHblits	X-ray	2.72Å	0.34	0.06	REGULATOR OF NONSENSE TRANSCRIPTS 1
2xzo.1.A	33.33	monomer	HHblits	X-ray	2.39Å	0.34	0.06	REGULATOR OF NONSENSE TRANSCRIPTS 1
2plr.1.A	17.86	homo-dimer	HHblits	X-ray	1.60Å	0.30	0.06	Probable thymidylate kinase
2plr.1.B	17.86	homo-dimer	HHblits	X-ray	1.60Å	0.30	0.06	Probable thymidylate kinase
4rzu.1.A	17.86	homo-dimer	HHblits	X-ray	2.80Å	0.30	0.06	Probable thymidylate kinase
4rzu.1.B	17.86	homo-dimer	HHblits	X-ray	2.80Å	0.30	0.06	Probable thymidylate kinase
4rzx.1.B	17.86	homo-dimer	HHblits	X-ray	2.30Å	0.30	0.06	Probable thymidylate kinase
3kjg.2.A	25.93	homo-dimer	HHblits	X-ray	2.30Å	0.33	0.06	CO dehydrogenase/acetyl-CoA synthase complex, accessory protein CooC
3kjg.1.A	25.93	monomer	HHblits	X-ray	2.30Å	0.33	0.06	CO dehydrogenase/acetyl-CoA synthase complex, accessory protein CooC
3kji.1.A	25.93	homo-dimer	HHblits	X-ray	2.13Å	0.33	0.06	CO dehydrogenase/acetyl-CoA synthase complex, accessory protein CooC
3kji.2.A	25.93	homo-dimer	HHblits	X-ray	2.13Å	0.33	0.06	CO dehydrogenase/acetyl-CoA synthase complex, accessory protein CooC
3kjh.1.A	25.93	homo-dimer	HHblits	X-ray	1.90Å	0.33	0.06	CO dehydrogenase/acetyl-CoA synthase complex, accessory protein CooC
3kje.1.A	25.93	monomer	HHblits	X-ray	2.30Å	0.33	0.06	CO dehydrogenase/acetyl-CoA synthase complex, accessory protein CooC
1tmk.1.A	36.00	homo-dimer	HHblits	X-ray	2.10Å	0.37	0.06	THYMIDYLATE KINASE
3tmk.1.A	36.00	homo-dimer	HHblits	X-ray	2.00Å	0.37	0.06	THYMIDYLATE KINASE
3tmk.1.B	36.00	homo-dimer	HHblits	X-ray	2.00Å	0.37	0.06	THYMIDYLATE KINASE
4pht.1.B	29.63	hetero-oligomer	HHblits	X-ray	2.83Å	0.31	0.06	General secretory pathway protein E
2pzf.1.A	19.23	monomer	HHblits	X-ray	2.00Å	0.33	0.06	Cystic fibrosis transmembrane conductance regulator
2i3b.1.A	30.77	monomer	HHblits	NMR	NA	0.33	0.06	Human Cancer-Related NTPase
4ksr.1.A	30.77	homo-hexamer	HHblits	X-ray	4.20Å	0.32	0.06	Type II secretion system protein E, Hemolysin-coregulated protein
4ksr.1.B	30.77	homo-hexamer	HHblits	X-ray	4.20Å	0.32	0.06	Type II secretion system protein E, Hemolysin-coregulated protein
4ksr.1.C	30.77	homo-hexamer	HHblits	X-ray	4.20Å	0.32	0.06	Type II secretion system protein E, Hemolysin-coregulated protein
4ba6.1.A	11.11	monomer	HHblits	X-ray	1.42Å	0.27	0.06	ENDOGLUCANASE CEL5A
5afe.1.A	11.11	monomer	HHblits	X-ray	2.60Å	0.27	0.06	ENDOGLUCANASE CEL5A
1q3t.1.A	29.17	monomer	HHblits	NMR	NA	0.36	0.05	Cytidylate kinase
2p65.1.A	20.00	monomer	HHblits	X-ray	1.70Å	0.32	0.06	Hypothetical protein PF08_0063
4ypn.1.A	20.00	monomer	HHblits	X-ray	2.07Å	0.31	0.06	Lon protease
3lnc.1.A	24.00	homo-dimer	HHblits	X-ray	1.95Å	0.31	0.06	Guanylate kinase
2bdt.1.A	39.13	homo-dimer	HHblits	X-ray	2.40Å	0.37	0.05	BH3686
2ypj.1.A	11.54	monomer	HHblits	X-ray	2.35Å	0.27	0.06	ENDOGLUCANASE CEL5A
2qor.1.A	24.00	monomer	HHblits	X-ray	1.80Å	0.30	0.06	Guanylate kinase
4e22.1.A	20.83	monomer	HHblits	X-ray	2.32Å	0.33	0.05	Cytidylate kinase
1s96.1.A	7.69	homo-dimer	HHblits	X-ray	2.00Å	0.26	0.06	Guanylate kinase
4y0a.1.A	30.43	monomer	HHblits	X-ray	1.91Å	0.35	0.05	Shikimate kinase
1kgd.1.A	12.00	monomer	HHblits	X-ray	1.31Å	0.27	0.06	PERIPHERAL PLASMA MEMBRANE CASK
3ch4.1.A	20.83	monomer	HHblits	X-ray	1.76Å	0.31	0.05	Phosphomevalonate kinase
3hr7.1.A	20.83	homo-dimer	HHblits	X-ray	1.80Å	0.30	0.05	Shikimate kinase
3hr7.1.B	20.83	homo-dimer	HHblits	X-ray	1.80Å	0.30	0.05	Shikimate kinase
1zui.1.A	20.83	monomer	HHblits	X-ray	2.30Å	0.30	0.05	Shikimate kinase
1zuh.1.A	20.83	monomer	HHblits	X-ray	1.80Å	0.30	0.05	Shikimate kinase
3muf.1.A	20.83	monomer	HHblits	X-ray	2.30Å	0.30	0.05	Shikimate kinase
3t61.1.A	12.50	homo-dimer	HHblits	X-ray	2.20Å	0.30	0.05	Gluconokinase
1kag.1.A	21.74	monomer	HHblits	X-ray	2.05Å	0.32	0.05	Shikimate kinase I
1kag.2.A	21.74	monomer	HHblits	X-ray	2.05Å	0.32	0.05	Shikimate kinase I
4qrh.1.B	21.74	homo-dimer	HHblits	X-ray	1.65Å	0.32	0.05	Guanylate kinase
4qrh.1.A	21.74	homo-dimer	HHblits	X-ray	1.65Å	0.32	0.05	Guanylate kinase
1xex.1.A	27.27	hetero-oligomer	HHblits	X-ray	2.50Å	0.34	0.05	SMC protein
1xew.1.A	27.27	hetero-oligomer	HHblits	X-ray	2.00Å	0.34	0.05	SMC protein
3kta.1.A	27.27	hetero-oligomer	HHblits	X-ray	1.63Å	0.34	0.05	Chromosome segregation protein smc
3kta.2.A	27.27	hetero-oligomer	HHblits	X-ray	1.63Å	0.34	0.05	Chromosome segregation protein smc
3mrs.1.A	21.74	monomer	HHblits	X-ray	2.40Å	0.30	0.05	Shikimate kinase
3ney.2.A	17.39	monomer	HHblits	X-ray	2.26Å	0.30	0.05	55 kDa erythrocyte membrane protein
3ney.1.A	17.39	monomer	HHblits	X-ray	2.26Å	0.30	0.05	55 kDa erythrocyte membrane protein
2pt5.2.A	33.33	monomer	HHblits	X-ray	2.10Å	0.35	0.05	Shikimate kinase
2pt5.1.A	33.33	monomer	HHblits	X-ray	2.10Å	0.35	0.05	Shikimate kinase
2pt5.3.A	33.33	monomer	HHblits	X-ray	2.10Å	0.35	0.05	Shikimate kinase
2pt5.4.A	33.33	monomer	HHblits	X-ray	2.10Å	0.35	0.05	Shikimate kinase
3hdt.1.A	17.39	homo-dimer	HHblits	X-ray	2.79Å	0.28	0.05	putative kinase
3hdt.1.B	17.39	homo-dimer	HHblits	X-ray	2.79Å	0.28	0.05	putative kinase
4aek.1.A	8.33	monomer	HHblits	X-ray	1.75Å	0.24	0.05	ENDOGLUCANASE CEL5A
4aem.1.A	8.33	monomer	HHblits	X-ray	2.10Å	0.24	0.05	ENDOGLUCANASE CEL5A
2j41.1.B	18.18	homo-dimer	HHblits	X-ray	1.90Å	0.30	0.05	GUANYLATE KINASE
2j41.1.A	18.18	homo-dimer	HHblits	X-ray	1.90Å	0.30	0.05	GUANYLATE KINASE
4afd.1.A	9.09	monomer	HHblits	X-ray	1.34Å	0.25	0.05	ENDOGLUCANASE CEL5A