SWISS-MODEL | Workspace | Model Results

SWISS-MODEL Homology Modelling Report

Model Building Report

This document lists the results for the homology modelling project "C7VBN9" submitted to SWISS-MODEL workspace on Oct. 17, 2017, 7:11 p.m..The submitted primary amino acid sequence is given in Table T1.

If you use any results in your research, please cite the relevant publications:

Marco Biasini; Stefan Bienert; Andrew Waterhouse; Konstantin Arnold; Gabriel Studer; Tobias Schmidt; Florian Kiefer; Tiziano Gallo Cassarino; Martino Bertoni; Lorenza Bordoli; Torsten Schwede. (2014). SWISS-MODEL: modelling protein tertiary and quaternary structure using evolutionary information. Nucleic Acids Research (1 July 2014) 42 (W1): W252-W258; doi: 10.1093/nar/gku340.
Arnold, K., Bordoli, L., Kopp, J. and Schwede, T. (2006) The SWISS-MODEL workspace: a web-based environment for protein structure homology modelling. Bioinformatics, 22, 195-201.
Benkert, P., Biasini, M. and Schwede, T. (2011) Toward the estimation of the absolute quality of individual protein structure models. Bioinformatics, 27, 343-350

Results

The SWISS-MODEL template library (SMTL version 2017-10-11, PDB release 2017-10-06) was searched with Blast (Altschul et al., 1997) and HHBlits (Remmert, et al., 2011) for evolutionary related structures matching the target sequence in Table T1. For details on the template search, see Materials and Methods. Overall 1084 templates were found (Table T2).

Models

The following models were built (see Materials and Methods "Model Building"):

Model #01	File	Built with	Oligo-State	Ligands	GMQE	QMEAN
	PDB	ProMod3 Version 1.0.2.	homo-dimer (matching prediction)	1 x DGL: D-GLUTAMIC ACID; 1 x GLU: GLUTAMIC ACID;	0.98	-0.81

QMEAN	-0.81
Cβ	2.37
All Atom	1.99
Solvation	1.25
Torsion	-1.47

Template	Seq Identity	Oligo-state	Found by	Method	Resolution	Seq Similarity	Range	Coverage	Description
2jfo.1.B	99.64	homo-dimer	BLAST	X-ray	2.50Å	0.60	4 - 270	1.00	GLUTAMATE RACEMASE

Ligand	Added to Model	Description
DGL	✓	D-GLUTAMIC ACID
GLU	✓	GLUTAMIC ACID

Target    MRMSNQEAIGLIDSGVGGLTVLKEALKQLPNERLIYLGDTARCPYGPRPAEQVVQFTWEMADFLLKKRIKMLVIACNTAT
2jfo.1.B  -HMSNQEAIGLIDSGVGGLTVLKEALKQLPNERLIYLGDTARCPYGPRPAEQVVQFTWEMADFLLKKRIKMLVIACNTAT

Target    AVALEEIKAALPIPVVGVILPGARAAVKVTKNNKIGVIGTLGTIKSASYEIAIKSKAPAIEVTSLACPKFVPIVESNQYR
2jfo.1.B  AVALEEIKAALPIPVVGVILPGARAAVKVTKNNKIGVIGTLGTIKSASYEIAIKSKAPAIEVTSLACPKFVPIVESNQYR

Target    SSVAKKIVAETLQALQLKGLDTLILGCTHYPLLRPVIQNVMGSHVTLIDSGAETVGEVSMLLDYFDIAHTPEAPTQPHEF
2jfo.1.B  SSVAKKIVAETLQALQLKGLDTLILGCTHYPLLRPVIQNVMGSHVTLIDSGAETVGEVSMLLDYFDIAHTPEAPTQPHEF

Target    YTTGSAKMFEEIASSWLGIENLKAQQIHLGGNEND
2jfo.1.B  YTTGSAKMFEEIASSWLGIENLKAQQIHLGGNEND

Model #02	File	Built with	Oligo-State	Ligands	GMQE	QMEAN
	PDB	ProMod3 Version 1.0.2.	MONOMER (matching prediction)	None	0.13	-3.07

QMEAN	-3.07
Cβ	-2.85
All Atom	-1.94
Solvation	-0.72
Torsion	-2.08

Template	Seq Identity	Oligo-state	Found by	Method	Resolution	Seq Similarity	Range	Coverage	Description
3hbl.1.C	13.04	homo-tetramer	HHblits	X-ray	2.71Å	0.27		0.33	Pyruvate carboxylase

Ligand	Added to Model	Description
ADP	✕ - Binding site not conserved.	ADENOSINE-5'-DIPHOSPHATE
BTI	✕ - Binding site not conserved.	5-(HEXAHYDRO-2-OXO-1H-THIENO[3,4-D]IMIDAZOL-6-YL)PENTANAL
BTI	✕ - Binding site not conserved.	5-(HEXAHYDRO-2-OXO-1H-THIENO[3,4-D]IMIDAZOL-6-YL)PENTANAL
BTI	✕ - Binding site not conserved.	5-(HEXAHYDRO-2-OXO-1H-THIENO[3,4-D]IMIDAZOL-6-YL)PENTANAL
BTI	✕ - Binding site not conserved.	5-(HEXAHYDRO-2-OXO-1H-THIENO[3,4-D]IMIDAZOL-6-YL)PENTANAL
MN	✕ - Binding site not conserved.	MANGANESE (II) ION
MN	✕ - Binding site not conserved.	MANGANESE (II) ION
MN	✕ - Binding site not conserved.	MANGANESE (II) ION
MN	✕ - Binding site not conserved.	MANGANESE (II) ION

Target    MRMSNQEAIGLIDSGVGGLTVLKEALKQLPNERLIYLGDTARCPY----------GP--RPAEQVVQF--TWEMADFLLK
3hbl.1.C  MKQ--IKKLLVANRGEIAIRIFRAAAELDISTVAIYSNEDKSSLHRYKADESYLVGSDLGPA---ESYLNIERIIDVAKQ

Target    KRIKMLVIACNTA--TAVALEEIKAALPIPVVGVILPGARAAVKVTKNNKIGVIGTLGTIKSASYEIAIKSKAPAIEVTS
3hbl.1.C  ANVDAIHPGYGFLSENEQ-FARRCAEEGIKFIGP----------------------------------------------

Target    LACPKFVPIVESNQYRSSVAKKIVAETLQALQLKGLDTLILGCTHYPLLRPVIQNVMGSHVTLIDSGAETVGEVSMLLDY
3hbl.1.C  --------------------------------------------------------------------------------

Target    FDIAHTPEAPTQPHEFYTTGSAKMFEEIASSWLGIENLKAQQIHLGGNEND
3hbl.1.C  ---------------------------------------------------

Model #03	File	Built with	Oligo-State	Ligands	GMQE	QMEAN
	PDB	ProMod3 Version 1.0.2.	MONOMER	None	0.12	-5.01

QMEAN	-5.01
Cβ	-3.41
All Atom	-1.75
Solvation	-0.37
Torsion	-4.01

Template	Seq Identity	Oligo-state	Found by	Method	Resolution	Seq Similarity	Range	Coverage	Description
3gbp.1.A	15.85	monomer	HHblits	X-ray	2.40Å	0.27	113 - 208	0.30	GALACTOSE-BINDING PROTEIN

Ligand	Added to Model	Description
BGC	✕ - Binding site not conserved.	SUGAR (GLUCOSE)
CA	✕ - Binding site not conserved.	CALCIUM ION

Target    MRMSNQEAIGLIDSGVGGLTVLKEALKQLPNERLIYLGDTARCPYGPRPAEQVVQFTWEMADFLLKKRIKMLVIACNTAT
3gbp.1.A  --------------------------------------------------------------------------------

Target    AVALEEIKAALPIPVVGVILPGARAAVKVTKNNKIGVIGTLGTIKSASYEIAIKSKAPAIEVTSLACPKFVPIVESN---
3gbp.1.A  -------------------------------DTRIGVTIYK--YDDNFMSVVRKAI-------------EKDGKSAPDVQ

Target    --QYRSSVAKKIVAETLQALQLKGLDTLILGCTHYPLLRPVIQNVMGSHVTLIDSGAETVGEVSMLLDYFDIAHTPEAPT
3gbp.1.A  LLMNDSQNDQSKQNDQIDVLLAKGVKALAINLVDPAAAGTVIEKARGQNVPVV---------------------------

Target    QPHEFYTTGSAKMFEEIASSWLGIENLKAQQIHLGGNEND
3gbp.1.A  ----------------------------------------

Materials and Methods

Template Search

Template search with Blast and HHBlits has been performed against the SWISS-MODEL template library (SMTL, last update: 2017-10-11, last included PDB release: 2017-10-06).

The target sequence was searched with BLAST (Altschul et al., 1997) against the primary amino acid sequence contained in the SMTL. A total of 37 templates were found.

An initial HHblits profile has been built using the procedure outlined in (Remmert, et al., 2011), followed by 1 iteration of HHblits against NR20. The obtained profile has then be searched against all profiles of the SMTL. A total of 1050 templates were found.

Template Selection

For each identified template, the template's quality has been predicted from features of the target-template alignment. The templates with the highest quality have then been selected for model building.

Model Building

Models are built based on the target-template alignment using ProMod3. Coordinates which are conserved between the target and the template are copied from the template to the model. Insertions and deletions are remodelled using a fragment library. Side chains are then rebuilt. Finally, the geometry of the resulting model is regularized by using a force field. In case loop modelling with ProMod3 fails, an alternative model is built with PROMOD-II (Guex, et al., 1997).

Model Quality Estimation

The global and per-residue model quality has been assessed using the QMEAN scoring function (Benkert, et al., 2011) . For improved performance, weights of the individual QMEAN terms have been trained specifically for SWISS-MODEL.

Ligand Modelling

Ligands present in the template structure are transferred by homology to the model when the following criteria are met (Gallo -Casserino, to be published): (a) The ligands are annotated as biologically relevant in the template library, (b) the ligand is in contact with the model, (c) the ligand is not clashing with the protein, (d) the residues in contact with the ligand are conserved between the target and the template. If any of these four criteria is not satisfied, a certain ligand will not be included in the model. The model summary includes information on why and which ligand has not been included.

Oligomeric State Conservation

Homo-oligomeric structure of the target protein is predicted based on the analysis of pairwise interfaces of the identified template structures. For each relevant interface between polypeptide chains (interfaces with more than 10 residue-residue interactions), the QscoreOligomer (Mariani et al., 2011) is predicted from features such as similarity to target and frequency of observing this interface in the identified templates (Kiefer, Bertoni, Biasini, to be published). The prediction is performed with a random forest regressor using these features as input parameters to predict the probability of conservation for each interface. The QscoreOligomer of the whole complex is then calculated as the weight-averaged QscoreOligomer of the interfaces. The oligomeric state of the target is predicted to be the same as in the template when QscoreOligomer is predicted to be higher or equal to 0.5.

References

Altschul, S.F., Madden, T.L., Schaffer, A.A., Zhang, J., Zhang, Z., Miller, W. and Lipman, D.J. (1997) Gapped BLAST and PSI-BLAST: a new generation of protein database search programs. Nucleic Acids Res, 25, 3389-3402.
Remmert, M., Biegert, A., Hauser, A. and Soding, J. (2012) HHblits: lightning-fast iterative protein sequence searching by HMM-HMM alignment. Nat Methods, 9, 173-175.
Guex, N. and Peitsch, M.C. (1997) SWISS-MODEL and the Swiss-PdbViewer: an environment for comparative protein modeling. Electrophoresis, 18, 2714-2723.
Sali, A. and Blundell, T.L. (1993) Comparative protein modelling by satisfaction of spatial restraints. J Mol Biol, 234, 779-815.
Benkert, P., Biasini, M. and Schwede, T. (2011) Toward the estimation of the absolute quality of individual protein structure models. Bioinformatics, 27, 343-350.
Mariani, V., Kiefer, F., Schmidt, T., Haas, J. and Schwede, T. (2011) Assessment of template based protein structure predictions in CASP9. Proteins, 79 Suppl 10, 37-58.

Table T1:

Primary amino acid sequence for which templates were searched and models were built.

MRMSNQEAIGLIDSGVGGLTVLKEALKQLPNERLIYLGDTARCPYGPRPAEQVVQFTWEMADFLLKKRIKMLVIACNTATAVALEEIKAALPIPVVGVIL
PGARAAVKVTKNNKIGVIGTLGTIKSASYEIAIKSKAPAIEVTSLACPKFVPIVESNQYRSSVAKKIVAETLQALQLKGLDTLILGCTHYPLLRPVIQNV
MGSHVTLIDSGAETVGEVSMLLDYFDIAHTPEAPTQPHEFYTTGSAKMFEEIASSWLGIENLKAQQIHLGGNEND

Table T2:

Template	Seq Identity	Oligo-state	Found by	Method	Resolution	Seq Similarity	Coverage	Description
2jfp.1.A	99.64	homo-dimer	BLAST	X-ray	1.98Å	0.60	1.00	GLUTAMATE RACEMASE
2jfo.1.B	99.64	homo-dimer	BLAST	X-ray	2.50Å	0.60	1.00	GLUTAMATE RACEMASE
2jfp.1.A	100.00	homo-dimer	HHblits	X-ray	1.98Å	0.60	0.99	GLUTAMATE RACEMASE
2jfo.1.B	100.00	homo-dimer	HHblits	X-ray	2.50Å	0.60	0.99	GLUTAMATE RACEMASE
2vvt.1.A	99.63	homo-dimer	BLAST	X-ray	1.65Å	0.59	0.99	GLUTAMATE RACEMASE
2vvt.1.B	99.63	homo-dimer	BLAST	X-ray	1.65Å	0.59	0.99	GLUTAMATE RACEMASE
2vvt.1.A	100.00	homo-dimer	HHblits	X-ray	1.65Å	0.60	0.97	GLUTAMATE RACEMASE
2vvt.1.B	100.00	homo-dimer	HHblits	X-ray	1.65Å	0.60	0.97	GLUTAMATE RACEMASE
2jfw.1.A	70.85	homo-dimer	BLAST	X-ray	2.00Å	0.51	0.99	GLUTAMATE RACEMASE
2jfw.1.A	71.27	homo-dimer	HHblits	X-ray	2.00Å	0.51	0.97	GLUTAMATE RACEMASE
3hfr.1.A	58.33	homo-dimer	BLAST	X-ray	2.30Å	0.47	0.96	Glutamate racemase
3hfr.1.B	58.33	homo-dimer	BLAST	X-ray	2.30Å	0.47	0.96	Glutamate racemase
3hfr.1.A	58.56	homo-dimer	HHblits	X-ray	2.30Å	0.47	0.96	Glutamate racemase
3hfr.1.B	58.56	homo-dimer	HHblits	X-ray	2.30Å	0.47	0.96	Glutamate racemase
2ohv.1.A	56.49	homo-dimer	HHblits	X-ray	2.50Å	0.46	0.95	Glutamate Racemase
2ohg.1.A	56.49	homo-dimer	HHblits	X-ray	2.50Å	0.46	0.95	Glutamate racemase
2gzm.1.A	58.56	homo-dimer	HHblits	X-ray	1.99Å	0.46	0.96	Glutamate racemase
2gzm.1.B	58.56	homo-dimer	HHblits	X-ray	1.99Å	0.46	0.96	Glutamate racemase
2gzm.2.B	58.56	homo-dimer	HHblits	X-ray	1.99Å	0.46	0.96	Glutamate racemase
2oho.1.A	56.70	homo-dimer	HHblits	X-ray	2.25Å	0.46	0.95	Glutamate Racemase
2oho.1.B	56.70	homo-dimer	HHblits	X-ray	2.25Å	0.46	0.95	Glutamate Racemase
2gzm.1.A	61.00	homo-dimer	BLAST	X-ray	1.99Å	0.47	0.94	Glutamate racemase
2gzm.1.B	61.00	homo-dimer	BLAST	X-ray	1.99Å	0.47	0.94	Glutamate racemase
2gzm.2.B	61.00	homo-dimer	BLAST	X-ray	1.99Å	0.47	0.94	Glutamate racemase
1zuw.1.A	53.23	homo-dimer	HHblits	X-ray	1.75Å	0.45	0.96	glutamate racemase 1
1zuw.1.B	53.23	homo-dimer	HHblits	X-ray	1.75Å	0.45	0.96	glutamate racemase 1
2oho.1.A	58.89	homo-dimer	BLAST	X-ray	2.25Å	0.47	0.92	Glutamate Racemase
2oho.1.B	58.89	homo-dimer	BLAST	X-ray	2.25Å	0.47	0.92	Glutamate Racemase
2ohv.1.A	59.13	homo-dimer	BLAST	X-ray	2.50Å	0.47	0.92	Glutamate Racemase
2ohg.1.A	59.13	homo-dimer	BLAST	X-ray	2.50Å	0.47	0.92	Glutamate racemase
1zuw.1.A	56.13	homo-dimer	BLAST	X-ray	1.75Å	0.46	0.92	glutamate racemase 1
1zuw.1.B	56.13	homo-dimer	BLAST	X-ray	1.75Å	0.46	0.92	glutamate racemase 1
5ijw.1.A	41.48	homo-dimer	BLAST	X-ray	1.76Å	0.40	0.98	Glutamate racemase
5ijw.1.B	41.48	homo-dimer	BLAST	X-ray	1.76Å	0.40	0.98	Glutamate racemase
2dwu.1.A	47.71	homo-dimer	HHblits	X-ray	1.60Å	0.42	0.95	Glutamate racemase
2dwu.2.A	47.71	homo-dimer	HHblits	X-ray	1.60Å	0.42	0.95	Glutamate racemase
2jfq.1.A	49.04	homo-dimer	HHblits	X-ray	2.15Å	0.42	0.95	GLUTAMATE RACEMASE
2jfq.1.B	49.04	homo-dimer	HHblits	X-ray	2.15Å	0.42	0.95	GLUTAMATE RACEMASE
5ijw.1.A	40.07	homo-dimer	HHblits	X-ray	1.76Å	0.39	0.97	Glutamate racemase
5ijw.1.B	40.07	homo-dimer	HHblits	X-ray	1.76Å	0.39	0.97	Glutamate racemase
2dwu.1.A	49.01	homo-dimer	BLAST	X-ray	1.60Å	0.43	0.92	Glutamate racemase
2dwu.2.A	49.01	homo-dimer	BLAST	X-ray	1.60Å	0.43	0.92	Glutamate racemase
2jfq.1.A	51.20	homo-dimer	BLAST	X-ray	2.15Å	0.43	0.91	GLUTAMATE RACEMASE
2jfq.1.B	51.20	homo-dimer	BLAST	X-ray	2.15Å	0.43	0.91	GLUTAMATE RACEMASE
5hj7.1.A	40.30	homo-dimer	HHblits	X-ray	2.30Å	0.39	0.96	Glutamate racemase
5hj7.1.A	40.93	homo-dimer	BLAST	X-ray	2.30Å	0.39	0.94	Glutamate racemase
3out.1.A	33.98	homo-hexamer	HHblits	X-ray	1.65Å	0.37	0.93	Glutamate racemase
3out.1.A	36.80	homo-hexamer	BLAST	X-ray	1.65Å	0.38	0.91	Glutamate racemase
5w1q.1.A	38.84	homo-dimer	BLAST	X-ray	1.95Å	0.39	0.88	Glutamate racemase
2jfy.1.B	37.70	homo-dimer	BLAST	X-ray	1.90Å	0.38	0.89	GLUTAMATE RACEMASE
2jfz.1.A	37.70	homo-dimer	BLAST	X-ray	1.86Å	0.38	0.89	GLUTAMATE RACEMASE
2jfx.1.A	37.70	homo-dimer	BLAST	X-ray	2.30Å	0.38	0.89	GLUTAMATE RACEMASE
2jfx.1.B	37.70	homo-dimer	BLAST	X-ray	2.30Å	0.38	0.89	GLUTAMATE RACEMASE
2jfy.1.A	37.70	homo-dimer	BLAST	X-ray	1.90Å	0.38	0.89	GLUTAMATE RACEMASE
4b1f.1.B	37.70	homo-dimer	BLAST	X-ray	2.05Å	0.38	0.89	GLUTAMATE RACEMASE
2w4i.1.A	37.70	homo-tetramer	BLAST	X-ray	1.87Å	0.38	0.89	GLUTAMATE RACEMASE
1b73.1.A	38.33	homo-dimer	HHblits	X-ray	2.30Å	0.39	0.87	GLUTAMATE RACEMASE
5w1q.1.A	36.59	homo-dimer	HHblits	X-ray	1.95Å	0.37	0.89	Glutamate racemase
2jfy.1.B	35.37	homo-dimer	HHblits	X-ray	1.90Å	0.37	0.89	GLUTAMATE RACEMASE
2jfz.1.A	35.37	homo-dimer	HHblits	X-ray	1.86Å	0.37	0.89	GLUTAMATE RACEMASE
2jfx.1.A	35.37	homo-dimer	HHblits	X-ray	2.30Å	0.37	0.89	GLUTAMATE RACEMASE
2jfx.1.B	35.37	homo-dimer	HHblits	X-ray	2.30Å	0.37	0.89	GLUTAMATE RACEMASE
2jfy.1.A	35.37	homo-dimer	HHblits	X-ray	1.90Å	0.37	0.89	GLUTAMATE RACEMASE
4b1f.1.B	35.37	homo-dimer	HHblits	X-ray	2.05Å	0.37	0.89	GLUTAMATE RACEMASE
2w4i.1.A	35.37	homo-tetramer	HHblits	X-ray	1.87Å	0.37	0.89	GLUTAMATE RACEMASE
3uho.1.A	36.63	monomer	HHblits	X-ray	2.20Å	0.37	0.88	Glutamate racemase
3uhf.2.A	36.63	monomer	HHblits	X-ray	1.83Å	0.37	0.88	Glutamate racemase
3uhp.1.A	36.63	monomer	HHblits	X-ray	2.79Å	0.37	0.88	Glutamate racemase
2jfn.1.A	26.91	monomer	HHblits	X-ray	1.90Å	0.34	0.91	GLUTAMATE RACEMASE
1b73.1.A	44.95	homo-dimer	BLAST	X-ray	2.30Å	0.42	0.72	GLUTAMATE RACEMASE
2jfn.1.A	31.46	monomer	BLAST	X-ray	1.90Å	0.36	0.77	GLUTAMATE RACEMASE
3uho.1.A	39.81	monomer	BLAST	X-ray	2.20Å	0.38	0.75	Glutamate racemase
3uhf.2.A	39.81	monomer	BLAST	X-ray	1.83Å	0.38	0.75	Glutamate racemase
3uhp.1.A	39.81	monomer	BLAST	X-ray	2.79Å	0.38	0.75	Glutamate racemase
2eq5.1.A	19.14	homo-dimer	HHblits	X-ray	2.20Å	0.30	0.76	228aa long hypothetical hydantoin racemase
2eq5.2.B	19.14	homo-dimer	HHblits	X-ray	2.20Å	0.30	0.76	228aa long hypothetical hydantoin racemase
2zsk.1.A	20.98	homo-dimer	HHblits	X-ray	2.55Å	0.30	0.75	226aa long hypothetical aspartate racemase
1jfl.1.A	20.98	homo-dimer	HHblits	X-ray	1.90Å	0.30	0.75	ASPARTATE RACEMASE
2dx7.1.A	20.49	homo-dimer	HHblits	X-ray	2.00Å	0.30	0.75	aspartate racemase
2dx7.1.B	20.49	homo-dimer	HHblits	X-ray	2.00Å	0.30	0.75	aspartate racemase
3s81.1.A	16.10	homo-dimer	HHblits	X-ray	1.80Å	0.30	0.75	Putative aspartate racemase
5ell.1.A	16.35	homo-dimer	HHblits	X-ray	1.80Å	0.28	0.76	Asp/Glu_racemase family protein
5ell.1.B	16.35	homo-dimer	HHblits	X-ray	1.80Å	0.28	0.76	Asp/Glu_racemase family protein
4fq7.1.A	14.98	homo-tetramer	HHblits	X-ray	3.00Å	0.29	0.75	Maleate cis-trans isomerase
5hqt.1.A	16.43	homo-dimer	HHblits	X-ray	1.60Å	0.28	0.75	aspartate/glutamate racemase
4fq5.1.A	14.01	homo-tetramer	HHblits	X-ray	2.10Å	0.28	0.75	Maleate cis-trans isomerase
4fq5.1.B	14.01	homo-tetramer	HHblits	X-ray	2.10Å	0.28	0.75	Maleate cis-trans isomerase
5elm.1.A	16.50	homo-dimer	HHblits	X-ray	2.00Å	0.28	0.75	Asp/Glu_racemase family protein
5elm.1.B	16.50	homo-dimer	HHblits	X-ray	2.00Å	0.28	0.75	Asp/Glu_racemase family protein
5elm.2.A	16.50	homo-dimer	HHblits	X-ray	2.00Å	0.28	0.75	Asp/Glu_racemase family protein
5elm.2.B	16.50	homo-dimer	HHblits	X-ray	2.00Å	0.28	0.75	Asp/Glu_racemase family protein
5ibq.1.A	18.32	monomer	HHblits	X-ray	1.20Å	0.29	0.73	Probable ribose ABC transporter, substrate-binding protein
5hsg.1.A	17.00	monomer	HHblits	X-ray	1.30Å	0.30	0.73	Putative ABC transporter, nucleotide binding/ATPase protein
2xed.1.A	12.68	monomer	HHblits	X-ray	1.95Å	0.27	0.75	PUTATIVE MALEATE ISOMERASE
2xec.1.A	12.68	homo-dimer	HHblits	X-ray	2.20Å	0.27	0.75	PUTATIVE MALEATE ISOMERASE
4ix1.1.A	10.95	homo-dimer	HHblits	X-ray	2.80Å	0.25	0.76	hypothetical protein
4ix1.1.B	10.95	homo-dimer	HHblits	X-ray	2.80Å	0.25	0.76	hypothetical protein
5b19.1.A	16.58	homo-dimer	HHblits	X-ray	1.85Å	0.29	0.72	Aspartate racemase
5b19.1.B	16.58	homo-dimer	HHblits	X-ray	1.85Å	0.29	0.72	Aspartate racemase
1jhz.1.A	16.83	homo-dimer	HHblits	X-ray	2.40Å	0.28	0.73	PURINE NUCLEOTIDE SYNTHESIS REPRESSOR
1jhz.1.B	16.83	homo-dimer	HHblits	X-ray	2.40Å	0.28	0.73	PURINE NUCLEOTIDE SYNTHESIS REPRESSOR
3ojc.1.A	22.05	homo-tetramer	HHblits	X-ray	1.75Å	0.30	0.71	Putative aspartate/glutamate racemase
3ojc.1.B	22.05	homo-tetramer	HHblits	X-ray	1.75Å	0.30	0.71	Putative aspartate/glutamate racemase
3ojc.1.C	22.05	homo-tetramer	HHblits	X-ray	1.75Å	0.30	0.71	Putative aspartate/glutamate racemase
3ojc.1.D	22.05	homo-tetramer	HHblits	X-ray	1.75Å	0.30	0.71	Putative aspartate/glutamate racemase
2dgd.1.A	12.20	homo-octamer	HHblits	X-ray	2.90Å	0.26	0.75	223aa long hypothetical arylmalonate decarboxylase
4y9t.1.A	14.85	monomer	HHblits	X-ray	1.80Å	0.27	0.73	ABC transporter, solute binding protein
4yv7.1.A	16.42	monomer	HHblits	X-ray	2.30Å	0.27	0.73	Periplasmic binding protein/LacI transcriptional regulator
4rs3.1.A	13.37	monomer	HHblits	X-ray	1.40Å	0.27	0.73	ABC transporter, carbohydrate uptake transporter-2 (CUT2) family, periplasmic sugar-binding protein
4rsm.1.A	15.42	monomer	HHblits	X-ray	1.60Å	0.27	0.73	Periplasmic binding protein/LacI transcriptional regulator
5odc.1.B	11.22	hetero-oligomer	HHblits	X-ray	2.30Å	0.25	0.75	Heterodisulfide reductase, subunit B
3ma0.1.A	14.36	monomer	HHblits	X-ray	2.20Å	0.26	0.73	D-xylose-binding periplasmic protein
3m9w.1.A	14.36	monomer	HHblits	X-ray	2.15Å	0.26	0.73	D-xylose-binding periplasmic protein
4ry9.1.A	12.32	monomer	HHblits	X-ray	1.40Å	0.26	0.74	Periplasmic binding protein/LacI transcriptional regulator
5ix8.1.A	5.85	monomer	HHblits	X-ray	1.60Å	0.25	0.75	Putative sugar ABC transport system, substrate-binding protein
3ixm.1.A	11.56	monomer	HHblits	X-ray	1.90Å	0.27	0.72	Arylmalonate decarboxylase
2vlb.1.A	11.00	monomer	HHblits	X-ray	1.92Å	0.26	0.73	ARYLMALONATE DECARBOXYLASE
2vlb.2.A	11.00	monomer	HHblits	X-ray	1.92Å	0.26	0.73	ARYLMALONATE DECARBOXYLASE
2vlb.3.A	11.00	monomer	HHblits	X-ray	1.92Å	0.26	0.73	ARYLMALONATE DECARBOXYLASE
2vlb.4.A	11.00	monomer	HHblits	X-ray	1.92Å	0.26	0.73	ARYLMALONATE DECARBOXYLASE
3dg9.1.A	11.00	monomer	HHblits	X-ray	1.50Å	0.26	0.73	Arylmalonate decarboxylase
1jye.1.A	12.50	homo-dimer	HHblits	X-ray	1.70Å	0.26	0.73	Lactose Operon Repressor
3k9c.1.A	12.06	homo-dimer	HHblits	X-ray	2.14Å	0.26	0.72	Transcriptional regulator, LacI family protein
3dtv.3.A	11.11	monomer	HHblits	X-ray	2.10Å	0.26	0.72	Arylmalonate decarboxylase
3dtv.2.A	11.11	monomer	HHblits	X-ray	2.10Å	0.26	0.72	Arylmalonate decarboxylase
3dtv.1.A	11.11	monomer	HHblits	X-ray	2.10Å	0.26	0.72	Arylmalonate decarboxylase
3dtv.4.A	11.11	monomer	HHblits	X-ray	2.10Å	0.26	0.72	Arylmalonate decarboxylase
3eis.1.A	11.11	monomer	HHblits	X-ray	2.10Å	0.26	0.72	Arylmalonate decarboxylase
3eis.2.A	11.11	monomer	HHblits	X-ray	2.10Å	0.26	0.72	Arylmalonate decarboxylase
3ixl.1.A	10.61	monomer	HHblits	X-ray	1.45Å	0.26	0.72	Arylmalonate decarboxylase
5lfd.1.A	16.84	homo-hexamer	HHblits	X-ray	2.15Å	0.28	0.69	Allantoin racemase
3qvj.1.A	16.84	homo-hexamer	HHblits	X-ray	2.10Å	0.28	0.69	Putative hydantoin racemase
3qvl.1.A	15.87	homo-hexamer	HHblits	X-ray	1.82Å	0.27	0.69	Putative hydantoin racemase
4r9x.1.A	20.63	homo-dimer	HHblits	X-ray	1.85Å	0.29	0.58	Copper homeostasis protein CutC
4r9x.1.B	20.63	homo-dimer	HHblits	X-ray	1.85Å	0.29	0.58	Copper homeostasis protein CutC
2ioy.1.A	14.38	monomer	HHblits	X-ray	1.90Å	0.27	0.58	Periplasmic sugar-binding protein
1jx6.1.A	14.38	monomer	HHblits	X-ray	1.50Å	0.27	0.58	LUXP PROTEIN
1gpw.1.A	14.56	hetero-oligomer	HHblits	X-ray	2.40Å	0.28	0.57	HISF PROTEIN
1gpw.3.A	14.56	hetero-oligomer	HHblits	X-ray	2.40Å	0.28	0.57	HISF PROTEIN
2bdq.1.A	14.86	homo-dimer	HHblits	X-ray	2.30Å	0.29	0.54	copper homeostasis protein CutC
4ccz.1.A	18.24	monomer	HHblits	X-ray	2.70Å	0.28	0.54	METHIONINE SYNTHASE
5a9s.1.B	13.61	hetero-oligomer	HHblits	X-ray	2.06Å	0.26	0.53	IMINE REDUCTASE
3fwn.1.A	16.55	homo-dimer	HHblits	X-ray	1.50Å	0.28	0.51	6-phosphogluconate dehydrogenase, decarboxylating
3fwn.1.B	16.55	homo-dimer	HHblits	X-ray	1.50Å	0.28	0.51	6-phosphogluconate dehydrogenase, decarboxylating
5a9r.1.A	16.54	homo-dimer	HHblits	X-ray	1.55Å	0.29	0.48	IMINE REDUCTASE
5a9s.1.A	16.54	hetero-oligomer	HHblits	X-ray	2.06Å	0.29	0.48	IMINE REDUCTASE
5fwn.1.B	16.54	homo-dimer	HHblits	X-ray	2.14Å	0.29	0.48	IMINE REDUCTASE
5dmm.1.A	13.77	monomer	HHblits	X-ray	1.78Å	0.25	0.50	Homocysteine S-methyltransferase
5dmn.1.A	13.77	homo-dimer	HHblits	X-ray	2.89Å	0.25	0.50	Homocysteine S-methyltransferase
3pef.1.A	12.03	homo-tetramer	HHblits	X-ray	2.07Å	0.27	0.48	6-phosphogluconate dehydrogenase, NAD-binding
3pef.2.C	12.03	homo-tetramer	HHblits	X-ray	2.07Å	0.27	0.48	6-phosphogluconate dehydrogenase, NAD-binding
4dll.1.A	12.78	homo-dimer	HHblits	X-ray	2.11Å	0.27	0.48	2-hydroxy-3-oxopropionate reductase
3obb.1.A	11.28	homo-tetramer	HHblits	X-ray	2.20Å	0.27	0.48	Probable 3-hydroxyisobutyrate dehydrogenase
5je8.1.B	14.39	homo-dimer	HHblits	X-ray	2.10Å	0.27	0.48	3-hydroxyisobutyrate dehydrogenase
5je8.1.A	14.39	homo-dimer	HHblits	X-ray	2.10Å	0.27	0.48	3-hydroxyisobutyrate dehydrogenase
3pdu.1.A	16.03	homo-tetramer	HHblits	X-ray	1.89Å	0.28	0.48	3-hydroxyisobutyrate dehydrogenase family protein
2gf2.1.A	13.64	homo-dimer	HHblits	X-ray	2.38Å	0.26	0.48	3-hydroxyisobutyrate dehydrogenase
2i9p.1.A	12.88	homo-tetramer	HHblits	X-ray	2.55Å	0.26	0.48	3-hydroxyisobutyrate dehydrogenase
3rot.1.A	16.54	homo-dimer	HHblits	X-ray	1.91Å	0.28	0.46	ABC sugar transporter, periplasmic sugar binding protein
3gbv.1.A	10.16	homo-dimer	HHblits	X-ray	2.20Å	0.27	0.47	Putative LacI-family transcriptional regulator
3gbv.1.B	10.16	homo-dimer	HHblits	X-ray	2.20Å	0.27	0.47	Putative LacI-family transcriptional regulator
4mwa.1.A	17.60	homo-tetramer	HHblits	X-ray	1.85Å	0.29	0.45	4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
4mwa.1.B	17.60	homo-tetramer	HHblits	X-ray	1.85Å	0.29	0.45	4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
4mwa.1.C	17.60	homo-tetramer	HHblits	X-ray	1.85Å	0.29	0.45	4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
4mwa.1.D	17.60	homo-tetramer	HHblits	X-ray	1.85Å	0.29	0.45	4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
4mwa.2.B	17.60	homo-tetramer	HHblits	X-ray	1.85Å	0.29	0.45	4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
4mwa.2.D	17.60	homo-tetramer	HHblits	X-ray	1.85Å	0.29	0.45	4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
3t95.1.A	16.67	monomer	HHblits	X-ray	1.75Å	0.28	0.46	Autoinducer 2-binding protein lsrB
1dbq.1.A	18.55	homo-dimer	HHblits	X-ray	2.20Å	0.29	0.45	PURINE REPRESSOR
1dbq.1.B	18.55	homo-dimer	HHblits	X-ray	2.20Å	0.29	0.45	PURINE REPRESSOR
3g1w.1.A	16.13	homo-dimer	HHblits	X-ray	2.02Å	0.29	0.45	Sugar ABC transporter
2pug.1.B	19.67	homo-dimer	HHblits	X-ray	2.70Å	0.30	0.44	PROTEIN (PURINE REPRESSOR)
4fx7.1.A	7.87	monomer	HHblits	X-ray	2.08Å	0.26	0.46	Imidazole glycerol phosphate synthase subunit HisF
1vpw.1.B	19.67	homo-dimer	HHblits	X-ray	2.70Å	0.29	0.44	PURINE REPRESSOR
1jh9.1.B	19.01	homo-dimer	HHblits	X-ray	2.55Å	0.30	0.44	PURINE NUCLEOTIDE SYNTHESIS REPRESSOR
4yo7.1.A	12.20	monomer	HHblits	X-ray	1.70Å	0.28	0.45	Sugar ABC transporter (Sugar-binding protein)
1bdh.1.B	18.85	homo-dimer	HHblits	X-ray	2.70Å	0.29	0.44	PROTEIN (PURINE REPRESSOR)
5a5f.1.A	17.74	monomer	HHblits	X-ray	1.90Å	0.28	0.45	UDP-N-ACETYLMURAMOYLALANINE--D-GLUTAMATE LIGASE
2y67.1.A	19.51	monomer	HHblits	X-ray	1.85Å	0.28	0.45	UDP-N-ACETYLMURAMOYLALANINE--D-GLUTAMATE LIGASE
2xpc.1.A	19.51	monomer	HHblits	X-ray	1.49Å	0.28	0.45	UDP-N-ACETYLMURAMOYLALANINE--D-GLUTAMATE LIGASE
3olz.1.A	12.31	homo-tetramer	HHblits	X-ray	2.75Å	0.24	0.47	Glutamate receptor, ionotropic kainate 3
3olz.1.B	12.31	homo-tetramer	HHblits	X-ray	2.75Å	0.24	0.47	Glutamate receptor, ionotropic kainate 3
1uag.1.A	17.89	monomer	HHblits	X-ray	1.95Å	0.28	0.45	UDP-N-ACETYLMURAMOYL-L-ALANINE/:D-GLUTAMATE LIGASE
1eeh.1.A	17.89	monomer	HHblits	X-ray	1.90Å	0.28	0.45	UDP-N-ACETYLMURAMOYL-L-ALANINE:D-GLUTAMATE LIGASE
2uag.1.A	17.89	monomer	HHblits	X-ray	1.70Å	0.28	0.45	PROTEIN (UDP-N-ACETYLMURAMOYL-L-ALANINE:D-GLUTAMATE LIGASE)
1e0d.1.A	17.89	monomer	HHblits	X-ray	2.40Å	0.28	0.45	UDP-N-ACETYLMURAMOYLALANINE--D-GLUTAMATE LIGASE
5a5e.1.A	17.89	monomer	HHblits	X-ray	1.84Å	0.28	0.45	UDP-N-ACETYLMURAMOYLALANINE--D-GLUTAMATE LIGASE
5bra.1.A	12.70	monomer	HHblits	X-ray	2.97Å	0.26	0.46	Putative periplasmic binding protein with substrate ribose
3tdn.1.A	8.00	homo-dimer	HHblits	X-ray	1.40Å	0.26	0.45	FLR SYMMETRIC ALPHA-BETA TIM BARREL
4x9s.1.A	19.67	monomer	HHblits	X-ray	1.60Å	0.28	0.44	Phosphoribosyl isomerase A
4ywh.1.A	12.10	monomer	HHblits	X-ray	2.35Å	0.26	0.45	ABC TRANSPORTER SOLUTE BINDING PROTEIN
4p98.1.A	9.60	monomer	HHblits	X-ray	1.90Å	0.25	0.45	Extracellular solute-binding protein
4x2r.1.A	16.26	monomer	HHblits	X-ray	1.05Å	0.26	0.45	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase
2x30.1.A	19.17	monomer	HHblits	X-ray	1.95Å	0.28	0.44	PHOSPHORIBOSYL ISOMERASE A
2p9h.1.A	13.22	homo-dimer	HHblits	X-ray	2.00Å	0.27	0.44	Lactose operon repressor
4o5a.1.A	10.57	homo-dimer	HHblits	X-ray	1.78Å	0.26	0.45	LacI family transcription regulator
1tlf.1.A	13.22	homo-tetramer	HHblits	X-ray	2.60Å	0.27	0.44	LAC REPRESSOR
1tlf.1.B	13.22	homo-tetramer	HHblits	X-ray	2.60Å	0.27	0.44	LAC REPRESSOR
1tlf.1.C	13.22	homo-tetramer	HHblits	X-ray	2.60Å	0.27	0.44	LAC REPRESSOR
1tlf.1.D	13.22	homo-tetramer	HHblits	X-ray	2.60Å	0.27	0.44	LAC REPRESSOR
1vzw.1.A	17.50	monomer	HHblits	X-ray	1.80Å	0.27	0.44	PHOSPHORIBOSYL ISOMERASE A
2vep.1.A	17.50	monomer	HHblits	X-ray	1.80Å	0.27	0.44	PHOSPHORIBOSYL ISOMERASE A
4axk.1.A	15.57	monomer	HHblits	X-ray	2.25Å	0.26	0.44	1-(5-PHOSPHORIBOSYL)-5-((5'-PHOSPHORIBOSYLAMINO) METHYLIDENEAMINO)IMIDAZOLE-4-CARBOXAMIDE ISOMERASE
4axk.2.A	15.57	monomer	HHblits	X-ray	2.25Å	0.26	0.44	1-(5-PHOSPHORIBOSYL)-5-((5'-PHOSPHORIBOSYLAMINO) METHYLIDENEAMINO)IMIDAZOLE-4-CARBOXAMIDE ISOMERASE
5dn1.1.A	18.49	monomer	HHblits	X-ray	1.95Å	0.28	0.43	Phosphoribosyl isomerase A
2y88.1.A	13.93	monomer	HHblits	X-ray	1.33Å	0.25	0.44	PHOSPHORIBOSYL ISOMERASE A
2y89.1.A	13.93	monomer	HHblits	X-ray	2.50Å	0.25	0.44	PHOSPHORIBOSYL ISOMERASE A
2y85.1.A	13.93	monomer	HHblits	X-ray	2.40Å	0.25	0.44	PHOSPHORIBOSYL ISOMERASE A
3zs4.1.A	13.93	monomer	HHblits	X-ray	1.90Å	0.25	0.44	PHOSPHORIBOSYL ISOMERASE A
4wd0.1.A	14.88	homo-hexamer	HHblits	X-ray	1.50Å	0.26	0.44	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase
4u28.1.A	16.95	monomer	HHblits	X-ray	1.33Å	0.28	0.43	Phosphoribosyl isomerase A
4had.1.A	13.45	homo-tetramer	HHblits	X-ray	2.00Å	0.27	0.43	Probable oxidoreductase protein
4joq.1.A	16.10	homo-dimer	HHblits	X-ray	1.90Å	0.28	0.43	ABC ribose transporter, periplasmic solute-binding protein
4tx9.1.A	16.95	monomer	HHblits	X-ray	1.60Å	0.28	0.43	Phosphoribosyl isomerase A
4rk5.1.A	13.45	homo-dimer	HHblits	X-ray	1.35Å	0.27	0.43	Transcriptional regulator, LacI family
3g1u.1.A	13.33	homo-tetramer	HHblits	X-ray	2.20Å	0.26	0.44	Adenosylhomocysteinase
4wxe.1.A	13.45	monomer	HHblits	X-ray	1.50Å	0.27	0.43	Transcriptional regulator, LacI family
3e61.1.A	6.56	homo-tetramer	HHblits	X-ray	2.00Å	0.25	0.44	Putative transcriptional repressor of ribose operon
3lft.1.A	14.29	monomer	HHblits	X-ray	1.35Å	0.27	0.43	uncharacterized protein
3h9u.1.A	12.50	homo-octamer	HHblits	X-ray	1.90Å	0.26	0.44	Adenosylhomocysteinase
4rk3.1.A	13.45	homo-dimer	HHblits	X-ray	1.80Å	0.26	0.43	Transcriptional regulator, LacI family
3g85.1.A	12.61	monomer	HHblits	X-ray	1.84Å	0.26	0.43	Transcriptional regulator (LacI family)
4evs.1.A	12.17	monomer	HHblits	X-ray	1.45Å	0.28	0.42	PUTATIVE ABC TRANSPORTER SUBUNIT, SUBSTRATE-BINDING COMPONENT
5ufh.1.A	10.08	homo-dimer	HHblits	X-ray	1.45Å	0.25	0.43	LacI-type transcriptional regulator
4mlc.1.A	12.17	monomer	HHblits	X-ray	2.71Å	0.27	0.42	Extracellular ligand-binding receptor
4q6b.1.A	12.17	monomer	HHblits	X-ray	1.67Å	0.27	0.42	Extracellular ligand-binding receptor
3n0x.1.A	10.08	monomer	HHblits	X-ray	1.50Å	0.23	0.43	Possible substrate binding protein of ABC transporter system
4f06.1.A	10.62	monomer	HHblits	X-ray	1.30Å	0.27	0.41	Extracellular ligand-binding receptor
5ocs.1.B	17.86	homo-dimer	HHblits	X-ray	1.70Å	0.27	0.41	Putative NADH-depentdent flavin oxidoreductase
5ocs.1.A	17.86	homo-dimer	HHblits	X-ray	1.70Å	0.27	0.41	Putative NADH-depentdent flavin oxidoreductase
5ide.1.B	8.55	hetero-oligomer	HHblits	EM	NA	0.24	0.43	Glutamate receptor 3
5ide.1.D	8.55	hetero-oligomer	HHblits	EM	NA	0.24	0.43	Glutamate receptor 3
5idf.1.B	8.55	hetero-oligomer	HHblits	EM	NA	0.24	0.43	Glutamate receptor 3
5idf.1.D	8.55	hetero-oligomer	HHblits	EM	NA	0.24	0.43	Glutamate receptor 3
1iu9.1.A	22.64	monomer	HHblits	X-ray	2.04Å	0.31	0.39	aspartate racemase
3i09.1.A	15.04	monomer	HHblits	X-ray	1.80Å	0.26	0.41	Periplasmic branched-chain amino acid-binding protein
3n0w.1.A	7.89	monomer	HHblits	X-ray	1.88Å	0.24	0.41	ABC branched chain amino acid family transporter, periplasmic ligand binding protein
4rk0.1.A	19.05	homo-dimer	HHblits	X-ray	1.80Å	0.30	0.38	LacI family sugar-binding transcriptional regulator
4rk0.1.B	19.05	homo-dimer	HHblits	X-ray	1.80Å	0.30	0.38	LacI family sugar-binding transcriptional regulator
1v8b.1.A	14.81	homo-tetramer	HHblits	X-ray	2.40Å	0.27	0.39	adenosylhomocysteinase
1jfl.1.A	18.27	homo-dimer	HHblits	X-ray	1.90Å	0.30	0.38	ASPARTATE RACEMASE
3s81.1.A	16.19	homo-dimer	HHblits	X-ray	1.80Å	0.29	0.38	Putative aspartate racemase
3gfg.1.A	18.63	homo-dimer	HHblits	X-ray	2.59Å	0.31	0.37	Uncharacterized oxidoreductase yvaA
2dx7.1.A	17.82	homo-dimer	HHblits	X-ray	2.00Å	0.30	0.37	aspartate racemase
2dx7.1.B	17.82	homo-dimer	HHblits	X-ray	2.00Å	0.30	0.37	aspartate racemase
5b19.1.A	12.50	homo-dimer	HHblits	X-ray	1.85Å	0.28	0.38	Aspartate racemase
5b19.1.B	12.50	homo-dimer	HHblits	X-ray	1.85Å	0.28	0.38	Aspartate racemase
1vpd.1.A	20.79	monomer	HHblits	X-ray	1.65Å	0.30	0.37	TARTRONATE SEMIALDEHYDE REDUCTASE
2zsk.1.A	18.63	homo-dimer	HHblits	X-ray	2.55Å	0.29	0.37	226aa long hypothetical aspartate racemase
2jfq.1.A	17.65	homo-dimer	HHblits	X-ray	2.15Å	0.29	0.37	GLUTAMATE RACEMASE
2jfq.1.B	17.65	homo-dimer	HHblits	X-ray	2.15Å	0.29	0.37	GLUTAMATE RACEMASE
3ojc.1.A	12.50	homo-tetramer	HHblits	X-ray	1.75Å	0.28	0.38	Putative aspartate/glutamate racemase
3ojc.1.B	12.50	homo-tetramer	HHblits	X-ray	1.75Å	0.28	0.38	Putative aspartate/glutamate racemase
3ojc.1.C	12.50	homo-tetramer	HHblits	X-ray	1.75Å	0.28	0.38	Putative aspartate/glutamate racemase
3ojc.1.D	12.50	homo-tetramer	HHblits	X-ray	1.75Å	0.28	0.38	Putative aspartate/glutamate racemase
5elm.1.A	14.56	homo-dimer	HHblits	X-ray	2.00Å	0.28	0.37	Asp/Glu_racemase family protein
5elm.1.B	14.56	homo-dimer	HHblits	X-ray	2.00Å	0.28	0.37	Asp/Glu_racemase family protein
5elm.2.A	14.56	homo-dimer	HHblits	X-ray	2.00Å	0.28	0.37	Asp/Glu_racemase family protein
5elm.2.B	14.56	homo-dimer	HHblits	X-ray	2.00Å	0.28	0.37	Asp/Glu_racemase family protein
5ell.1.A	13.59	homo-dimer	HHblits	X-ray	1.80Å	0.28	0.37	Asp/Glu_racemase family protein
5ell.1.B	13.59	homo-dimer	HHblits	X-ray	1.80Å	0.28	0.37	Asp/Glu_racemase family protein
5hqt.1.A	14.56	homo-dimer	HHblits	X-ray	1.60Å	0.28	0.37	aspartate/glutamate racemase
3g0o.1.A	11.76	homo-dimer	HHblits	X-ray	1.80Å	0.28	0.37	3-hydroxyisobutyrate dehydrogenase
1zuw.1.A	16.83	homo-dimer	HHblits	X-ray	1.75Å	0.29	0.37	glutamate racemase 1
1zuw.1.B	16.83	homo-dimer	HHblits	X-ray	1.75Å	0.29	0.37	glutamate racemase 1
5ijw.1.A	14.71	homo-dimer	HHblits	X-ray	1.76Å	0.28	0.37	Glutamate racemase
5ijw.1.B	14.71	homo-dimer	HHblits	X-ray	1.76Å	0.28	0.37	Glutamate racemase
3out.1.A	15.84	homo-hexamer	HHblits	X-ray	1.65Å	0.28	0.37	Glutamate racemase
5lfd.1.A	11.88	homo-hexamer	HHblits	X-ray	2.15Å	0.28	0.37	Allantoin racemase
2jfw.1.A	12.75	homo-dimer	HHblits	X-ray	2.00Å	0.27	0.37	GLUTAMATE RACEMASE
2vvt.1.A	12.75	homo-dimer	HHblits	X-ray	1.65Å	0.27	0.37	GLUTAMATE RACEMASE
2vvt.1.B	12.75	homo-dimer	HHblits	X-ray	1.65Å	0.27	0.37	GLUTAMATE RACEMASE
3uho.1.A	17.00	monomer	HHblits	X-ray	2.20Å	0.28	0.36	Glutamate racemase
3uhf.2.A	17.00	monomer	HHblits	X-ray	1.83Å	0.28	0.36	Glutamate racemase
3uhp.1.A	17.00	monomer	HHblits	X-ray	2.79Å	0.28	0.36	Glutamate racemase
3fn4.1.A	12.87	homo-dimer	HHblits	X-ray	1.96Å	0.27	0.37	NAD-dependent formate dehydrogenase
2jfp.1.A	11.76	homo-dimer	HHblits	X-ray	1.98Å	0.26	0.37	GLUTAMATE RACEMASE
2jfo.1.B	11.76	homo-dimer	HHblits	X-ray	2.50Å	0.26	0.37	GLUTAMATE RACEMASE
5w1q.1.A	14.00	homo-dimer	HHblits	X-ray	1.95Å	0.28	0.36	Glutamate racemase
2oho.1.A	8.91	homo-dimer	HHblits	X-ray	2.25Å	0.27	0.37	Glutamate Racemase
2oho.1.B	8.91	homo-dimer	HHblits	X-ray	2.25Å	0.27	0.37	Glutamate Racemase
3qvj.1.A	12.00	homo-hexamer	HHblits	X-ray	2.10Å	0.27	0.36	Putative hydantoin racemase
2ohv.1.A	13.00	homo-dimer	HHblits	X-ray	2.50Å	0.27	0.36	Glutamate Racemase
2ohg.1.A	13.00	homo-dimer	HHblits	X-ray	2.50Å	0.27	0.36	Glutamate racemase
2dwu.1.A	15.84	homo-dimer	HHblits	X-ray	1.60Å	0.26	0.37	Glutamate racemase
2dwu.2.A	15.84	homo-dimer	HHblits	X-ray	1.60Å	0.26	0.37	Glutamate racemase
5hj7.1.A	10.89	homo-dimer	HHblits	X-ray	2.30Å	0.26	0.37	Glutamate racemase
3qvl.1.A	10.89	homo-hexamer	HHblits	X-ray	1.82Å	0.26	0.37	Putative hydantoin racemase
3hfr.1.A	11.76	homo-dimer	HHblits	X-ray	2.30Å	0.25	0.37	Glutamate racemase
3hfr.1.B	11.76	homo-dimer	HHblits	X-ray	2.30Å	0.25	0.37	Glutamate racemase
3q3c.1.A	10.00	homo-tetramer	HHblits	X-ray	2.30Å	0.26	0.36	Probable 3-hydroxyisobutyrate dehydrogenase
3ixm.1.A	14.14	monomer	HHblits	X-ray	1.90Å	0.26	0.36	Arylmalonate decarboxylase
2vlb.1.A	14.14	monomer	HHblits	X-ray	1.92Å	0.26	0.36	ARYLMALONATE DECARBOXYLASE
2vlb.2.A	14.14	monomer	HHblits	X-ray	1.92Å	0.26	0.36	ARYLMALONATE DECARBOXYLASE
2vlb.3.A	14.14	monomer	HHblits	X-ray	1.92Å	0.26	0.36	ARYLMALONATE DECARBOXYLASE
2vlb.4.A	14.14	monomer	HHblits	X-ray	1.92Å	0.26	0.36	ARYLMALONATE DECARBOXYLASE
3dg9.1.A	14.14	monomer	HHblits	X-ray	1.50Å	0.26	0.36	Arylmalonate decarboxylase
3ixl.1.A	13.13	monomer	HHblits	X-ray	1.45Å	0.26	0.36	Arylmalonate decarboxylase
2bdq.1.A	13.40	homo-dimer	HHblits	X-ray	2.30Å	0.27	0.35	copper homeostasis protein CutC
1c30.1.A	13.54	hetero-oligomer	HHblits	X-ray	2.00Å	0.28	0.35	CARBAMOYL PHOSPHATE SYNTHETASE: LARGE SUBUNIT
1bxr.1.A	13.54	hetero-oligomer	HHblits	X-ray	2.10Å	0.28	0.35	CARBAMOYL-PHOSPHATE SYNTHASE
2dgd.1.A	13.40	homo-octamer	HHblits	X-ray	2.90Å	0.27	0.35	223aa long hypothetical arylmalonate decarboxylase
3d6n.1.B	10.10	hetero-oligomer	HHblits	X-ray	2.30Å	0.25	0.36	Aspartate carbamoyltransferase
3lp8.1.A	10.53	monomer	HHblits	X-ray	2.15Å	0.27	0.35	Phosphoribosylamine-glycine ligase
3dtv.3.A	14.58	monomer	HHblits	X-ray	2.10Å	0.26	0.35	Arylmalonate decarboxylase
3dtv.2.A	14.58	monomer	HHblits	X-ray	2.10Å	0.26	0.35	Arylmalonate decarboxylase
3dtv.1.A	14.58	monomer	HHblits	X-ray	2.10Å	0.26	0.35	Arylmalonate decarboxylase
3dtv.4.A	14.58	monomer	HHblits	X-ray	2.10Å	0.26	0.35	Arylmalonate decarboxylase
3eis.1.A	14.58	monomer	HHblits	X-ray	2.10Å	0.26	0.35	Arylmalonate decarboxylase
3eis.2.A	14.58	monomer	HHblits	X-ray	2.10Å	0.26	0.35	Arylmalonate decarboxylase
2jfn.1.A	11.58	monomer	HHblits	X-ray	1.90Å	0.27	0.35	GLUTAMATE RACEMASE
4ffm.1.A	18.09	monomer	HHblits	X-ray	1.91Å	0.28	0.34	PylC
2rir.1.A	14.13	homo-tetramer	HHblits	X-ray	2.79Å	0.28	0.33	Dipicolinate synthase, A chain
2rir.1.B	14.13	homo-tetramer	HHblits	X-ray	2.79Å	0.28	0.33	Dipicolinate synthase, A chain
3d4o.1.A	14.13	homo-dimer	HHblits	X-ray	2.10Å	0.28	0.33	Dipicolinate synthase subunit A
3d4o.1.B	14.13	homo-dimer	HHblits	X-ray	2.10Å	0.28	0.33	Dipicolinate synthase subunit A
3ho8.1.A	10.64	homo-tetramer	HHblits	X-ray	2.90Å	0.26	0.34	Pyruvate carboxylase
3ho8.1.B	10.64	homo-tetramer	HHblits	X-ray	2.90Å	0.26	0.34	Pyruvate carboxylase
3ho8.1.C	10.64	homo-tetramer	HHblits	X-ray	2.90Å	0.26	0.34	Pyruvate carboxylase
3ho8.1.D	10.64	homo-tetramer	HHblits	X-ray	2.90Å	0.26	0.34	Pyruvate carboxylase
3b1f.1.A	15.22	homo-dimer	HHblits	X-ray	2.10Å	0.27	0.33	Putative prephenate dehydrogenase
3hbl.1.A	13.04	homo-tetramer	HHblits	X-ray	2.71Å	0.27	0.33	Pyruvate carboxylase
3hbl.1.B	13.04	homo-tetramer	HHblits	X-ray	2.71Å	0.27	0.33	Pyruvate carboxylase
3hbl.1.C	13.04	homo-tetramer	HHblits	X-ray	2.71Å	0.27	0.33	Pyruvate carboxylase
3hbl.1.D	13.04	homo-tetramer	HHblits	X-ray	2.71Å	0.27	0.33	Pyruvate carboxylase
3lq1.1.A	8.60	homo-dimer	HHblits	X-ray	2.60Å	0.26	0.34	2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase
1gso.1.A	10.99	monomer	HHblits	X-ray	1.60Å	0.27	0.33	PROTEIN (GLYCINAMIDE RIBONUCLEOTIDE SYNTHETASE)
2qk4.1.A	12.09	monomer	HHblits	X-ray	2.45Å	0.27	0.33	Trifunctional purine biosynthetic protein adenosine-3
4qsh.1.A	9.68	homo-tetramer	HHblits	X-ray	2.51Å	0.25	0.34	Pyruvate carboxylase
4zht.1.A	11.96	homo-tetramer	HHblits	X-ray	2.69Å	0.26	0.33	Bifunctional UDP-N-acetylglucosamine 2-epimerase/N-acetylmannosamine kinase
3se7.1.A	15.22	homo-dimer	HHblits	X-ray	3.07Å	0.26	0.33	VanA
3mjf.1.A	14.29	monomer	HHblits	X-ray	1.47Å	0.27	0.33	Phosphoribosylamine--glycine ligase
3hb9.1.A	9.78	homo-tetramer	HHblits	X-ray	2.90Å	0.26	0.33	Pyruvate carboxylase
3hb9.1.B	9.78	homo-tetramer	HHblits	X-ray	2.90Å	0.26	0.33	Pyruvate carboxylase
3hb9.1.C	9.78	homo-tetramer	HHblits	X-ray	2.90Å	0.26	0.33	Pyruvate carboxylase
3hb9.1.D	9.78	homo-tetramer	HHblits	X-ray	2.90Å	0.26	0.33	Pyruvate carboxylase
3gid.1.A	8.79	monomer	HHblits	X-ray	2.30Å	0.26	0.33	Acetyl-CoA carboxylase 2
3gid.2.A	8.79	monomer	HHblits	X-ray	2.30Å	0.26	0.33	Acetyl-CoA carboxylase 2
3glk.1.A	8.79	monomer	HHblits	X-ray	2.10Å	0.26	0.33	Acetyl-CoA carboxylase 2
5kkn.2.A	8.79	monomer	HHblits	X-ray	2.60Å	0.26	0.33	Acetyl-CoA carboxylase 2
5kkn.1.A	8.79	monomer	HHblits	X-ray	2.60Å	0.26	0.33	Acetyl-CoA carboxylase 2
3n6r.1.A	17.98	hetero-oligomer	HHblits	X-ray	3.20Å	0.28	0.32	Propionyl-CoA carboxylase, alpha subunit
2yl2.1.A	8.79	monomer	HHblits	X-ray	2.30Å	0.26	0.33	ACETYL-COA CARBOXYLASE 1
2yl2.2.A	8.79	monomer	HHblits	X-ray	2.30Å	0.26	0.33	ACETYL-COA CARBOXYLASE 1
3lp8.1.A	18.18	monomer	HHblits	X-ray	2.15Å	0.28	0.32	Phosphoribosylamine-glycine ligase
2ip4.1.A	14.61	monomer	HHblits	X-ray	2.80Å	0.27	0.32	Phosphoribosylamine--glycine ligase
2ip4.2.A	14.61	monomer	HHblits	X-ray	2.80Å	0.27	0.32	Phosphoribosylamine--glycine ligase
4qsl.1.A	10.11	homo-tetramer	HHblits	X-ray	3.28Å	0.27	0.32	Pyruvate carboxylase
4qsl.1.B	10.11	homo-tetramer	HHblits	X-ray	3.28Å	0.27	0.32	Pyruvate carboxylase
4qsl.1.C	10.11	homo-tetramer	HHblits	X-ray	3.28Å	0.27	0.32	Pyruvate carboxylase
4qsl.1.D	10.11	homo-tetramer	HHblits	X-ray	3.28Å	0.27	0.32	Pyruvate carboxylase
5mlk.1.A	12.36	homo-dimer	HHblits	X-ray	1.94Å	0.27	0.32	Acetyl-COA carboxylase
5tov.1.A	15.91	homo-tetramer	HHblits	X-ray	1.90Å	0.27	0.32	Adenosylhomocysteinase
5tov.1.B	15.91	homo-tetramer	HHblits	X-ray	1.90Å	0.27	0.32	Adenosylhomocysteinase
1ulz.1.A	5.56	homo-dimer	HHblits	X-ray	2.20Å	0.25	0.33	pyruvate carboxylase n-terminal domain
2dzd.1.A	7.69	homo-dimer	HHblits	X-ray	2.40Å	0.25	0.33	pyruvate carboxylase
2c00.1.A	9.78	monomer	HHblits	X-ray	2.50Å	0.24	0.33	BIOTIN CARBOXYLASE
2c00.2.A	9.78	monomer	HHblits	X-ray	2.50Å	0.24	0.33	BIOTIN CARBOXYLASE
2vqd.1.A	9.78	monomer	HHblits	X-ray	2.41Å	0.24	0.33	BIOTIN CARBOXYLASE
2hjs.1.A	13.64	homo-dimer	HHblits	X-ray	2.20Å	0.27	0.32	USG-1 protein homolog
3kux.1.A	15.91	monomer	HHblits	X-ray	2.75Å	0.27	0.32	Putative oxidoreductase
2ys6.1.A	12.36	monomer	HHblits	X-ray	2.21Å	0.26	0.32	Phosphoribosylglycinamide synthetase
4qsk.1.A	10.34	homo-tetramer	HHblits	X-ray	2.70Å	0.28	0.32	Pyruvate carboxylase
2yya.1.A	7.95	monomer	HHblits	X-ray	2.40Å	0.27	0.32	Phosphoribosylamine--glycine ligase
4mv4.2.A	11.36	monomer	HHblits	X-ray	1.61Å	0.26	0.32	Biotin carboxylase
3fd8.1.A	16.09	homo-hexamer	HHblits	X-ray	2.45Å	0.27	0.32	Oxidoreductase, Gfo/Idh/MocA family
3u9s.1.A	7.78	hetero-oligomer	HHblits	X-ray	3.50Å	0.24	0.33	Methylcrotonyl-CoA carboxylase, alpha-subunit
3u9t.1.A	7.78	hetero-oligomer	HHblits	X-ray	2.90Å	0.24	0.33	Methylcrotonyl-CoA carboxylase, alpha-subunit
4dim.1.A	13.64	monomer	HHblits	X-ray	2.61Å	0.26	0.32	Phosphoribosylglycinamide synthetase
3ouu.1.A	14.77	homo-dimer	HHblits	X-ray	2.25Å	0.26	0.32	Biotin carboxylase
1z7e.1.B	7.69	homo-hexamer	HHblits	X-ray	3.00Å	0.23	0.33	protein ArnA
1z7e.1.A	7.69	homo-hexamer	HHblits	X-ray	3.00Å	0.23	0.33	protein ArnA
1z7e.1.F	7.69	homo-hexamer	HHblits	X-ray	3.00Å	0.23	0.33	protein ArnA
4wkg.1.D	7.69	homo-hexamer	HHblits	X-ray	2.70Å	0.23	0.33	Bifunctional polymyxin resistance protein ArnA
4wkg.1.E	7.69	homo-hexamer	HHblits	X-ray	2.70Å	0.23	0.33	Bifunctional polymyxin resistance protein ArnA
4wkg.1.F	7.69	homo-hexamer	HHblits	X-ray	2.70Å	0.23	0.33	Bifunctional polymyxin resistance protein ArnA
4wkg.1.B	7.69	homo-hexamer	HHblits	X-ray	2.70Å	0.23	0.33	Bifunctional polymyxin resistance protein ArnA
4wkg.1.C	7.69	homo-hexamer	HHblits	X-ray	2.70Å	0.23	0.33	Bifunctional polymyxin resistance protein ArnA
2vpq.1.A	4.49	homo-dimer	HHblits	X-ray	2.10Å	0.25	0.32	ACETYL-COA CARBOXYLASE
2xcl.1.A	11.36	monomer	HHblits	X-ray	2.10Å	0.26	0.32	PHOSPHORIBOSYLAMINE--GLYCINE LIGASE
5h80.1.A	8.99	homo-dimer	HHblits	X-ray	1.70Å	0.25	0.32	Carboxylase
3g8d.1.A	11.36	monomer	HHblits	X-ray	1.90Å	0.25	0.32	Biotin carboxylase
4kqc.1.A	19.51	monomer	HHblits	X-ray	1.62Å	0.31	0.30	Periplasmic binding protein/LacI transcriptional regulator
1nvm.1.B	15.29	hetero-oligomer	HHblits	X-ray	1.70Å	0.28	0.31	acetaldehyde dehydrogenase (acylating)
1nvm.2.B	15.29	hetero-oligomer	HHblits	X-ray	1.70Å	0.28	0.31	acetaldehyde dehydrogenase (acylating)
4iil.1.A	20.24	monomer	HHblits	X-ray	1.30Å	0.29	0.31	Membrane lipoprotein TpN38(b)
2jfy.1.B	11.63	homo-dimer	HHblits	X-ray	1.90Å	0.27	0.31	GLUTAMATE RACEMASE
2jfz.1.A	11.63	homo-dimer	HHblits	X-ray	1.86Å	0.27	0.31	GLUTAMATE RACEMASE
2jfx.1.A	11.63	homo-dimer	HHblits	X-ray	2.30Å	0.27	0.31	GLUTAMATE RACEMASE
2jfx.1.B	11.63	homo-dimer	HHblits	X-ray	2.30Å	0.27	0.31	GLUTAMATE RACEMASE
2jfy.1.A	11.63	homo-dimer	HHblits	X-ray	1.90Å	0.27	0.31	GLUTAMATE RACEMASE
4b1f.1.B	11.63	homo-dimer	HHblits	X-ray	2.05Å	0.27	0.31	GLUTAMATE RACEMASE
2w4i.1.A	11.63	homo-tetramer	HHblits	X-ray	1.87Å	0.27	0.31	GLUTAMATE RACEMASE
3sg0.1.A	20.99	monomer	HHblits	X-ray	1.20Å	0.31	0.29	Extracellular ligand-binding receptor
1h6c.1.A	16.67	homo-tetramer	HHblits	X-ray	2.20Å	0.28	0.31	PRECURSOR FORM OF GLUCOSE-FRUCTOSE OXIDOREDUCTASE
1kji.1.A	15.12	homo-dimer	HHblits	X-ray	1.60Å	0.26	0.31	phosphoribosylglycinamide formyltransferase 2
1kji.1.B	15.12	homo-dimer	HHblits	X-ray	1.60Å	0.26	0.31	phosphoribosylglycinamide formyltransferase 2
3g8c.1.A	9.09	monomer	HHblits	X-ray	2.00Å	0.24	0.32	Biotin carboxylase
3g8c.2.A	9.09	monomer	HHblits	X-ray	2.00Å	0.24	0.32	Biotin carboxylase
4r9x.1.A	16.87	homo-dimer	HHblits	X-ray	1.85Å	0.29	0.30	Copper homeostasis protein CutC
4r9x.1.B	16.87	homo-dimer	HHblits	X-ray	1.85Å	0.29	0.30	Copper homeostasis protein CutC
2r00.2.A	12.94	homo-dimer	HHblits	X-ray	2.03Å	0.27	0.31	Aspartate-semialdehyde dehydrogenase
2r00.1.B	12.94	homo-dimer	HHblits	X-ray	2.03Å	0.27	0.31	Aspartate-semialdehyde dehydrogenase
2r00.1.A	12.94	homo-dimer	HHblits	X-ray	2.03Å	0.27	0.31	Aspartate-semialdehyde dehydrogenase
5kws.1.A	23.46	monomer	HHblits	X-ray	1.32Å	0.30	0.29	Galactose-binding protein
2pn1.1.A	8.24	homo-dimer	HHblits	X-ray	2.00Å	0.26	0.31	Carbamoylphosphate synthase large subunit
4pz0.1.A	14.46	monomer	HHblits	X-ray	1.25Å	0.28	0.30	sugar ABC transporter, sugar-binding protein
3rv3.1.A	8.05	homo-dimer	HHblits	X-ray	1.91Å	0.24	0.32	Biotin carboxylase
3cea.1.A	14.29	homo-tetramer	HHblits	X-ray	2.40Å	0.27	0.31	Myo-inositol 2-dehydrogenase
4nv3.1.A	17.07	monomer	HHblits	X-ray	1.09Å	0.29	0.30	Amino acid/amide ABC transporter substrate-binding protein, HAAT family
2ipl.1.A	22.22	monomer	HHblits	X-ray	1.20Å	0.30	0.29	D-galactose-binding periplasmic protein
3ejw.1.A	12.05	monomer	HHblits	X-ray	1.80Å	0.28	0.30	SmLsrB
2pud.1.B	18.75	homo-dimer	HHblits	X-ray	2.60Å	0.30	0.29	PROTEIN (PURINE REPRESSOR)
3rc1.1.A	14.29	monomer	HHblits	X-ray	1.71Å	0.26	0.31	Sugar 3-ketoreductase
2hph.1.A	20.99	monomer	HHblits	X-ray	1.33Å	0.29	0.29	D-galactose-binding periplasmic protein
2ehj.1.A	16.25	homo-tetramer	HHblits	X-ray	2.80Å	0.30	0.29	Uracil phosphoribosyltransferase
2ehj.1.C	16.25	homo-tetramer	HHblits	X-ray	2.80Å	0.30	0.29	Uracil phosphoribosyltransferase
4obb.1.A	17.28	monomer	HHblits	X-ray	1.53Å	0.29	0.29	Amino acid/amide ABC transporter substrate-binding protein, HAAT family
2ipm.1.A	20.99	monomer	HHblits	X-ray	1.12Å	0.29	0.29	D-galactose-binding periplasmic protein
1bdi.1.B	18.75	homo-dimer	HHblits	X-ray	3.00Å	0.30	0.29	PROTEIN (PURINE REPRESSOR)
4zjp.1.A	22.50	monomer	HHblits	X-ray	1.63Å	0.30	0.29	Monosaccharide-transporting ATPase
4zpj.1.A	11.76	monomer	HHblits	X-ray	2.24Å	0.25	0.31	Extracellular ligand-binding receptor
2ipn.1.A	20.99	monomer	HHblits	X-ray	1.15Å	0.29	0.29	D-galactose-binding periplasmic protein
1tm2.1.A	8.43	monomer	HHblits	X-ray	1.90Å	0.27	0.30	sugar transport protein
1tjy.1.A	8.43	monomer	HHblits	X-ray	1.30Å	0.27	0.30	sugar transport protein
1o5o.1.A	16.05	homo-tetramer	HHblits	X-ray	2.30Å	0.29	0.29	Uracil phosphoribosyltransferase
3gfg.1.A	11.90	homo-dimer	HHblits	X-ray	2.59Å	0.26	0.31	Uncharacterized oxidoreductase yvaA
5e38.1.B	17.50	homo-tetramer	HHblits	X-ray	3.00Å	0.30	0.29	Uracil phosphoribosyltransferase
5e38.1.A	17.50	homo-tetramer	HHblits	X-ray	3.00Å	0.30	0.29	Uracil phosphoribosyltransferase
5e38.1.D	17.50	homo-tetramer	HHblits	X-ray	3.00Å	0.30	0.29	Uracil phosphoribosyltransferase
4wwh.1.A	17.28	monomer	HHblits	X-ray	1.20Å	0.29	0.29	ABC transporter
1jft.1.B	18.75	homo-dimer	HHblits	X-ray	2.50Å	0.30	0.29	PURINE NUCLEOTIDE SYNTHESIS REPRESSOR
1glg.1.A	22.50	monomer	HHblits	X-ray	2.00Å	0.30	0.29	GALACTOSE/GLUCOSE-BINDING PROTEIN
2qw1.1.A	22.50	monomer	HHblits	X-ray	1.70Å	0.30	0.29	D-galactose-binding periplasmic protein
2fvy.1.A	22.50	monomer	HHblits	X-ray	0.92Å	0.30	0.29	D-galactose-binding periplasmic protein
1jfs.1.B	18.75	homo-dimer	HHblits	X-ray	2.90Å	0.30	0.29	PURINE NUCLEOTIDE SYNTHESIS REPRESSOR
3q2k.1.A	20.00	homo-octamer	HHblits	X-ray	2.13Å	0.30	0.29	oxidoreductase
3q2k.1.B	20.00	homo-octamer	HHblits	X-ray	2.13Å	0.30	0.29	oxidoreductase
4wzz.1.A	17.50	monomer	HHblits	X-ray	1.70Å	0.29	0.29	Putative sugar ABC transporter, substrate-binding protein
3gbp.1.A	15.85	monomer	HHblits	X-ray	2.40Å	0.27	0.30	GALACTOSE-BINDING PROTEIN
1evj.1.A	15.85	homo-dimer	HHblits	X-ray	2.70Å	0.27	0.30	GLUCOSE-FRUCTOSE OXIDOREDUCTASE
4jb0.1.A	11.90	monomer	HHblits	X-ray	1.91Å	0.25	0.31	branched-chain amino acid transport system substrate-binding protein
3s99.1.A	13.41	monomer	HHblits	X-ray	2.05Å	0.27	0.30	Basic membrane lipoprotein
4n54.1.A	13.25	homo-tetramer	HHblits	X-ray	2.05Å	0.26	0.30	Inositol dehydrogenase
4n54.1.C	13.25	homo-tetramer	HHblits	X-ray	2.05Å	0.26	0.30	Inositol dehydrogenase
4n54.1.D	13.25	homo-tetramer	HHblits	X-ray	2.05Å	0.26	0.30	Inositol dehydrogenase
5dkv.1.A	21.25	monomer	HHblits	X-ray	1.68Å	0.29	0.29	ABC transporter substrate binding protein (Ribose)
5dkv.4.A	21.25	monomer	HHblits	X-ray	1.68Å	0.29	0.29	ABC transporter substrate binding protein (Ribose)
5odc.1.B	14.63	hetero-oligomer	HHblits	X-ray	2.30Å	0.27	0.30	Heterodisulfide reductase, subunit B
4nv3.1.A	6.02	monomer	HHblits	X-ray	1.09Å	0.26	0.30	Amino acid/amide ABC transporter substrate-binding protein, HAAT family
3ec7.1.A	15.19	homo-tetramer	HHblits	X-ray	2.15Å	0.30	0.29	Putative Dehydrogenase
2gx6.1.A	21.52	monomer	HHblits	X-ray	1.97Å	0.30	0.29	D-ribose-binding periplasmic protein
1xtu.1.A	15.00	homo-tetramer	HHblits	X-ray	2.80Å	0.28	0.29	Probable uracil phosphoribosyltransferase
3g6w.1.A	15.00	homo-tetramer	HHblits	X-ray	2.90Å	0.28	0.29	Uracil phosphoribosyltransferase
3g6w.1.B	15.00	homo-tetramer	HHblits	X-ray	2.90Å	0.28	0.29	Uracil phosphoribosyltransferase
1xtv.1.B	15.00	homo-tetramer	HHblits	X-ray	2.60Å	0.28	0.29	Probable uracil phosphoribosyltransferase
1xtv.1.C	15.00	homo-tetramer	HHblits	X-ray	2.60Å	0.28	0.29	Probable uracil phosphoribosyltransferase
1xtt.1.A	15.00	homo-tetramer	HHblits	X-ray	1.80Å	0.28	0.29	Probable uracil phosphoribosyltransferase
1xtt.1.B	15.00	homo-tetramer	HHblits	X-ray	1.80Å	0.28	0.29	Probable uracil phosphoribosyltransferase
1vst.1.A	15.00	homo-tetramer	HHblits	X-ray	2.80Å	0.28	0.29	Uracil phosphoribosyltransferase
3hut.1.A	13.58	monomer	HHblits	X-ray	1.93Å	0.27	0.29	putative branched-chain amino acid ABC transporter
4z0n.1.A	15.00	monomer	HHblits	X-ray	1.26Å	0.28	0.29	Periplasmic binding protein/LacI transcriptional regulator
1b73.1.A	18.75	homo-dimer	HHblits	X-ray	2.30Å	0.28	0.29	GLUTAMATE RACEMASE
3i45.1.A	13.10	monomer	HHblits	X-ray	1.36Å	0.24	0.31	Twin-arginine translocation pathway signal protein
5eqv.1.A	18.99	monomer	HHblits	X-ray	1.45Å	0.29	0.29	bifunctional 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase periplasmic precursor protein
3f4l.1.A	16.05	homo-dimer	HHblits	X-ray	2.00Å	0.26	0.29	Putative oxidoreductase yhhX
1vgv.1.B	12.35	homo-dimer	HHblits	X-ray	2.31Å	0.26	0.29	UDP-N-acetylglucosamine 2-epimerase
1vgv.1.A	12.35	homo-dimer	HHblits	X-ray	2.31Å	0.26	0.29	UDP-N-acetylglucosamine 2-epimerase
1vgv.2.B	12.35	homo-dimer	HHblits	X-ray	2.31Å	0.26	0.29	UDP-N-acetylglucosamine 2-epimerase
4gnr.1.A	11.25	monomer	HHblits	X-ray	1.00Å	0.27	0.29	ABC transporter substrate-binding protein-branched chain amino acid transport
1z16.1.A	11.25	monomer	HHblits	X-ray	1.72Å	0.27	0.29	Leu/Ile/Val-binding protein
1z15.1.A	11.25	monomer	HHblits	X-ray	1.70Å	0.27	0.29	Leu/Ile/Val-binding protein
3rc7.1.A	22.37	monomer	HHblits	X-ray	2.00Å	0.31	0.28	Sugar 3-ketoreductase
4ru1.1.A	19.23	monomer	HHblits	X-ray	1.50Å	0.29	0.28	Monosaccharide ABC transporter substrate-binding protein, CUT2 family
3uk0.1.A	12.50	monomer	HHblits	X-ray	1.49Å	0.27	0.29	Extracellular ligand-binding receptor
4jb0.1.A	11.25	monomer	HHblits	X-ray	1.91Å	0.27	0.29	branched-chain amino acid transport system substrate-binding protein
1f6d.1.B	12.50	homo-dimer	HHblits	X-ray	2.50Å	0.26	0.29	UDP-N-ACETYLGLUCOSAMINE 2-EPIMERASE
1f6d.1.A	12.50	homo-dimer	HHblits	X-ray	2.50Å	0.26	0.29	UDP-N-ACETYLGLUCOSAMINE 2-EPIMERASE
1ez1.1.A	15.19	homo-dimer	HHblits	X-ray	1.75Å	0.27	0.29	PHOSPHORIBOSYLGLYCINAMIDE FORMYLTRANSFERASE 2
1ez1.1.B	15.19	homo-dimer	HHblits	X-ray	1.75Å	0.27	0.29	PHOSPHORIBOSYLGLYCINAMIDE FORMYLTRANSFERASE 2
2hqb.1.A	12.66	monomer	HHblits	X-ray	2.70Å	0.27	0.29	Transcriptional activator of comK gene
3h5l.1.A	8.43	monomer	HHblits	X-ray	1.70Å	0.23	0.30	putative Branched-chain amino acid ABC transporter
4iq0.1.A	15.58	homo-dimer	HHblits	X-ray	2.00Å	0.29	0.28	Oxidoreductase, Gfo/Idh/MocA family
4iq0.2.B	15.58	homo-dimer	HHblits	X-ray	2.00Å	0.29	0.28	Oxidoreductase, Gfo/Idh/MocA family
2w6m.1.A	9.88	monomer	HHblits	X-ray	2.00Å	0.24	0.29	BIOTIN CARBOXYLASE
1bnc.1.B	9.88	homo-dimer	HHblits	X-ray	2.40Å	0.24	0.29	BIOTIN CARBOXYLASE
1bnc.1.A	9.88	homo-dimer	HHblits	X-ray	2.40Å	0.24	0.29	BIOTIN CARBOXYLASE
4hr7.1.A	9.88	hetero-oligomer	HHblits	X-ray	2.50Å	0.24	0.29	Biotin carboxylase
4hr7.1.C	9.88	hetero-oligomer	HHblits	X-ray	2.50Å	0.24	0.29	Biotin carboxylase
4hr7.1.E	9.88	hetero-oligomer	HHblits	X-ray	2.50Å	0.24	0.29	Biotin carboxylase
4hr7.1.F	9.88	hetero-oligomer	HHblits	X-ray	2.50Å	0.24	0.29	Biotin carboxylase
2j9g.2.A	9.88	monomer	HHblits	X-ray	2.05Å	0.24	0.29	BIOTIN CARBOXYLASE
2vr1.2.A	9.88	monomer	HHblits	X-ray	2.60Å	0.24	0.29	BIOTIN CARBOXYLASE
1qh1.1.B	12.82	hetero-oligomer	HHblits	X-ray	1.60Å	0.27	0.28	PROTEIN (NITROGENASE MOLYBDENUM IRON PROTEIN)
4irx.1.A	10.26	monomer	HHblits	X-ray	1.45Å	0.27	0.28	Sugar ABC transporter, periplasmic sugar-binding protein
3q2i.1.A	15.58	homo-octamer	HHblits	X-ray	1.50Å	0.28	0.28	dehydrogenase
3tx6.1.A	11.54	monomer	HHblits	X-ray	1.50Å	0.27	0.28	Putative branched-chain amino acid transport system substrate-binding protein
5ide.1.A	8.64	hetero-oligomer	HHblits	EM	NA	0.24	0.29	Glutamate receptor 2
5ide.1.C	8.64	hetero-oligomer	HHblits	EM	NA	0.24	0.29	Glutamate receptor 2
5idf.1.A	8.64	hetero-oligomer	HHblits	EM	NA	0.24	0.29	Glutamate receptor 2
5idf.1.C	8.64	hetero-oligomer	HHblits	EM	NA	0.24	0.29	Glutamate receptor 2
3aer.1.B	17.95	hetero-oligomer	HHblits	X-ray	2.80Å	0.27	0.28	Light-independent protochlorophyllide reductase subunit B
3aeq.1.B	17.95	hetero-oligomer	HHblits	X-ray	2.90Å	0.27	0.28	Light-independent protochlorophyllide reductase subunit B
3aek.1.B	17.95	hetero-oligomer	HHblits	X-ray	2.30Å	0.27	0.28	Light-independent protochlorophyllide reductase subunit B
3aeu.1.B	17.95	hetero-oligomer	HHblits	X-ray	2.90Å	0.27	0.28	Light-independent protochlorophyllide reductase subunit B
1gub.1.A	8.86	monomer	HHblits	X-ray	3.10Å	0.26	0.29	D-ALLOSE-BINDING PERIPLASMIC PROTEIN
1gud.1.A	8.86	monomer	HHblits	X-ray	1.71Å	0.26	0.29	D-ALLOSE-BINDING PERIPLASMIC PROTEIN
1gud.2.A	8.86	monomer	HHblits	X-ray	1.71Å	0.26	0.29	D-ALLOSE-BINDING PERIPLASMIC PROTEIN
1rpj.1.A	8.86	monomer	HHblits	X-ray	1.80Å	0.26	0.29	PROTEIN (PRECURSOR OF PERIPLASMIC SUGAR RECEPTOR)
4u5b.1.A	6.25	hetero-oligomer	HHblits	X-ray	3.50Å	0.24	0.29	Glutamate receptor 2
4u5b.1.B	6.25	hetero-oligomer	HHblits	X-ray	3.50Å	0.24	0.29	Glutamate receptor 2
4u5b.1.C	6.25	hetero-oligomer	HHblits	X-ray	3.50Å	0.24	0.29	Glutamate receptor 2
4u5b.1.D	6.25	hetero-oligomer	HHblits	X-ray	3.50Å	0.24	0.29	Glutamate receptor 2
4eyk.1.A	11.69	monomer	HHblits	X-ray	1.90Å	0.26	0.28	Twin-arginine translocation pathway signal
5vev.1.A	9.09	monomer	HHblits	X-ray	1.90Å	0.26	0.28	Phosphoribosylamine--glycine ligase
3q2i.1.A	14.29	homo-octamer	HHblits	X-ray	1.50Å	0.26	0.28	dehydrogenase
3qlv.1.C	16.22	hetero-oligomer	HHblits	X-ray	3.94Å	0.29	0.27	Glutamate receptor, ionotropic kainate 2
3h6g.1.A	16.22	homo-dimer	HHblits	X-ray	2.70Å	0.29	0.27	Glutamate receptor, ionotropic kainate 2
3h6h.1.A	16.22	homo-dimer	HHblits	X-ray	2.90Å	0.29	0.27	Glutamate receptor, ionotropic kainate 2
3uvz.1.A	13.16	homo-dimer	HHblits	X-ray	2.20Å	0.27	0.28	Phosphoribosylaminoimidazole carboxylase, ATPase subunit
4mkx.1.A	13.16	homo-tetramer	HHblits	X-ray	1.60Å	0.27	0.28	Inositol dehydrogenase
3p74.1.A	14.67	monomer	HHblits	X-ray	1.20Å	0.28	0.27	Pentaerythritol tetranitrate reductase
2abb.1.A	14.67	monomer	HHblits	X-ray	1.00Å	0.28	0.27	pentaerythritol tetranitrate reductase
1vys.1.A	14.67	monomer	HHblits	X-ray	1.80Å	0.28	0.27	PENTAERYTHRITOL TETRANITRATE REDUCTASE
3p81.1.A	14.67	monomer	HHblits	X-ray	1.20Å	0.28	0.27	Pentaerythritol tetranitrate reductase
1gpw.1.A	5.26	hetero-oligomer	HHblits	X-ray	2.40Å	0.26	0.28	HISF PROTEIN
1gpw.3.A	5.26	hetero-oligomer	HHblits	X-ray	2.40Å	0.26	0.28	HISF PROTEIN
2y85.1.A	12.99	monomer	HHblits	X-ray	2.40Å	0.25	0.28	PHOSPHORIBOSYL ISOMERASE A
3zs4.1.A	12.99	monomer	HHblits	X-ray	1.90Å	0.25	0.28	PHOSPHORIBOSYL ISOMERASE A
5kuh.1.A	16.22	homo-tetramer	HHblits	EM	NA	0.28	0.27	Glutamate receptor ionotropic, kainate 2
5kuh.1.B	16.22	homo-tetramer	HHblits	EM	NA	0.28	0.27	Glutamate receptor ionotropic, kainate 2
3gka.1.A	20.00	monomer	HHblits	X-ray	2.30Å	0.27	0.27	N-ethylmaleimide reductase
1vyp.1.A	14.86	monomer	HHblits	X-ray	1.27Å	0.28	0.27	PENTAERYTHRITOL TETRANITRATE REDUCTASE
3p67.1.A	13.51	monomer	HHblits	X-ray	1.50Å	0.28	0.27	Pentaerythritol tetranitrate reductase
4nut.1.A	16.22	hetero-oligomer	HHblits	X-ray	1.55Å	0.27	0.27	13 kDa ribonucleoprotein-associated protein
3p8i.1.A	12.33	monomer	HHblits	X-ray	1.19Å	0.28	0.27	Pentaerythritol tetranitrate reductase
3p62.1.A	12.33	monomer	HHblits	X-ray	1.40Å	0.28	0.27	Pentaerythritol tetranitrate reductase
2aif.1.A	17.57	monomer	HHblits	X-ray	1.89Å	0.27	0.27	ribosomal protein L7A
2aba.1.A	12.33	monomer	HHblits	X-ray	1.05Å	0.28	0.27	pentaerythritol tetranitrate reductase
4zqi.2.A	20.83	homo-dimer	HHblits	X-ray	2.30Å	0.29	0.26	D-alanine--D-alanine ligase
4zqi.1.A	20.83	homo-dimer	HHblits	X-ray	2.30Å	0.29	0.26	D-alanine--D-alanine ligase
5bph.1.B	20.83	homo-dimer	HHblits	X-ray	1.70Å	0.29	0.26	D-alanine--D-alanine ligase
5lfa.1.A	12.00	monomer	HHblits	X-ray	2.50Å	0.25	0.27	(6-4) photolyase
4izo.1.A	15.28	monomer	HHblits	X-ray	1.85Å	0.29	0.26	Phosphoribosylaminoimidazole carboxylase, ATPase subunit
3p82.1.A	12.33	monomer	HHblits	X-ray	2.20Å	0.27	0.27	Pentaerythritol tetranitrate reductase
3p84.1.A	12.33	monomer	HHblits	X-ray	1.10Å	0.27	0.27	Pentaerythritol tetranitrate reductase
3ec7.1.A	11.27	homo-tetramer	HHblits	X-ray	2.15Å	0.29	0.26	Putative Dehydrogenase
5lgx.1.A	15.49	monomer	HHblits	X-ray	1.50Å	0.29	0.26	Pentaerythritol tetranitrate reductase
4ab4.1.A	18.92	monomer	HHblits	X-ray	1.50Å	0.26	0.27	XENOBIOTIC REDUCTASE B
3p8j.1.A	11.11	monomer	HHblits	X-ray	1.00Å	0.27	0.26	Pentaerythritol tetranitrate reductase
3u4f.1.A	18.57	homo-dimer	HHblits	X-ray	1.90Å	0.29	0.25	Mandelate racemase/muconate lactonizing enzyme family protein
3t8q.1.A	21.74	homo-dimer	HHblits	X-ray	2.00Å	0.30	0.25	Mandelate racemase/muconate lactonizing enzyme family protein
3wgi.1.B	13.89	homo-dimer	HHblits	X-ray	3.25Å	0.27	0.26	Redox-sensing transcriptional repressor rex
3wg9.2.A	13.89	homo-dimer	HHblits	X-ray	1.97Å	0.27	0.26	Redox-sensing transcriptional repressor rex
3wg9.2.B	13.89	homo-dimer	HHblits	X-ray	1.97Å	0.27	0.26	Redox-sensing transcriptional repressor rex
3wgh.1.B	13.89	homo-dimer	HHblits	X-ray	2.05Å	0.27	0.26	Redox-sensing transcriptional repressor rex
3wgg.1.A	13.89	homo-dimer	HHblits	X-ray	2.10Å	0.27	0.26	Redox-sensing transcriptional repressor rex
3wgg.1.B	13.89	homo-dimer	HHblits	X-ray	2.10Å	0.27	0.26	Redox-sensing transcriptional repressor rex
4iyj.1.A	23.53	homo-dimer	HHblits	X-ray	1.37Å	0.31	0.25	GDSL-like protein
3n0x.1.A	8.00	monomer	HHblits	X-ray	1.50Å	0.24	0.27	Possible substrate binding protein of ABC transporter system
3rcb.1.A	11.11	monomer	HHblits	X-ray	2.49Å	0.26	0.26	Sugar 3-ketoreductase
3tcs.1.A	18.84	homo-dimer	HHblits	X-ray	1.88Å	0.29	0.25	Racemase, putative
3nnd.1.A	8.11	homo-tetramer	HHblits	X-ray	2.80Å	0.24	0.27	Possible substrate binding protein of ABC transporter system
4e6m.1.A	11.43	homo-octamer	HHblits	X-ray	1.80Å	0.28	0.25	Putative dehydratase protein
3sbf.1.A	17.14	homo-dimer	HHblits	X-ray	1.50Å	0.28	0.25	mandelate racemase / muconate lactonizing enzyme
1ofg.1.A	12.68	homo-tetramer	HHblits	X-ray	2.70Å	0.26	0.26	GLUCOSE-FRUCTOSE OXIDOREDUCTASE
4nas.1.A	12.86	homo-dimer	HHblits	X-ray	1.92Å	0.27	0.25	Ribulose-bisphosphate carboxylase
1m1b.1.A	12.68	homo-tetramer	HHblits	X-ray	2.25Å	0.26	0.26	PHOSPHOENOLPYRUVATE PHOSPHOMUTASE
1s2v.1.A	12.68	homo-tetramer	HHblits	X-ray	2.10Å	0.26	0.26	Phosphoenolpyruvate phosphomutase
1s2w.1.A	12.68	monomer	HHblits	X-ray	1.69Å	0.26	0.26	Phosphoenolpyruvate phosphomutase
3rc9.1.A	9.72	monomer	HHblits	X-ray	1.91Å	0.25	0.26	Sugar 3-ketoreductase
3nkl.1.A	15.94	homo-dimer	HHblits	X-ray	1.90Å	0.28	0.25	UDP-D-quinovosamine 4-dehydrogenase
3nkl.1.B	15.94	homo-dimer	HHblits	X-ray	1.90Å	0.28	0.25	UDP-D-quinovosamine 4-dehydrogenase
2eq5.1.A	14.49	homo-dimer	HHblits	X-ray	2.20Å	0.28	0.25	228aa long hypothetical hydantoin racemase
2eq5.2.B	14.49	homo-dimer	HHblits	X-ray	2.20Å	0.28	0.25	228aa long hypothetical hydantoin racemase
3t9p.1.A	18.84	homo-dimer	HHblits	X-ray	1.97Å	0.28	0.25	Mandelate racemase/muconate lactonizing enzyme family protein
4mg4.1.A	15.49	homo-dimer	HHblits	X-ray	1.70Å	0.26	0.26	Phosphonomutase
4mg4.2.B	15.49	homo-dimer	HHblits	X-ray	1.70Å	0.26	0.26	Phosphonomutase
3dfh.1.A	14.29	homo-octamer	HHblits	X-ray	2.20Å	0.27	0.25	mandelate racemase
1ryd.1.A	11.27	homo-tetramer	HHblits	X-ray	2.20Å	0.26	0.26	glucose-fructose oxidoreductase
1rye.1.B	11.27	homo-tetramer	HHblits	X-ray	2.30Å	0.26	0.26	glucose-fructose oxidoreductase
1rye.1.A	11.27	homo-tetramer	HHblits	X-ray	2.30Å	0.26	0.26	glucose-fructose oxidoreductase
3r25.1.A	14.29	homo-dimer	HHblits	X-ray	1.60Å	0.27	0.25	mandelate racemase / muconate lactonizing enzyme
3tji.1.A	14.29	homo-octamer	HHblits	X-ray	1.80Å	0.26	0.25	Mandelate racemase/muconate lactonizing enzyme, N-terminal domain protein
3e9m.1.A	5.63	homo-dimer	HHblits	X-ray	2.70Å	0.25	0.26	Oxidoreductase, Gfo/Idh/MocA family
3e9m.1.B	5.63	homo-dimer	HHblits	X-ray	2.70Å	0.25	0.26	Oxidoreductase, Gfo/Idh/MocA family
3e9m.2.A	5.63	homo-dimer	HHblits	X-ray	2.70Å	0.25	0.26	Oxidoreductase, Gfo/Idh/MocA family
5unc.1.A	7.04	homo-tetramer	HHblits	X-ray	1.71Å	0.25	0.26	PHOSPHOENOLPYRUVATE PHOSPHOMUTASE
4hf7.1.A	19.40	homo-dimer	HHblits	X-ray	1.77Å	0.29	0.24	Putative acylhydrolase
3rc7.1.A	13.04	monomer	HHblits	X-ray	2.00Å	0.27	0.25	Sugar 3-ketoreductase
4gir.1.A	11.43	homo-octamer	HHblits	X-ray	2.00Å	0.26	0.25	Enolase
3t4w.1.A	11.59	homo-octamer	HHblits	X-ray	2.52Å	0.27	0.25	Mandelate racemase/muconate lactonizing enzyme family protein
2oek.1.A	8.70	homo-dimer	HHblits	X-ray	1.80Å	0.26	0.25	2,3-diketo-5-methylthiopentyl-1-phosphate enolase
4iq0.1.A	14.93	homo-dimer	HHblits	X-ray	2.00Å	0.29	0.24	Oxidoreductase, Gfo/Idh/MocA family
4iq0.2.B	14.93	homo-dimer	HHblits	X-ray	2.00Å	0.29	0.24	Oxidoreductase, Gfo/Idh/MocA family
2ho5.1.A	14.93	homo-dimer	HHblits	X-ray	2.56Å	0.29	0.24	Oxidoreductase, Gfo/Idh/MocA family
4ppy.1.A	17.91	homo-dimer	HHblits	X-ray	2.00Å	0.29	0.24	Putative acylhydrolase
3s47.1.A	11.43	homo-dimer	HHblits	X-ray	1.70Å	0.25	0.25	Mandelate racemase/muconate lactonizing protein
3gy1.1.A	11.43	homo-octamer	HHblits	X-ray	1.60Å	0.25	0.25	Mandelate racemase/muconate lactonizing protein
1v2g.1.A	14.71	monomer	HHblits	X-ray	2.00Å	0.28	0.25	Acyl-CoA thioesterase I
2pge.1.A	10.00	monomer	HHblits	X-ray	1.60Å	0.25	0.25	MenC
1j00.1.A	17.91	monomer	HHblits	X-ray	2.00Å	0.28	0.24	Thioesterase I
1u8u.1.A	17.91	monomer	HHblits	X-ray	2.08Å	0.28	0.24	Acyl-CoA thioesterase I
3ssz.1.A	11.59	homo-octamer	HHblits	X-ray	2.39Å	0.26	0.25	Mandelate racemase/muconate lactonizing enzyme, N-terminal domain protein
4h1z.1.A	10.14	homo-octamer	HHblits	X-ray	2.01Å	0.26	0.25	Enolase Q92Zs5
2ppg.1.A	10.14	homo-octamer	HHblits	X-ray	2.49Å	0.26	0.25	Putative isomerase
2ppg.1.C	10.14	homo-octamer	HHblits	X-ray	2.49Å	0.26	0.25	Putative isomerase
3rr1.1.A	12.86	homo-octamer	HHblits	X-ray	1.95Å	0.25	0.25	Putative D-galactonate dehydratase
2o14.1.A	16.42	monomer	HHblits	X-ray	2.10Å	0.28	0.24	Hypothetical protein yxiM
3rcy.1.A	8.70	homo-octamer	HHblits	X-ray	1.99Å	0.25	0.25	Mandelate racemase/muconate lactonizing enzyme-like protein
3qlt.1.A	15.15	homo-dimer	HHblits	X-ray	2.99Å	0.29	0.24	Glutamate receptor, ionotropic kainate 2
3qlu.1.B	15.15	hetero-oligomer	HHblits	X-ray	2.91Å	0.29	0.24	Glutamate receptor, ionotropic kainate 2
4kem.1.A	10.14	homo-dimer	HHblits	X-ray	1.30Å	0.25	0.25	Mandelate racemase/muconate lactonizing enzyme
1r3r.1.A	18.46	homo-dimer	HHblits	X-ray	1.85Å	0.30	0.24	Uroporphyrinogen Decarboxylase
1r3w.1.A	18.46	homo-dimer	HHblits	X-ray	1.70Å	0.30	0.24	Uroporphyrinogen Decarboxylase
1r3s.1.A	18.46	homo-dimer	HHblits	X-ray	1.65Å	0.30	0.24	Uroporphyrinogen Decarboxylase
4il2.1.A	5.71	homo-octamer	HHblits	X-ray	1.95Å	0.24	0.25	Starvation sensing protein rspA
3q2k.1.A	16.42	homo-octamer	HHblits	X-ray	2.13Å	0.27	0.24	oxidoreductase
3q2k.1.B	16.42	homo-octamer	HHblits	X-ray	2.13Å	0.27	0.24	oxidoreductase
3ugv.1.A	4.29	homo-octamer	HHblits	X-ray	2.30Å	0.24	0.25	Enolase
1yzf.1.A	18.18	monomer	HHblits	X-ray	1.90Å	0.28	0.24	lipase/acylhydrolase
5b5s.1.A	19.70	monomer	HHblits	X-ray	1.50Å	0.28	0.24	Acetic acid
4e38.1.A	20.00	homo-trimer	HHblits	X-ray	1.64Å	0.29	0.24	Keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase
4e38.1.C	20.00	homo-trimer	HHblits	X-ray	1.64Å	0.29	0.24	Keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase
2uyy.1.A	15.15	homo-tetramer	HHblits	X-ray	2.50Å	0.28	0.24	N-PAC PROTEIN
5fwy.1.B	12.31	hetero-oligomer	HHblits	X-ray	2.12Å	0.29	0.24	GLUTAMATE RECEPTOR 3
4j3z.1.A	10.14	homo-octamer	HHblits	X-ray	2.50Å	0.24	0.25	Mandelate racemase/muconate lactonizing enzyme
3gw0.1.A	18.75	homo-dimer	HHblits	X-ray	2.00Å	0.30	0.23	Uroporphyrinogen decarboxylase
5ide.1.B	10.61	hetero-oligomer	HHblits	EM	NA	0.27	0.24	Glutamate receptor 3
5ide.1.D	10.61	hetero-oligomer	HHblits	EM	NA	0.27	0.24	Glutamate receptor 3
5idf.1.B	10.61	hetero-oligomer	HHblits	EM	NA	0.27	0.24	Glutamate receptor 3
5idf.1.D	10.61	hetero-oligomer	HHblits	EM	NA	0.27	0.24	Glutamate receptor 3
3stp.1.A	8.82	homo-octamer	HHblits	X-ray	1.88Å	0.25	0.25	Galactonate dehydratase, putative
4e5t.1.A	11.76	homo-octamer	HHblits	X-ray	2.90Å	0.25	0.25	Mandelate racemase / muconate lactonizing enzyme, C-terminal domain protein
2ax4.1.A	22.95	homo-dimer	HHblits	X-ray	2.50Å	0.30	0.22	Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthetase 2
3lft.1.A	12.50	monomer	HHblits	X-ray	1.35Å	0.26	0.23	uncharacterized protein
3gw3.1.A	16.13	homo-dimer	HHblits	X-ray	1.70Å	0.29	0.23	Uroporphyrinogen decarboxylase
2gzm.1.A	17.74	homo-dimer	HHblits	X-ray	1.99Å	0.29	0.23	Glutamate racemase
2gzm.1.B	17.74	homo-dimer	HHblits	X-ray	1.99Å	0.29	0.23	Glutamate racemase
2gzm.2.B	17.74	homo-dimer	HHblits	X-ray	1.99Å	0.29	0.23	Glutamate racemase
3gvv.1.A	16.13	homo-dimer	HHblits	X-ray	2.80Å	0.28	0.23	Uroporphyrinogen decarboxylase
3qlt.1.A	21.31	homo-dimer	HHblits	X-ray	2.99Å	0.30	0.22	Glutamate receptor, ionotropic kainate 2
3qlu.1.B	21.31	hetero-oligomer	HHblits	X-ray	2.91Å	0.30	0.22	Glutamate receptor, ionotropic kainate 2
3qlv.1.C	21.31	hetero-oligomer	HHblits	X-ray	3.94Å	0.30	0.22	Glutamate receptor, ionotropic kainate 2
3h6g.1.A	21.31	homo-dimer	HHblits	X-ray	2.70Å	0.30	0.22	Glutamate receptor, ionotropic kainate 2
3h6h.1.A	21.31	homo-dimer	HHblits	X-ray	2.90Å	0.30	0.22	Glutamate receptor, ionotropic kainate 2
3gvq.1.A	16.39	homo-dimer	HHblits	X-ray	2.10Å	0.29	0.22	Uroporphyrinogen decarboxylase
1r3v.1.A	16.39	homo-dimer	HHblits	X-ray	1.90Å	0.29	0.22	Uroporphyrinogen Decarboxylase
1jpk.1.A	16.39	homo-dimer	HHblits	X-ray	2.20Å	0.29	0.22	UROPORPHYRINOGEN DECARBOXYLASE
4u63.1.A	11.11	monomer	HHblits	X-ray	1.67Å	0.26	0.23	DNA photolyase
1omo.1.A	16.13	homo-dimer	HHblits	X-ray	2.32Å	0.27	0.23	alanine dehydrogenase
1omo.1.B	16.13	homo-dimer	HHblits	X-ray	2.32Å	0.27	0.23	alanine dehydrogenase
4k3u.1.A	7.81	monomer	HHblits	X-ray	2.16Å	0.24	0.23	GDSL-like Lipase/Acylhydrolase family protein
4fq5.1.A	11.48	homo-tetramer	HHblits	X-ray	2.10Å	0.27	0.22	Maleate cis-trans isomerase
4fq5.1.B	11.48	homo-tetramer	HHblits	X-ray	2.10Å	0.27	0.22	Maleate cis-trans isomerase
5o8e.1.A	11.48	monomer	HHblits	X-ray	1.70Å	0.26	0.22	Deoxyribodipyrimidine photolyase
4rfv.1.A	16.95	homo-dimer	HHblits	X-ray	1.69Å	0.27	0.21	Bifunctional enzyme CysN/CysC
2vpt.1.A	11.86	homo-dimer	HHblits	X-ray	1.40Å	0.26	0.21	LIPOLYTIC ENZYME
1m7h.4.B	23.64	homo-tetramer	HHblits	X-ray	2.00Å	0.31	0.20	Adenylylsulfate kinase
1d6j.1.B	23.64	homo-dimer	HHblits	X-ray	2.00Å	0.31	0.20	ADENOSINE-5'PHOSPHOSULFATE KINASE
1d6j.1.A	23.64	homo-dimer	HHblits	X-ray	2.00Å	0.31	0.20	ADENOSINE-5'PHOSPHOSULFATE KINASE
1m7h.4.C	23.64	homo-tetramer	HHblits	X-ray	2.00Å	0.31	0.20	Adenylylsulfate kinase
1m7g.5.A	23.64	homo-tetramer	HHblits	X-ray	1.43Å	0.31	0.20	Adenylylsulfate kinase
2xec.1.A	22.22	homo-dimer	HHblits	X-ray	2.20Å	0.30	0.20	PUTATIVE MALEATE ISOMERASE
4mwa.1.A	18.52	homo-tetramer	HHblits	X-ray	1.85Å	0.30	0.20	4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
4mwa.1.B	18.52	homo-tetramer	HHblits	X-ray	1.85Å	0.30	0.20	4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
4mwa.1.C	18.52	homo-tetramer	HHblits	X-ray	1.85Å	0.30	0.20	4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
4mwa.1.D	18.52	homo-tetramer	HHblits	X-ray	1.85Å	0.30	0.20	4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
4mwa.2.B	18.52	homo-tetramer	HHblits	X-ray	1.85Å	0.30	0.20	4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
4mwa.2.D	18.52	homo-tetramer	HHblits	X-ray	1.85Å	0.30	0.20	4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
1vhc.1.A	14.04	homo-trimer	HHblits	X-ray	1.89Å	0.26	0.21	Putative KHG/KDPG aldolase
1wau.1.A	10.53	homo-trimer	HHblits	X-ray	2.80Å	0.25	0.21	KHG/KDPG ALDOLASE
1yht.1.A	15.09	monomer	HHblits	X-ray	2.00Å	0.31	0.19	DspB
4ix1.1.A	12.50	homo-dimer	HHblits	X-ray	2.80Å	0.26	0.20	hypothetical protein
4ix1.1.B	12.50	homo-dimer	HHblits	X-ray	2.80Å	0.26	0.20	hypothetical protein
2vpt.1.A	7.02	homo-dimer	HHblits	X-ray	1.40Å	0.25	0.21	LIPOLYTIC ENZYME
1wbh.1.A	10.53	homo-trimer	HHblits	X-ray	1.55Å	0.25	0.21	KHG/KDPG ALDOLASE
5im5.1.P	14.55	hetero-oligomer	HHblits	X-ray	3.70Å	0.27	0.20	Designed Keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase
4yv7.1.A	16.07	monomer	HHblits	X-ray	2.30Å	0.25	0.20	Periplasmic binding protein/LacI transcriptional regulator
3noy.1.A	14.81	homo-dimer	HHblits	X-ray	2.70Å	0.28	0.20	4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
3noy.2.A	14.81	homo-dimer	HHblits	X-ray	2.70Å	0.28	0.20	4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
4fq7.1.A	15.09	homo-tetramer	HHblits	X-ray	3.00Å	0.29	0.19	Maleate cis-trans isomerase
2xed.1.A	21.15	monomer	HHblits	X-ray	1.95Å	0.30	0.19	PUTATIVE MALEATE ISOMERASE
4e38.1.A	15.09	homo-trimer	HHblits	X-ray	1.64Å	0.28	0.19	Keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase
4e38.1.C	15.09	homo-trimer	HHblits	X-ray	1.64Å	0.28	0.19	Keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase
4bk9.1.A	16.67	homo-trimer	HHblits	X-ray	2.77Å	0.26	0.20	2-DEHYDRO-3-DEOXYPHOSPHOGLUCONATE ALDOLASE/4-HYDROXY-2-OXO GLUTARATE ALDOLASE
3bol.1.A	11.76	homo-dimer	HHblits	X-ray	1.85Å	0.30	0.19	5-methyltetrahydrofolate S-homocysteine methyltransferase
1q7m.2.A	11.76	monomer	HHblits	X-ray	2.10Å	0.30	0.19	5-methyltetrahydrofolate S-homocysteine methyltransferase
1q7q.1.A	11.76	monomer	HHblits	X-ray	3.10Å	0.30	0.19	5-methyltetrahydrofolate S-homocysteine methyltransferase
1q8a.2.A	11.76	monomer	HHblits	X-ray	1.70Å	0.30	0.19	5-methyltetrahydrofolate S-homocysteine methyltransferase
1fq0.1.A	11.11	homo-trimer	HHblits	X-ray	2.10Å	0.25	0.20	KDPG ALDOLASE
1eua.1.C	11.11	homo-trimer	HHblits	X-ray	1.95Å	0.25	0.20	KDPG ALDOLASE
1fwr.1.A	11.32	homo-trimer	HHblits	X-ray	2.70Å	0.26	0.19	KDPG ALDOLASE
4x00.1.A	13.46	monomer	HHblits	X-ray	1.38Å	0.27	0.19	Putative hydrolase
1mxs.1.A	22.00	homo-trimer	HHblits	X-ray	2.20Å	0.29	0.18	KDPG Aldolase
3fph.1.A	14.29	homo-dimer	HHblits	X-ray	1.80Å	0.29	0.18	Putative uncharacterized protein
3fph.1.B	14.29	homo-dimer	HHblits	X-ray	1.80Å	0.29	0.18	Putative uncharacterized protein
3fpj.1.B	14.29	homo-dimer	HHblits	X-ray	1.80Å	0.29	0.18	Putative uncharacterized protein
3fpg.1.A	14.29	homo-dimer	HHblits	X-ray	2.00Å	0.29	0.18	Putative uncharacterized protein
4nmw.1.A	14.00	monomer	HHblits	X-ray	1.50Å	0.27	0.18	Pimelyl-[acyl-carrier protein] methyl ester esterase
1x2e.1.A	14.00	monomer	HHblits	X-ray	2.40Å	0.26	0.18	Proline iminopeptidase
1eo1.1.A	14.58	monomer	HHblits	NMR	NA	0.28	0.17	HYPOTHETICAL PROTEIN MTH1175
4i3f.1.A	10.00	monomer	HHblits	X-ray	1.69Å	0.25	0.18	serine hydrolase CCSP0084
4fx9.1.A	14.89	homo-dimer	HHblits	X-ray	2.70Å	0.30	0.17	Coenzyme A disulfide reductase
4v4b.1.Z	19.15	hetero-oligomer	HHblits	EM	NA	0.29	0.17	60S ribosomal protein L8-A
1fui.1.A	14.58	homo-trimer	HHblits	X-ray	2.50Å	0.27	0.17	L-FUCOSE ISOMERASE
1a96.1.A	18.75	homo-tetramer	HHblits	X-ray	2.00Å	0.27	0.17	XANTHINE-GUANINE PHOSPHORIBOSYLTRANSFERASE
1a96.1.C	18.75	homo-tetramer	HHblits	X-ray	2.00Å	0.27	0.17	XANTHINE-GUANINE PHOSPHORIBOSYLTRANSFERASE
1nul.1.B	18.75	homo-tetramer	HHblits	X-ray	1.80Å	0.27	0.17	XANTHINE-GUANINE PHOSPHORIBOSYLTRANSFERASE
4jls.2.A	18.75	homo-tetramer	HHblits	X-ray	2.20Å	0.27	0.17	Xanthine phosphoribosyltransferase
4c22.1.A	12.50	homo-hexamer	HHblits	X-ray	2.70Å	0.27	0.17	L-FUCOSE ISOMERASE
4c20.1.A	10.42	monomer	HHblits	X-ray	2.41Å	0.26	0.17	L-FUCOSE ISOMERASE
4c21.1.A	10.42	homo-hexamer	HHblits	X-ray	2.55Å	0.26	0.17	L-FUCOSE ISOMERASE
1war.1.A	14.89	monomer	HHblits	X-ray	2.22Å	0.28	0.17	HUMAN PURPLE ACID PHOSPHATASE
1a97.1.A	19.15	homo-tetramer	HHblits	X-ray	2.60Å	0.27	0.17	XANTHINE-GUANINE PHOSPHORIBOSYLTRANSFERASE
1a98.1.A	19.15	homo-tetramer	HHblits	X-ray	2.25Å	0.27	0.17	XANTHINE-GUANINE PHOSPHORIBOSYLTRANSFERASE
4tug.1.C	6.25	homo-hexamer	HHblits	X-ray	3.55Å	0.25	0.17	DNA double-strand break repair protein Mre11
4tug.1.A	6.25	homo-hexamer	HHblits	X-ray	3.55Å	0.25	0.17	DNA double-strand break repair protein Mre11
4tug.1.F	6.25	homo-hexamer	HHblits	X-ray	3.55Å	0.25	0.17	DNA double-strand break repair protein Mre11
2bq8.1.A	15.22	monomer	HHblits	X-ray	2.20Å	0.28	0.17	TARTRATE-RESISTANT ACID PHOSPHATASE TYPE 5
2hjr.1.A	22.22	homo-dimer	HHblits	X-ray	2.20Å	0.29	0.16	Malate dehydrogenase
3mjf.1.A	15.22	monomer	HHblits	X-ray	1.47Å	0.27	0.17	Phosphoribosylamine--glycine ligase
2ip4.1.A	15.56	monomer	HHblits	X-ray	2.80Å	0.28	0.16	Phosphoribosylamine--glycine ligase
2ip4.2.A	15.56	monomer	HHblits	X-ray	2.80Å	0.28	0.16	Phosphoribosylamine--glycine ligase
2yya.1.A	10.87	monomer	HHblits	X-ray	2.40Å	0.27	0.17	Phosphoribosylamine--glycine ligase
2ys6.1.A	13.33	monomer	HHblits	X-ray	2.21Å	0.27	0.16	Phosphoribosylglycinamide synthetase
1gso.1.A	18.18	monomer	HHblits	X-ray	1.60Å	0.29	0.16	PROTEIN (GLYCINAMIDE RIBONUCLEOTIDE SYNTHETASE)
1x7i.1.A	20.93	homo-dimer	HHblits	X-ray	1.70Å	0.30	0.16	Copper homeostasis protein cutC
1x7i.1.B	20.93	homo-dimer	HHblits	X-ray	1.70Å	0.30	0.16	Copper homeostasis protein cutC
1twd.1.A	20.93	homo-dimer	HHblits	X-ray	1.70Å	0.30	0.16	Copper homeostasis protein cutC
1twd.1.B	20.93	homo-dimer	HHblits	X-ray	1.70Å	0.30	0.16	Copper homeostasis protein cutC
2qk4.1.A	18.60	monomer	HHblits	X-ray	2.45Å	0.30	0.16	Trifunctional purine biosynthetic protein adenosine-3
4h4x.1.A	16.67	homo-dimer	HHblits	X-ray	1.50Å	0.31	0.15	Biphenyl dioxygenase ferredoxin reductase subunit
3o8o.1.B	21.43	hetero-oligomer	HHblits	X-ray	2.90Å	0.30	0.15	6-phosphofructokinase subunit beta
5fs9.1.A	16.67	monomer	HHblits	X-ray	1.75Å	0.30	0.15	APOPTOSIS-INDUCING FACTOR 1, MITOCHONDRIAL
5jcm.1.A	21.43	monomer	HHblits	X-ray	1.90Å	0.30	0.15	Os09g0567300 protein
1iu9.1.A	17.07	monomer	HHblits	X-ray	2.04Å	0.32	0.15	aspartate racemase
3lxd.1.A	16.67	monomer	HHblits	X-ray	2.50Å	0.30	0.15	FAD-dependent pyridine nucleotide-disulphide oxidoreductase
4v7h.1.4	16.67	hetero-oligomer	HHblits	EM	8.90Å	0.29	0.15	60S ribosomal protein L8(A)
3ef6.1.A	28.21	monomer	HHblits	X-ray	1.80Å	0.35	0.14	Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase
4emi.1.A	28.21	monomer	HHblits	X-ray	1.81Å	0.35	0.14	TodA
4emj.1.A	28.21	hetero-oligomer	HHblits	X-ray	2.40Å	0.35	0.14	TodA
4h4t.1.A	17.07	homo-dimer	HHblits	X-ray	1.50Å	0.31	0.15	Biphenyl dioxygenase ferredoxin reductase subunit
4h4p.1.A	17.07	homo-dimer	HHblits	X-ray	1.50Å	0.31	0.15	Biphenyl dioxygenase ferredoxin reductase subunit
2yvg.1.A	17.07	homo-dimer	HHblits	X-ray	1.60Å	0.31	0.15	Ferredoxin reductase
2yvj.1.A	17.07	hetero-oligomer	HHblits	X-ray	1.90Å	0.31	0.15	Ferredoxin reductase
2yvj.1.C	17.07	hetero-oligomer	HHblits	X-ray	1.90Å	0.31	0.15	Ferredoxin reductase
1d7y.1.A	17.07	homo-dimer	HHblits	X-ray	2.10Å	0.31	0.15	FERREDOXIN REDUCTASE
4h4z.1.A	17.07	homo-dimer	HHblits	X-ray	1.95Å	0.31	0.15	Biphenyl dioxygenase ferredoxin reductase subunit
5jcl.1.A	21.43	monomer	HHblits	X-ray	1.80Å	0.29	0.15	Os09g0567300 protein
3beo.1.A	13.95	homo-dimer	HHblits	X-ray	1.70Å	0.27	0.16	UDP-N-acetylglucosamine 2-epimerase
2gr3.1.A	17.07	homo-dimer	HHblits	X-ray	1.50Å	0.31	0.15	ferredoxin reductase
4h4r.1.A	17.07	homo-dimer	HHblits	X-ray	1.40Å	0.31	0.15	Biphenyl dioxygenase ferredoxin reductase subunit
2xcl.1.A	6.67	monomer	HHblits	X-ray	2.10Å	0.23	0.16	PHOSPHORIBOSYLAMINE--GLYCINE LIGASE
4lii.1.A	17.07	monomer	HHblits	X-ray	1.88Å	0.30	0.15	Apoptosis-inducing factor 1, mitochondrial
5fs8.1.A	17.07	monomer	HHblits	X-ray	1.40Å	0.30	0.15	APOPTOSIS-INDUCING FACTOR 1, MITOCHONDRIAL
4fdc.1.A	17.07	monomer	HHblits	X-ray	2.40Å	0.30	0.15	Apoptosis-inducing factor 1, mitochondrial
1m6i.1.A	17.07	monomer	HHblits	X-ray	1.80Å	0.30	0.15	Programmed cell death protein 8
5fs6.1.A	17.07	monomer	HHblits	X-ray	1.90Å	0.30	0.15	APOPTOSIS-INDUCING FACTOR 1, MITOCHONDRIAL
5fs7.1.A	17.07	monomer	HHblits	X-ray	1.85Å	0.30	0.15	APOPTOSIS-INDUCING FACTOR 1, MITOCHONDRIAL
3jah.57.A	30.00	monomer	HHblits	EM	NA	0.32	0.15	eS12
5k0y.1.d	30.00	hetero-oligomer	HHblits	EM	NA	0.32	0.15	40S ribosomal protein S12
2v3a.1.A	16.67	monomer	HHblits	X-ray	2.40Å	0.28	0.15	RUBREDOXIN REDUCTASE
2v3b.1.A	16.67	hetero-oligomer	HHblits	X-ray	2.45Å	0.28	0.15	RUBREDOXIN REDUCTASE
5jci.1.A	21.95	monomer	HHblits	X-ray	1.70Å	0.30	0.15	Os09g0567300 protein
3syi.1.A	14.63	homo-dimer	HHblits	X-ray	2.20Å	0.30	0.15	Sulfide-quinone reductase, putative
3szw.1.A	14.63	homo-dimer	HHblits	X-ray	2.20Å	0.30	0.15	Sulfide-quinone reductase, putative
3sx6.1.A	14.63	homo-dimer	HHblits	X-ray	1.80Å	0.30	0.15	Sulfide-quinone reductase, putative
3szf.1.A	14.63	homo-dimer	HHblits	X-ray	2.10Å	0.30	0.15	Sulfide-quinone reductase, putative
4u4n.116.A	19.51	monomer	HHblits	X-ray	3.10Å	0.30	0.15	60S ribosomal protein L8-A
4u4r.41.A	19.51	monomer	HHblits	X-ray	2.80Å	0.30	0.15	60S ribosomal protein L8-A
1v8b.1.A	14.29	homo-tetramer	HHblits	X-ray	2.40Å	0.28	0.15	adenosylhomocysteinase
3kd9.1.A	14.63	homo-dimer	HHblits	X-ray	2.75Å	0.30	0.15	Coenzyme A disulfide reductase
3fg2.1.A	17.07	monomer	HHblits	X-ray	2.20Å	0.30	0.15	Putative rubredoxin reductase
2r68.1.A	6.98	monomer	HHblits	X-ray	2.40Å	0.25	0.16	Glycosyl transferase, group 1
4h4v.1.A	17.50	homo-dimer	HHblits	X-ray	1.40Å	0.31	0.15	Biphenyl dioxygenase ferredoxin reductase subunit
4v8m.75.A	25.00	monomer	HHblits	EM	5.57Å	0.31	0.15	60S RIBOSOMAL PROTEIN L7A, PUTATIVE
3n4y.1.A	20.00	monomer	HHblits	X-ray	2.40Å	0.31	0.15	50S ribosomal protein L30e
5t5h.1.j	22.50	hetero-oligomer	HHblits	EM	NA	0.31	0.15	Ribosomal protein L7a-like protein
1go1.1.A	20.00	monomer	HHblits	NMR	NA	0.31	0.15	50S RIBOSOMAL PROTEIN L30E
1go0.1.A	20.00	monomer	HHblits	NMR	NA	0.31	0.15	50S RIBOSOMAL PROTEIN L30E
1h7m.1.A	20.00	monomer	HHblits	X-ray	1.96Å	0.31	0.15	50S RIBOSOMAL PROTEIN L30E
3td9.1.A	14.63	homo-dimer	HHblits	X-ray	1.90Å	0.29	0.15	Branched chain amino acid ABC transporter, periplasmic amino acid-binding protein
4bur.1.A	17.50	monomer	HHblits	X-ray	2.88Å	0.31	0.15	APOPTOSIS INDUCING FACTOR 1, MITOCHONDRIAL
4bur.3.A	17.50	monomer	HHblits	X-ray	2.88Å	0.31	0.15	APOPTOSIS INDUCING FACTOR 1, MITOCHONDRIAL
3gd4.1.A	17.50	homo-dimer	HHblits	X-ray	2.24Å	0.31	0.15	Apoptosis-inducing factor 1, mitochondrial
3gd4.1.B	17.50	homo-dimer	HHblits	X-ray	2.24Å	0.31	0.15	Apoptosis-inducing factor 1, mitochondrial
5fmh.1.A	17.50	monomer	HHblits	X-ray	1.80Å	0.31	0.15	APOPTOSIS-INDUCING FACTOR 1, MITOCHONDRIAL
5kvi.1.A	17.50	monomer	HHblits	X-ray	2.00Å	0.31	0.15	Apoptosis-inducing factor 1, mitochondrial
1gv4.1.A	17.50	monomer	HHblits	X-ray	2.00Å	0.31	0.15	PROGRAMED CELL DEATH PROTEIN 8
3gd3.1.A	17.50	monomer	HHblits	X-ray	2.95Å	0.31	0.15	Apoptosis-inducing factor 1, mitochondrial
3gd3.2.A	17.50	monomer	HHblits	X-ray	2.95Å	0.31	0.15	Apoptosis-inducing factor 1, mitochondrial
3gd3.4.A	17.50	monomer	HHblits	X-ray	2.95Å	0.31	0.15	Apoptosis-inducing factor 1, mitochondrial
5kvh.1.A	17.50	homo-dimer	HHblits	X-ray	2.27Å	0.31	0.15	Apoptosis-inducing factor 1, mitochondrial
5miu.1.A	17.50	monomer	HHblits	X-ray	3.50Å	0.31	0.15	Apoptosis-inducing factor 1, mitochondrial
5miv.1.A	17.50	homo-dimer	HHblits	X-ray	3.10Å	0.31	0.15	Apoptosis-inducing factor 1, mitochondrial
5miv.1.B	17.50	homo-dimer	HHblits	X-ray	3.10Å	0.31	0.15	Apoptosis-inducing factor 1, mitochondrial
4ru0.1.A	16.67	monomer	HHblits	X-ray	2.44Å	0.27	0.15	Putative branched-chain amino acid ABC transporter, periplasmic branched-chain amino acid-binding protein
3noy.1.A	28.21	homo-dimer	HHblits	X-ray	2.70Å	0.32	0.14	4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
3noy.2.A	28.21	homo-dimer	HHblits	X-ray	2.70Å	0.32	0.14	4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
4v6w.80.A	17.50	monomer	HHblits	EM	NA	0.30	0.15	60S ribosomal protein L7a
3hyv.1.A	17.95	homo-trimer	HHblits	X-ray	2.30Å	0.32	0.14	Sulfide-quinone reductase
4ry0.1.A	25.64	monomer	HHblits	X-ray	1.40Å	0.32	0.14	Probable ribose ABC transporter, substrate-binding protein
3iwa.1.A	14.63	homo-dimer	HHblits	X-ray	2.30Å	0.28	0.15	FAD-dependent pyridine nucleotide-disulphide oxidoreductase
3h5l.1.A	17.50	monomer	HHblits	X-ray	1.70Å	0.30	0.15	putative Branched-chain amino acid ABC transporter
3ra6.1.A	20.51	monomer	HHblits	X-ray	2.00Å	0.32	0.14	50S ribosomal protein L30e
3cge.1.A	12.20	homo-dimer	HHblits	X-ray	2.26Å	0.28	0.15	Pyridine nucleotide-disulfide oxidoreductase, class I
1lqu.1.A	20.00	monomer	HHblits	X-ray	1.25Å	0.30	0.15	FprA
3lfo.1.A	20.51	monomer	HHblits	X-ray	1.80Å	0.32	0.14	50S ribosomal protein L30e
1w41.1.A	20.51	monomer	HHblits	X-ray	1.70Å	0.32	0.14	50S RIBOSOMAL PROTEIN L30E
1w40.1.A	20.51	monomer	HHblits	X-ray	2.03Å	0.32	0.14	50S RIBOSOMAL PROTEIN L30E
3n4z.1.A	20.51	monomer	HHblits	X-ray	2.40Å	0.32	0.14	50S ribosomal protein L30e
3n4z.2.A	20.51	monomer	HHblits	X-ray	2.40Å	0.32	0.14	50S ribosomal protein L30e
3ra5.1.A	20.51	homo-dimer	HHblits	X-ray	1.80Å	0.32	0.14	50S ribosomal protein L30e
3ics.1.A	12.20	homo-dimer	HHblits	X-ray	1.94Å	0.28	0.15	Coenzyme A-Disulfide Reductase
1q1r.1.A	15.00	monomer	HHblits	X-ray	1.91Å	0.29	0.15	Putidaredoxin reductase
1q1w.2.A	15.00	monomer	HHblits	X-ray	2.60Å	0.29	0.15	Putidaredoxin reductase
3lb8.1.A	15.00	hetero-oligomer	HHblits	X-ray	2.60Å	0.29	0.15	Putidaredoxin reductase
3lb8.2.A	15.00	hetero-oligomer	HHblits	X-ray	2.60Å	0.29	0.15	Putidaredoxin reductase
1w42.1.A	20.51	monomer	HHblits	X-ray	1.80Å	0.31	0.14	50S RIBOSOMAL PROTEIN L30E
5lzz.57.A	25.64	monomer	HHblits	EM	3.47Å	0.31	0.14	40S ribosomal protein S12
4ujc.57.A	25.64	monomer	HHblits	EM	9.50Å	0.31	0.14	40S RIBOSOMAL PROTEIN ES12
5aj0.58.A	25.64	monomer	HHblits	EM	3.50Å	0.31	0.14	40S ribosomal protein S12
4kzx.1.M	25.64	hetero-oligomer	HHblits	X-ray	7.81Å	0.31	0.14	40S ribosomal protein S12
5vyc.5.M	25.64	hetero-oligomer	HHblits	X-ray	6.00Å	0.31	0.14	40S ribosomal protein S12
3ukj.1.A	12.50	monomer	HHblits	X-ray	1.60Å	0.29	0.15	Extracellular ligand-binding receptor
3sxi.1.A	12.50	homo-dimer	HHblits	X-ray	2.18Å	0.29	0.15	Sulfide-quinone reductase, putative
2c7g.1.A	20.00	homo-dimer	HHblits	X-ray	1.80Å	0.29	0.15	NADPH-FERREDOXIN REDUCTASE FPRA
4u3u.116.A	20.51	monomer	HHblits	X-ray	2.90Å	0.31	0.14	60S ribosomal protein L8-A
4u3m.41.A	20.51	monomer	HHblits	X-ray	3.00Å	0.31	0.14	60S ribosomal protein L8-A
4v4n.65.A	20.51	monomer	HHblits	EM	NA	0.31	0.14	50S ribosomal protein L30E
4v6u.56.A	20.51	monomer	HHblits	EM	NA	0.31	0.14	50S ribosomal protein L30e
3j7a.1.R	17.50	hetero-oligomer	HHblits	EM	NA	0.29	0.15	40S ribosomal protein eS12
5l1n.1.A	12.50	homo-dimer	HHblits	X-ray	3.60Å	0.29	0.15	Coenzyme A disulfide reductase
4fx7.1.A	4.88	monomer	HHblits	X-ray	2.08Å	0.27	0.15	Imidazole glycerol phosphate synthase subunit HisF
4gnr.1.A	10.00	monomer	HHblits	X-ray	1.00Å	0.29	0.15	ABC transporter substrate-binding protein-branched chain amino acid transport
2bc1.1.A	10.00	homo-dimer	HHblits	X-ray	2.15Å	0.28	0.15	NADH Oxidase
3cpq.1.A	23.08	homo-dimer	HHblits	X-ray	1.90Å	0.30	0.14	50S ribosomal protein L30e
3cgb.1.A	12.50	homo-dimer	HHblits	X-ray	1.90Å	0.28	0.15	Pyridine nucleotide-disulfide oxidoreductase, class I
1w3e.1.A	17.95	monomer	HHblits	X-ray	1.77Å	0.30	0.14	50S RIBOSOMAL PROTEIN L30E
3klj.1.A	17.95	monomer	HHblits	X-ray	2.10Å	0.30	0.14	NAD(FAD)-dependent dehydrogenase, NirB-family (N-terminal domain)
3ipa.1.A	17.95	monomer	HHblits	X-ray	1.55Å	0.30	0.14	ABC transporter, substrate binding protein (Amino acid)
5l2e.1.A	26.32	homo-dimer	HHblits	X-ray	4.15Å	0.32	0.14	Glutamate receptor ionotropic, delta-2,Glutamate receptor ionotropic, delta-2
4bts.100.A	17.50	monomer	HHblits	X-ray	3.70Å	0.27	0.15	40S RIBOSOMAL PROTEIN RPS12E
4v5o.2.3	17.50	hetero-oligomer	HHblits	X-ray	3.93Å	0.27	0.15	RIBOSOMAL PROTEIN L7AE CONTAINING PROTEIN
4v5o.1.3	17.50	hetero-oligomer	HHblits	X-ray	3.93Å	0.27	0.15	RIBOSOMAL PROTEIN L7AE CONTAINING PROTEIN
4v8m.58.A	20.51	monomer	HHblits	EM	5.57Å	0.29	0.14	60S RIBOSOMAL PROTEIN L30
1yqz.1.A	12.50	homo-dimer	HHblits	X-ray	1.54Å	0.27	0.15	coenzyme A disulfide reductase
4em3.1.A	12.50	homo-dimer	HHblits	X-ray	1.98Å	0.27	0.15	Coenzyme A disulfide reductase
4eqs.1.A	12.50	homo-dimer	HHblits	X-ray	1.50Å	0.27	0.15	Coenzyme A disulfide reductase
3nta.1.A	15.00	homo-dimer	HHblits	X-ray	2.01Å	0.27	0.15	FAD-dependent pyridine nucleotide-disulphide oxidoreductase
4ocg.1.A	15.00	homo-dimer	HHblits	X-ray	2.75Å	0.27	0.15	FAD-dependent pyridine nucleotide-disulphide oxidoreductase
3ntd.1.A	15.00	homo-dimer	HHblits	X-ray	1.99Å	0.27	0.15	FAD-dependent pyridine nucleotide-disulphide oxidoreductase
3nt6.1.A	15.00	homo-dimer	HHblits	X-ray	2.00Å	0.27	0.15	FAD-dependent pyridine nucleotide-disulphide oxidoreductase
5oql.1.V	15.38	hetero-oligomer	HHblits	EM	NA	0.29	0.14	Snu13
4q6w.1.A	15.00	monomer	HHblits	X-ray	1.84Å	0.27	0.15	Putative leu/ile/val-binding protein
4kv7.1.A	20.51	monomer	HHblits	X-ray	1.20Å	0.29	0.14	Probable leucine/isoleucine/valine-binding protein
4dqd.1.A	12.82	monomer	HHblits	X-ray	1.60Å	0.29	0.14	Extracellular ligand-binding receptor
3oc4.1.A	18.42	homo-dimer	HHblits	X-ray	2.60Å	0.31	0.14	Oxidoreductase, pyridine nucleotide-disulfide family
3oc4.1.B	18.42	homo-dimer	HHblits	X-ray	2.60Å	0.31	0.14	Oxidoreductase, pyridine nucleotide-disulfide family
4lck.1.A	17.95	monomer	HHblits	X-ray	3.20Å	0.29	0.14	Ribosomal protein YbxF
4lck.2.A	17.95	monomer	HHblits	X-ray	3.20Å	0.29	0.14	Ribosomal protein YbxF
3v7e.1.A	17.95	monomer	HHblits	X-ray	2.80Å	0.29	0.14	Ribosome-associated protein L7Ae-like
4tzz.2.A	17.95	monomer	HHblits	X-ray	3.64Å	0.29	0.14	Ribosome-associated protein L7Ae-like
4tzp.2.A	17.95	monomer	HHblits	X-ray	8.50Å	0.29	0.14	Ribosome-associated protein L7Ae-like
4tzw.1.A	17.95	monomer	HHblits	X-ray	4.67Å	0.29	0.14	Ribosome-associated protein L7Ae-like
5xy3.1.4	17.95	hetero-oligomer	HHblits	EM	NA	0.28	0.14	60S ribosomal protein L30, putative
4x9s.1.A	23.08	monomer	HHblits	X-ray	1.60Å	0.28	0.14	Phosphoribosyl isomerase A
3ipc.1.A	18.42	monomer	HHblits	X-ray	1.30Å	0.30	0.14	ABC transporter, substrate binding protein (Amino acid)
1e7k.1.A	17.95	monomer	HHblits	X-ray	2.90Å	0.28	0.14	15.5 KD RNA BINDING PROTEIN
5o9z.1.O	17.95	hetero-oligomer	HHblits	EM	NA	0.28	0.14	NHP2-like protein 1
3o85.1.A	12.82	monomer	HHblits	X-ray	1.81Å	0.28	0.14	Ribosomal protein L7Ae
4v6w.7.A	17.95	monomer	HHblits	EM	NA	0.28	0.14	40S ribosomal protein S12
4eqr.1.A	12.82	homo-dimer	HHblits	X-ray	1.80Å	0.28	0.14	Coenzyme A disulfide reductase
4eqx.1.A	12.82	homo-dimer	HHblits	X-ray	1.70Å	0.28	0.14	Coenzyme A disulfide reductase
4emw.1.A	12.82	homo-dimer	HHblits	X-ray	2.39Å	0.28	0.14	Coenzyme A disulfide reductase
4eqw.1.A	12.82	homo-dimer	HHblits	X-ray	1.50Å	0.28	0.14	Coenzyme A disulfide reductase
4evq.1.A	15.79	monomer	HHblits	X-ray	1.40Å	0.30	0.14	Putative ABC transporter subunit, substrate-binding component
5xxb.1.4	17.95	hetero-oligomer	HHblits	EM	NA	0.28	0.14	Ribosomal protein eL30
5er0.1.A	10.26	homo-dimer	HHblits	X-ray	2.41Å	0.27	0.14	NADH oxidase
2lbp.1.A	12.82	monomer	HHblits	X-ray	2.40Å	0.27	0.14	LEUCINE-BINDING PROTEIN
4qwv.1.A	12.82	monomer	HHblits	X-ray	2.45Å	0.27	0.14	High-affinity leucine-specific transport system periplasmic binding protein, Chemotaxis protein CheY
1qo0.1.A	12.82	hetero-oligomer	HHblits	X-ray	2.25Å	0.27	0.14	AMIC
1pea.1.A	12.82	homo-dimer	HHblits	X-ray	2.10Å	0.27	0.14	AMIDASE OPERON
1qnl.1.A	12.82	homo-tetramer	HHblits	X-ray	2.70Å	0.27	0.14	ALIPHATIC AMIDASE EXPRESSION-REGULATING PROTEIN
1nhr.1.A	15.79	monomer	HHblits	X-ray	2.10Å	0.29	0.14	NADH PEROXIDASE
1f8w.1.A	15.79	homo-tetramer	HHblits	X-ray	2.45Å	0.29	0.14	NADH PEROXIDASE
3jcs.1.b	21.05	hetero-oligomer	HHblits	EM	NA	0.29	0.14	ribosomal protein L30e
5t2a.23.A	21.05	monomer	HHblits	EM	NA	0.29	0.14	eL30
4d67.1.1	15.79	hetero-oligomer	HHblits	EM	9.00Å	0.29	0.14	60S RIBOSOMAL PROTEIN L30
3j92.1.1	15.79	hetero-oligomer	HHblits	EM	NA	0.29	0.14	eL30
3j7o.1.4	15.79	hetero-oligomer	HHblits	EM	3.50Å	0.29	0.14	Ribosomal protein eL30
5t2c.43.A	15.79	monomer	HHblits	EM	NA	0.29	0.14	60S ribosomal protein L30
4ug0.28.A	15.79	monomer	HHblits	EM	NA	0.29	0.14	60S RIBOSOMAL PROTEIN L30
4v6x.63.A	15.79	monomer	HHblits	EM	NA	0.29	0.14	60S ribosomal protein L30
4v5z.48.A	15.79	monomer	HHblits	EM	NA	0.29	0.14	60S Ribosomal protein L30e
5lks.28.A	15.79	monomer	HHblits	EM	NA	0.29	0.14	60S ribosomal protein L30
5aj0.29.A	15.79	monomer	HHblits	EM	3.50Å	0.29	0.14	60S ribosomal protein L30
4v6w.63.A	24.32	monomer	HHblits	EM	NA	0.31	0.13	60S ribosomal protein L30
4u4f.1.A	2.44	homo-tetramer	HHblits	X-ray	4.79Å	0.23	0.15	Glutamate receptor 2
4u4f.1.B	2.44	homo-tetramer	HHblits	X-ray	4.79Å	0.23	0.15	Glutamate receptor 2
4u4f.1.C	2.44	homo-tetramer	HHblits	X-ray	4.79Å	0.23	0.15	Glutamate receptor 2
4u4f.1.D	2.44	homo-tetramer	HHblits	X-ray	4.79Å	0.23	0.15	Glutamate receptor 2
4u4g.1.A	2.44	homo-tetramer	HHblits	X-ray	4.49Å	0.23	0.15	Glutamate receptor 2
4u4g.1.B	2.44	homo-tetramer	HHblits	X-ray	4.49Å	0.23	0.15	Glutamate receptor 2
4u4g.1.C	2.44	homo-tetramer	HHblits	X-ray	4.49Å	0.23	0.15	Glutamate receptor 2
4u4g.1.D	2.44	homo-tetramer	HHblits	X-ray	4.49Å	0.23	0.15	Glutamate receptor 2
2hqb.1.A	18.42	monomer	HHblits	X-ray	2.70Å	0.29	0.14	Transcriptional activator of comK gene
4v8p.1.G	18.42	hetero-oligomer	HHblits	X-ray	3.52Å	0.29	0.14	RPL30
3vi6.1.A	15.79	monomer	HHblits	X-ray	1.59Å	0.29	0.14	60S ribosomal protein L30
5lzz.28.A	15.79	monomer	HHblits	EM	3.47Å	0.29	0.14	eL30
4n0q.1.A	18.42	monomer	HHblits	X-ray	2.30Å	0.29	0.14	Leu/Ile/Val-binding protein homolog 3
4iil.1.A	15.79	monomer	HHblits	X-ray	1.30Å	0.28	0.14	Membrane lipoprotein TpN38(b)
3saj.1.A	12.50	homo-dimer	HHblits	X-ray	2.50Å	0.24	0.15	Glutamate receptor 1
3saj.1.B	12.50	homo-dimer	HHblits	X-ray	2.50Å	0.24	0.15	Glutamate receptor 1
3saj.2.A	12.50	homo-dimer	HHblits	X-ray	2.50Å	0.24	0.15	Glutamate receptor 1
3saj.2.B	12.50	homo-dimer	HHblits	X-ray	2.50Å	0.24	0.15	Glutamate receptor 1
5kc9.2.A	34.29	homo-dimer	HHblits	X-ray	2.30Å	0.34	0.13	Glutamate receptor ionotropic, delta-1
5kc9.1.B	34.29	homo-dimer	HHblits	X-ray	2.30Å	0.34	0.13	Glutamate receptor ionotropic, delta-1
5kc9.1.A	34.29	homo-dimer	HHblits	X-ray	2.30Å	0.34	0.13	Glutamate receptor ionotropic, delta-1
1usi.1.A	13.16	monomer	HHblits	X-ray	1.80Å	0.28	0.14	LEUCINE-SPECIFIC BINDING PROTEIN
1usg.1.A	13.16	homo-dimer	HHblits	X-ray	1.53Å	0.28	0.14	LEUCINE-SPECIFIC BINDING PROTEIN
3lkv.1.A	21.62	homo-dimer	HHblits	X-ray	2.20Å	0.30	0.13	uncharacterized CONSERVED DOMAIN PROTEIN
2cdu.1.A	7.89	homo-dimer	HHblits	X-ray	1.80Å	0.27	0.14	NADPH OXIDASE
5hy5.1.A	13.51	homo-dimer	HHblits	X-ray	2.68Å	0.29	0.13	Tryptophan 6-halogenase
5kuh.1.A	21.62	homo-tetramer	HHblits	EM	NA	0.29	0.13	Glutamate receptor ionotropic, kainate 2
5kuh.1.B	21.62	homo-tetramer	HHblits	EM	NA	0.29	0.13	Glutamate receptor ionotropic, kainate 2
5l1g.1.C	2.50	homo-tetramer	HHblits	X-ray	4.51Å	0.23	0.15	Glutamate receptor 2
5l1g.1.B	2.50	homo-tetramer	HHblits	X-ray	4.51Å	0.23	0.15	Glutamate receptor 2
5l1g.1.A	2.50	homo-tetramer	HHblits	X-ray	4.51Å	0.23	0.15	Glutamate receptor 2
5l1g.1.D	2.50	homo-tetramer	HHblits	X-ray	4.51Å	0.23	0.15	Glutamate receptor 2
5l1b.1.D	2.50	homo-tetramer	HHblits	X-ray	4.00Å	0.23	0.15	Glutamate receptor 2,Glutamate receptor 2
5l1b.1.C	2.50	homo-tetramer	HHblits	X-ray	4.00Å	0.23	0.15	Glutamate receptor 2,Glutamate receptor 2
5l1b.1.B	2.50	homo-tetramer	HHblits	X-ray	4.00Å	0.23	0.15	Glutamate receptor 2,Glutamate receptor 2
5l1b.1.A	2.50	homo-tetramer	HHblits	X-ray	4.00Å	0.23	0.15	Glutamate receptor 2,Glutamate receptor 2
4ru0.1.A	7.89	monomer	HHblits	X-ray	2.44Å	0.27	0.14	Putative branched-chain amino acid ABC transporter, periplasmic branched-chain amino acid-binding protein
2liv.1.A	13.16	monomer	HHblits	X-ray	2.40Å	0.27	0.14	LEUCINE
3i45.1.A	10.26	monomer	HHblits	X-ray	1.36Å	0.25	0.14	Twin-arginine translocation pathway signal protein
4evq.1.A	18.92	monomer	HHblits	X-ray	1.40Å	0.28	0.13	Putative ABC transporter subunit, substrate-binding component
1zhh.1.A	13.16	hetero-oligomer	HHblits	X-ray	1.94Å	0.26	0.14	Autoinducer 2-binding periplasmic protein luxP
3ic9.1.A	17.65	homo-dimer	HHblits	X-ray	2.15Å	0.34	0.12	dihydrolipoamide dehydrogenase
3ic9.1.B	17.65	homo-dimer	HHblits	X-ray	2.15Å	0.34	0.12	dihydrolipoamide dehydrogenase
3ic9.2.B	17.65	homo-dimer	HHblits	X-ray	2.15Å	0.34	0.12	dihydrolipoamide dehydrogenase
3vrd.1.B	16.67	hetero-oligomer	HHblits	X-ray	1.50Å	0.30	0.13	Flavocytochrome c flavin subunit
3nnd.1.A	7.69	homo-tetramer	HHblits	X-ray	2.80Å	0.23	0.14	Possible substrate binding protein of ABC transporter system
4mlc.1.A	16.67	monomer	HHblits	X-ray	2.71Å	0.29	0.13	Extracellular ligand-binding receptor
4q6b.1.A	16.67	monomer	HHblits	X-ray	1.67Å	0.29	0.13	Extracellular ligand-binding receptor
4maa.1.A	18.92	monomer	HHblits	X-ray	2.00Å	0.27	0.13	Putative branched-chain amino acid ABC transporter, periplasmic amino acid-binding protein
3uk0.1.A	7.89	monomer	HHblits	X-ray	1.49Å	0.25	0.14	Extracellular ligand-binding receptor
3tx6.1.A	5.26	monomer	HHblits	X-ray	1.50Å	0.25	0.14	Putative branched-chain amino acid transport system substrate-binding protein
3ukj.1.A	5.26	monomer	HHblits	X-ray	1.60Å	0.24	0.14	Extracellular ligand-binding receptor
4maa.1.A	5.26	monomer	HHblits	X-ray	2.00Å	0.24	0.14	Putative branched-chain amino acid ABC transporter, periplasmic amino acid-binding protein
3hly.1.A	31.43	monomer	HHblits	X-ray	2.40Å	0.30	0.13	Flavodoxin-like domain
3hly.2.A	31.43	monomer	HHblits	X-ray	2.40Å	0.30	0.13	Flavodoxin-like domain
3hly.3.A	31.43	monomer	HHblits	X-ray	2.40Å	0.30	0.13	Flavodoxin-like domain
4obb.1.A	8.33	monomer	HHblits	X-ray	1.53Å	0.28	0.13	Amino acid/amide ABC transporter substrate-binding protein, HAAT family
5kbv.1.A	2.63	homo-tetramer	HHblits	EM	NA	0.23	0.14	Glutamate receptor 2
5kbv.1.B	2.63	homo-tetramer	HHblits	EM	NA	0.23	0.14	Glutamate receptor 2
5kbv.1.C	2.63	homo-tetramer	HHblits	EM	NA	0.23	0.14	Glutamate receptor 2
5kbv.1.D	2.63	homo-tetramer	HHblits	EM	NA	0.23	0.14	Glutamate receptor 2
3ipa.1.A	8.11	monomer	HHblits	X-ray	1.55Å	0.25	0.13	ABC transporter, substrate binding protein (Amino acid)
2lbp.1.A	16.67	monomer	HHblits	X-ray	2.40Å	0.27	0.13	LEUCINE-BINDING PROTEIN
4dqd.1.A	8.11	monomer	HHblits	X-ray	1.60Å	0.25	0.13	Extracellular ligand-binding receptor
4q6w.1.A	2.70	monomer	HHblits	X-ray	1.84Å	0.25	0.13	Putative leu/ile/val-binding protein
3sg0.1.A	5.41	monomer	HHblits	X-ray	1.20Å	0.25	0.13	Extracellular ligand-binding receptor
3hut.1.A	20.59	monomer	HHblits	X-ray	1.93Å	0.31	0.12	putative branched-chain amino acid ABC transporter
4dn1.1.A	11.11	homo-dimer	HHblits	X-ray	2.05Å	0.26	0.13	Isomerase/lactonizing enzyme
4dn1.1.B	11.11	homo-dimer	HHblits	X-ray	2.05Å	0.26	0.13	Isomerase/lactonizing enzyme
3h5v.2.A	2.70	homo-dimer	HHblits	X-ray	2.33Å	0.23	0.13	Glutamate receptor 2
3h5v.1.B	2.70	homo-dimer	HHblits	X-ray	2.33Å	0.23	0.13	Glutamate receptor 2
3h5v.1.A	2.70	homo-dimer	HHblits	X-ray	2.33Å	0.23	0.13	Glutamate receptor 2
3h5w.1.A	2.70	homo-dimer	HHblits	X-ray	2.69Å	0.23	0.13	Glutamate receptor 2
3h5w.1.B	2.70	homo-dimer	HHblits	X-ray	2.69Å	0.23	0.13	Glutamate receptor 2
3td9.1.A	2.70	homo-dimer	HHblits	X-ray	1.90Å	0.23	0.13	Branched chain amino acid ABC transporter, periplasmic amino acid-binding protein
4f06.1.A	5.56	monomer	HHblits	X-ray	1.30Å	0.25	0.13	Extracellular ligand-binding receptor
3ks9.1.A	18.18	homo-dimer	HHblits	X-ray	1.90Å	0.32	0.12	Metabotropic glutamate receptor 1
3o21.2.A	11.11	homo-dimer	HHblits	X-ray	2.20Å	0.24	0.13	Glutamate receptor 3
3o21.1.B	11.11	homo-dimer	HHblits	X-ray	2.20Å	0.24	0.13	Glutamate receptor 3
3o21.1.A	11.11	homo-dimer	HHblits	X-ray	2.20Å	0.24	0.13	Glutamate receptor 3
3p3w.1.A	11.11	homo-dimer	HHblits	X-ray	4.20Å	0.24	0.13	Glutamate receptor 3
3p3w.1.B	11.11	homo-dimer	HHblits	X-ray	4.20Å	0.24	0.13	Glutamate receptor 3
4kv7.1.A	8.33	monomer	HHblits	X-ray	1.20Å	0.24	0.13	Probable leucine/isoleucine/valine-binding protein
5fwy.1.B	11.11	hetero-oligomer	HHblits	X-ray	2.12Å	0.24	0.13	GLUTAMATE RECEPTOR 3
4gpa.1.A	11.43	homo-dimer	HHblits	X-ray	2.25Å	0.26	0.13	Glutamate receptor 4
5fwx.1.B	11.43	hetero-oligomer	HHblits	X-ray	2.50Å	0.26	0.13	GLUTAMATE RECEPTOR 4
3ijd.1.A	17.65	homo-dimer	HHblits	X-ray	2.00Å	0.28	0.12	uncharacterized protein
4ry9.1.A	15.15	monomer	HHblits	X-ray	1.40Å	0.29	0.12	Periplasmic binding protein/LacI transcriptional regulator
3o2j.1.A	2.86	homo-dimer	HHblits	X-ray	1.95Å	0.24	0.13	Glutamate receptor 2
3o2j.1.B	2.86	homo-dimer	HHblits	X-ray	1.95Å	0.24	0.13	Glutamate receptor 2
3ipc.1.A	8.82	monomer	HHblits	X-ray	1.30Å	0.26	0.12	ABC transporter, substrate binding protein (Amino acid)
3mqt.1.A	8.82	homo-octamer	HHblits	X-ray	2.10Å	0.25	0.12	Mandelate racemase/muconate lactonizing protein
1usi.1.A	26.67	monomer	HHblits	X-ray	1.80Å	0.32	0.11	LEUCINE-SPECIFIC BINDING PROTEIN
1usg.1.A	26.67	homo-dimer	HHblits	X-ray	1.53Å	0.32	0.11	LEUCINE-SPECIFIC BINDING PROTEIN
3b1f.1.A	15.63	homo-dimer	HHblits	X-ray	2.10Å	0.27	0.12	Putative prephenate dehydrogenase
5g3s.1.A	23.33	homo-dimer	HHblits	X-ray	2.08Å	0.32	0.11	L-TRYPTOPHAN OXIDASE VIOA
5g3s.1.B	23.33	homo-dimer	HHblits	X-ray	2.08Å	0.32	0.11	L-TRYPTOPHAN OXIDASE VIOA
5g3u.1.A	23.33	homo-dimer	HHblits	X-ray	2.38Å	0.32	0.11	L-TRYPTOPHAN OXIDASE VIOA
3lov.1.A	16.67	monomer	HHblits	X-ray	2.06Å	0.32	0.11	Protoporphyrinogen oxidase
6b4o.1.A	16.13	homo-dimer	HHblits	X-ray	1.73Å	0.28	0.11	Glutathione reductase
2bac.1.A	25.00	monomer	HHblits	X-ray	2.30Å	0.31	0.10	putative aminooxidase
3djd.1.A	10.71	monomer	HHblits	X-ray	1.75Å	0.31	0.10	Fructosyl amine: oxygen oxidoreductase
3dje.1.A	10.71	monomer	HHblits	X-ray	1.60Å	0.31	0.10	Fructosyl amine: oxygen oxidoreductase
3p94.1.A	21.43	monomer	HHblits	X-ray	1.93Å	0.30	0.10	GDSL-like Lipase
1gub.1.A	10.00	monomer	HHblits	X-ray	3.10Å	0.24	0.11	D-ALLOSE-BINDING PERIPLASMIC PROTEIN
1gud.1.A	10.00	monomer	HHblits	X-ray	1.71Å	0.24	0.11	D-ALLOSE-BINDING PERIPLASMIC PROTEIN
1gud.2.A	10.00	monomer	HHblits	X-ray	1.71Å	0.24	0.11	D-ALLOSE-BINDING PERIPLASMIC PROTEIN
1rpj.1.A	10.00	monomer	HHblits	X-ray	1.80Å	0.24	0.11	PROTEIN (PRECURSOR OF PERIPLASMIC SUGAR RECEPTOR)
4rpg.1.A	26.92	homo-dimer	HHblits	X-ray	2.40Å	0.34	0.09	UDP-galactopyranose mutase
4rpl.2.B	26.92	homo-dimer	HHblits	X-ray	2.25Å	0.34	0.09	UDP-galactopyranose mutase
5koj.1.B	10.34	hetero-oligomer	HHblits	X-ray	2.59Å	0.25	0.11	Nitrogenase FeMo beta subunit protein NifK
3n0w.1.A	6.90	monomer	HHblits	X-ray	1.88Å	0.25	0.11	ABC branched chain amino acid family transporter, periplasmic ligand binding protein
4kqc.1.A	14.29	monomer	HHblits	X-ray	1.62Å	0.26	0.10	Periplasmic binding protein/LacI transcriptional regulator
3iwp.1.B	19.23	homo-tetramer	HHblits	X-ray	2.50Å	0.31	0.09	Copper homeostasis protein cutC homolog
3iwp.1.A	19.23	homo-tetramer	HHblits	X-ray	2.50Å	0.31	0.09	Copper homeostasis protein cutC homolog
3iwp.2.B	19.23	homo-tetramer	HHblits	X-ray	2.50Å	0.31	0.09	Copper homeostasis protein cutC homolog
3iwp.2.C	19.23	homo-tetramer	HHblits	X-ray	2.50Å	0.31	0.09	Copper homeostasis protein cutC homolog
3iwp.2.D	19.23	homo-tetramer	HHblits	X-ray	2.50Å	0.31	0.09	Copper homeostasis protein cutC homolog
3iwp.3.A	19.23	homo-tetramer	HHblits	X-ray	2.50Å	0.31	0.09	Copper homeostasis protein cutC homolog
3iwp.3.B	19.23	homo-tetramer	HHblits	X-ray	2.50Å	0.31	0.09	Copper homeostasis protein cutC homolog
3iwp.3.C	19.23	homo-tetramer	HHblits	X-ray	2.50Å	0.31	0.09	Copper homeostasis protein cutC homolog
3iwp.3.D	19.23	homo-tetramer	HHblits	X-ray	2.50Å	0.31	0.09	Copper homeostasis protein cutC homolog
3vcr.1.A	19.23	homo-trimer	HHblits	X-ray	1.84Å	0.31	0.09	putative Kdpg (2-keto-3-deoxy-6-phosphogluconate) aldolase
5kp9.1.A	23.08	homo-60-mer	HHblits	EM	NA	0.30	0.09	EPN-01*
5dkv.1.A	24.00	monomer	HHblits	X-ray	1.68Å	0.30	0.09	ABC transporter substrate binding protein (Ribose)
5dkv.4.A	24.00	monomer	HHblits	X-ray	1.68Å	0.30	0.09	ABC transporter substrate binding protein (Ribose)
1qnl.1.A	12.50	homo-tetramer	HHblits	X-ray	2.70Å	0.31	0.09	ALIPHATIC AMIDASE EXPRESSION-REGULATING PROTEIN
3nzg.1.A	11.54	homo-octamer	HHblits	X-ray	2.00Å	0.25	0.09	Putative racemase
4rs3.1.A	20.83	monomer	HHblits	X-ray	1.40Å	0.31	0.09	ABC transporter, carbohydrate uptake transporter-2 (CUT2) family, periplasmic sugar-binding protein
4rsm.1.A	16.67	monomer	HHblits	X-ray	1.60Å	0.31	0.09	Periplasmic binding protein/LacI transcriptional regulator
5bra.1.A	12.00	monomer	HHblits	X-ray	2.97Å	0.28	0.09	Putative periplasmic binding protein with substrate ribose
1drk.1.A	20.83	monomer	HHblits	X-ray	2.00Å	0.31	0.09	D-RIBOSE-BINDING PROTEIN
3lkv.1.A	7.41	homo-dimer	HHblits	X-ray	2.20Å	0.21	0.10	uncharacterized CONSERVED DOMAIN PROTEIN
2gx6.1.A	16.67	monomer	HHblits	X-ray	1.97Å	0.29	0.09	D-ribose-binding periplasmic protein
4yo7.1.A	8.00	monomer	HHblits	X-ray	1.70Å	0.26	0.09	Sugar ABC transporter (Sugar-binding protein)
1glg.1.A	16.67	monomer	HHblits	X-ray	2.00Å	0.29	0.09	GALACTOSE/GLUCOSE-BINDING PROTEIN
2qw1.1.A	16.67	monomer	HHblits	X-ray	1.70Å	0.29	0.09	D-galactose-binding periplasmic protein
2fvy.1.A	16.67	monomer	HHblits	X-ray	0.92Å	0.29	0.09	D-galactose-binding periplasmic protein
4up3.1.A	20.83	homo-dimer	HHblits	X-ray	1.44Å	0.29	0.09	THIOREDOXIN REDUCTASE
4up3.1.B	20.83	homo-dimer	HHblits	X-ray	1.44Å	0.29	0.09	THIOREDOXIN REDUCTASE
1qo0.1.A	13.04	hetero-oligomer	HHblits	X-ray	2.25Å	0.32	0.08	AMIC
1pea.1.A	13.04	homo-dimer	HHblits	X-ray	2.10Å	0.32	0.08	AMIDASE OPERON
2uyy.1.A	27.27	homo-tetramer	HHblits	X-ray	2.50Å	0.35	0.08	N-PAC PROTEIN
4evs.1.A	8.00	monomer	HHblits	X-ray	1.45Å	0.24	0.09	PUTATIVE ABC TRANSPORTER SUBUNIT, SUBSTRATE-BINDING COMPONENT
4zjp.1.A	17.39	monomer	HHblits	X-ray	1.63Å	0.31	0.08	Monosaccharide-transporting ATPase
4ru1.1.A	16.67	monomer	HHblits	X-ray	1.50Å	0.27	0.09	Monosaccharide ABC transporter substrate-binding protein, CUT2 family
4n0q.1.A	13.04	monomer	HHblits	X-ray	2.30Å	0.30	0.08	Leu/Ile/Val-binding protein homolog 3
5ufh.1.A	17.39	homo-dimer	HHblits	X-ray	1.45Å	0.30	0.08	LacI-type transcriptional regulator
2ipm.1.A	17.39	monomer	HHblits	X-ray	1.12Å	0.30	0.08	D-galactose-binding periplasmic protein
2ipn.1.A	17.39	monomer	HHblits	X-ray	1.15Å	0.30	0.08	D-galactose-binding periplasmic protein
2hph.1.A	17.39	monomer	HHblits	X-ray	1.33Å	0.30	0.08	D-galactose-binding periplasmic protein
5ibq.1.A	17.39	monomer	HHblits	X-ray	1.20Å	0.29	0.08	Probable ribose ABC transporter, substrate-binding protein
1tm2.1.A	13.04	monomer	HHblits	X-ray	1.90Å	0.29	0.08	sugar transport protein
1tjy.1.A	13.04	monomer	HHblits	X-ray	1.30Å	0.29	0.08	sugar transport protein
4rk0.1.A	17.39	homo-dimer	HHblits	X-ray	1.80Å	0.29	0.08	LacI family sugar-binding transcriptional regulator
4rk0.1.B	17.39	homo-dimer	HHblits	X-ray	1.80Å	0.29	0.08	LacI family sugar-binding transcriptional regulator
3ma0.1.A	13.04	monomer	HHblits	X-ray	2.20Å	0.29	0.08	D-xylose-binding periplasmic protein
3m9w.1.A	13.04	monomer	HHblits	X-ray	2.15Å	0.29	0.08	D-xylose-binding periplasmic protein
4y9t.1.A	8.33	monomer	HHblits	X-ray	1.80Å	0.25	0.09	ABC transporter, solute binding protein
1dbq.1.A	22.73	homo-dimer	HHblits	X-ray	2.20Å	0.32	0.08	PURINE REPRESSOR
1dbq.1.B	22.73	homo-dimer	HHblits	X-ray	2.20Å	0.32	0.08	PURINE REPRESSOR
1jhz.1.A	22.73	homo-dimer	HHblits	X-ray	2.40Å	0.32	0.08	PURINE NUCLEOTIDE SYNTHESIS REPRESSOR
1jhz.1.B	22.73	homo-dimer	HHblits	X-ray	2.40Å	0.32	0.08	PURINE NUCLEOTIDE SYNTHESIS REPRESSOR
2liv.1.A	22.73	monomer	HHblits	X-ray	2.40Å	0.32	0.08	LEUCINE
1urp.1.A	22.73	monomer	HHblits	X-ray	2.30Å	0.32	0.08	D-RIBOSE-BINDING PROTEIN
2dri.1.A	22.73	monomer	HHblits	X-ray	1.60Å	0.32	0.08	D-RIBOSE-BINDING PROTEIN
4a5l.1.A	17.39	homo-dimer	HHblits	X-ray	1.66Å	0.27	0.08	THIOREDOXIN REDUCTASE
4a5l.1.B	17.39	homo-dimer	HHblits	X-ray	1.66Å	0.27	0.08	THIOREDOXIN REDUCTASE
4ccr.1.A	17.39	homo-dimer	HHblits	X-ray	2.28Å	0.27	0.08	THIOREDOXIN REDUCTASE
5hsg.1.A	4.35	monomer	HHblits	X-ray	1.30Å	0.27	0.08	Putative ABC transporter, nucleotide binding/ATPase protein
2ipl.1.A	18.18	monomer	HHblits	X-ray	1.20Å	0.30	0.08	D-galactose-binding periplasmic protein
3ga5.1.A	18.18	monomer	HHblits	X-ray	1.87Å	0.30	0.08	D-galactose-binding periplasmic protein
5kws.1.A	18.18	monomer	HHblits	X-ray	1.32Å	0.30	0.08	Galactose-binding protein
1z16.1.A	23.81	monomer	HHblits	X-ray	1.72Å	0.33	0.08	Leu/Ile/Val-binding protein
1z15.1.A	23.81	monomer	HHblits	X-ray	1.70Å	0.33	0.08	Leu/Ile/Val-binding protein
2r68.1.A	4.17	monomer	HHblits	X-ray	2.40Å	0.21	0.09	Glycosyl transferase, group 1
4o5a.1.A	13.04	homo-dimer	HHblits	X-ray	1.78Å	0.25	0.08	LacI family transcription regulator
4jn7.1.A	4.35	homo-octamer	HHblits	X-ray	1.15Å	0.23	0.08	ENOLASE
3ejw.1.A	14.29	monomer	HHblits	X-ray	1.80Å	0.29	0.08	SmLsrB
3k9c.1.A	14.29	homo-dimer	HHblits	X-ray	2.14Å	0.29	0.08	Transcriptional regulator, LacI family protein
3c61.1.A	14.29	homo-dimer	HHblits	X-ray	1.80Å	0.27	0.08	Dihydroorotate dehydrogenase
4eyk.1.A	14.29	monomer	HHblits	X-ray	1.90Å	0.27	0.08	Twin-arginine translocation pathway signal
4ry0.1.A	9.52	monomer	HHblits	X-ray	1.40Å	0.26	0.08	Probable ribose ABC transporter, substrate-binding protein
1rvk.1.A	22.22	monomer	HHblits	X-ray	1.70Å	0.34	0.07	isomerase/lactonizing enzyme
3sqs.1.A	0.00	homo-octamer	HHblits	X-ray	1.90Å	0.22	0.06	mandelate racemase/muconate lactonizing protein