SWISS-MODEL | Workspace | Model Results

SWISS-MODEL Homology Modelling Report

Model Building Report

This document lists the results for the homology modelling project "A8Z3Z7" submitted to SWISS-MODEL workspace on Oct. 26, 2017, 8:37 p.m..The submitted primary amino acid sequence is given in Table T1.

If you use any results in your research, please cite the relevant publications:

Marco Biasini; Stefan Bienert; Andrew Waterhouse; Konstantin Arnold; Gabriel Studer; Tobias Schmidt; Florian Kiefer; Tiziano Gallo Cassarino; Martino Bertoni; Lorenza Bordoli; Torsten Schwede. (2014). SWISS-MODEL: modelling protein tertiary and quaternary structure using evolutionary information. Nucleic Acids Research (1 July 2014) 42 (W1): W252-W258; doi: 10.1093/nar/gku340.
Arnold, K., Bordoli, L., Kopp, J. and Schwede, T. (2006) The SWISS-MODEL workspace: a web-based environment for protein structure homology modelling. Bioinformatics, 22, 195-201.
Benkert, P., Biasini, M. and Schwede, T. (2011) Toward the estimation of the absolute quality of individual protein structure models. Bioinformatics, 27, 343-350

Results

The SWISS-MODEL template library (SMTL version 2017-10-23, PDB release 2017-10-13) was searched with Blast (Altschul et al., 1997) and HHBlits (Remmert, et al., 2011) for evolutionary related structures matching the target sequence in Table T1. For details on the template search, see Materials and Methods. Overall 1733 templates were found (Table T2).

Models

The following model was built (see Materials and Methods "Model Building"):

Model #01	File	Built with	Oligo-State	Ligands	GMQE	QMEAN
	PDB	ProMod3 Version 1.1.0.	MONOMER (matching prediction)	None	0.62	-3.66

QMEAN	-3.66
Cβ	-1.18
All Atom	-1.36
Solvation	-0.89
Torsion	-3.26

Template	Seq Identity	Oligo-state	Found by	Method	Resolution	Seq Similarity	Range	Coverage	Description
1f0k.1.B	25.44	homo-dimer	HHblits	X-ray	1.90Å	0.33		0.95	UDP-N-ACETYLGLUCOSAMINE-N-ACETYLMURAMYL-(PENTAPEPTIDE) PYROPHOSPHORYL-UNDECAPRENOL N-ACETYLGLUCOSAMINE TRANSFERASE

Ligand	Added to Model	Description
SO4	✕ - Not biologically relevant.	SULFATE ION

Target    MTKIAFTGGGTVGHVSVNLSLIPTALSQGYEALYIGSKNGIEREMIESQLPEIKYYPISSGKLRRYISLENAKDVFKVLK
1f0k.1.B  -KRLMVMAGGTGGHVFPGLAVAHHLMAQGWQVRWLGTADRMEADLVPKH--GIEIDFIRISGLRGKGIKALIAAPLRIFN

Target    GILDARKVLKKEKPDLLFSKGGFVSVPVVIAAKSLNIPTLIHESDLTPGLANKIALKFAKKIYTTFEETLNYLPKEKADF
1f0k.1.B  AWRQARAIMKAYKPDVVLGMGGYVSGPGGLAAWSLGIPVVLHEQNGIAGLTNKWLAKIATKVMQAFPGA---FPNA--EV

Target    IGATIREDLKNGNAHNGYQLTGFNENKKVLLVMGGSLGSKKLNSIIRENLDALLQQYQVIHLTGKGLKDAQVK-K-----
1f0k.1.B  VGNPVRTDVLALP--LPQQRLAGREGPVRVLVVGGSQGARILNQTMPQVAAKLGDSVTIWHQSGKGSQQSVEQAYAEAGQ

Target    SGYIQYEFVKEDLTDLLAITDTVISRAGSNAIYEFLTLRIPMLLVPLGLDQSRGDQIDNANHFADKGYAKAIDEEQLTAQ
1f0k.1.B  PQHKVTEFI-DDMAAAYAWADVVVCRSGALTVSEIAAAGLPALFVPFQ--HKDRQQYWNALPLEKAGAAKIIEQPQLSVD

Target    ILLQELNEMEQERTR---IINNMKSYEQSYTKEALFDKMIKDALN
1f0k.1.B  AVANTLAGW--SRETLLTMAERARAASIPDATERVAN-EVSRV--

Materials and Methods

Template Search

Template search with Blast and HHBlits has been performed against the SWISS-MODEL template library (SMTL, last update: 2017-10-23, last included PDB release: 2017-10-13).

The target sequence was searched with BLAST (Altschul et al., 1997) against the primary amino acid sequence contained in the SMTL. A total of 5 templates were found.

An initial HHblits profile has been built using the procedure outlined in (Remmert, et al., 2011), followed by 1 iteration of HHblits against NR20. The obtained profile has then be searched against all profiles of the SMTL. A total of 1732 templates were found.

Template Selection

For each identified template, the template's quality has been predicted from features of the target-template alignment. The templates with the highest quality have then been selected for model building.

Model Building

Models are built based on the target-template alignment using ProMod3. Coordinates which are conserved between the target and the template are copied from the template to the model. Insertions and deletions are remodelled using a fragment library. Side chains are then rebuilt. Finally, the geometry of the resulting model is regularized by using a force field. In case loop modelling with ProMod3 fails, an alternative model is built with PROMOD-II (Guex, et al., 1997).

Model Quality Estimation

The global and per-residue model quality has been assessed using the QMEAN scoring function (Benkert, et al., 2011) . For improved performance, weights of the individual QMEAN terms have been trained specifically for SWISS-MODEL.

Ligand Modelling

Ligands present in the template structure are transferred by homology to the model when the following criteria are met (Gallo -Casserino, to be published): (a) The ligands are annotated as biologically relevant in the template library, (b) the ligand is in contact with the model, (c) the ligand is not clashing with the protein, (d) the residues in contact with the ligand are conserved between the target and the template. If any of these four criteria is not satisfied, a certain ligand will not be included in the model. The model summary includes information on why and which ligand has not been included.

Oligomeric State Conservation

Homo-oligomeric structure of the target protein is predicted based on the analysis of pairwise interfaces of the identified template structures. For each relevant interface between polypeptide chains (interfaces with more than 10 residue-residue interactions), the QscoreOligomer (Mariani et al., 2011) is predicted from features such as similarity to target and frequency of observing this interface in the identified templates (Kiefer, Bertoni, Biasini, to be published). The prediction is performed with a random forest regressor using these features as input parameters to predict the probability of conservation for each interface. The QscoreOligomer of the whole complex is then calculated as the weight-averaged QscoreOligomer of the interfaces. The oligomeric state of the target is predicted to be the same as in the template when QscoreOligomer is predicted to be higher or equal to 0.5.

References

Altschul, S.F., Madden, T.L., Schaffer, A.A., Zhang, J., Zhang, Z., Miller, W. and Lipman, D.J. (1997) Gapped BLAST and PSI-BLAST: a new generation of protein database search programs. Nucleic Acids Res, 25, 3389-3402.
Remmert, M., Biegert, A., Hauser, A. and Soding, J. (2012) HHblits: lightning-fast iterative protein sequence searching by HMM-HMM alignment. Nat Methods, 9, 173-175.
Guex, N. and Peitsch, M.C. (1997) SWISS-MODEL and the Swiss-PdbViewer: an environment for comparative protein modeling. Electrophoresis, 18, 2714-2723.
Sali, A. and Blundell, T.L. (1993) Comparative protein modelling by satisfaction of spatial restraints. J Mol Biol, 234, 779-815.
Benkert, P., Biasini, M. and Schwede, T. (2011) Toward the estimation of the absolute quality of individual protein structure models. Bioinformatics, 27, 343-350.
Mariani, V., Kiefer, F., Schmidt, T., Haas, J. and Schwede, T. (2011) Assessment of template based protein structure predictions in CASP9. Proteins, 79 Suppl 10, 37-58.

Table T1:

Primary amino acid sequence for which templates were searched and models were built.

MTKIAFTGGGTVGHVSVNLSLIPTALSQGYEALYIGSKNGIEREMIESQLPEIKYYPISSGKLRRYISLENAKDVFKVLKGILDARKVLKKEKPDLLFSK
GGFVSVPVVIAAKSLNIPTLIHESDLTPGLANKIALKFAKKIYTTFEETLNYLPKEKADFIGATIREDLKNGNAHNGYQLTGFNENKKVLLVMGGSLGSK
KLNSIIRENLDALLQQYQVIHLTGKGLKDAQVKKSGYIQYEFVKEDLTDLLAITDTVISRAGSNAIYEFLTLRIPMLLVPLGLDQSRGDQIDNANHFADK
GYAKAIDEEQLTAQILLQELNEMEQERTRIINNMKSYEQSYTKEALFDKMIKDALN

Table T2:

Template	Seq Identity	Oligo-state	Found by	Method	Resolution	Seq Similarity	Coverage	Description
3s2u.1.A	27.84	monomer	BLAST	X-ray	2.23Å	0.34	0.94	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase
3s2u.1.A	23.98	monomer	HHblits	X-ray	2.23Å	0.32	0.96	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase
1f0k.1.A	25.44	homo-dimer	HHblits	X-ray	1.90Å	0.33	0.95	UDP-N-ACETYLGLUCOSAMINE-N-ACETYLMURAMYL-(PENTAPEPTIDE) PYROPHOSPHORYL-UNDECAPRENOL N-ACETYLGLUCOSAMINE TRANSFERASE
1f0k.1.B	25.44	homo-dimer	HHblits	X-ray	1.90Å	0.33	0.95	UDP-N-ACETYLGLUCOSAMINE-N-ACETYLMURAMYL-(PENTAPEPTIDE) PYROPHOSPHORYL-UNDECAPRENOL N-ACETYLGLUCOSAMINE TRANSFERASE
1nlm.1.A	25.44	homo-dimer	HHblits	X-ray	2.50Å	0.33	0.95	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase
1nlm.1.B	25.44	homo-dimer	HHblits	X-ray	2.50Å	0.33	0.95	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase
4wyi.1.A	15.84	monomer	HHblits	X-ray	2.50Å	0.28	0.96	Monogalactosyldiacylglycerol synthase 1, chloroplastic
4x1t.1.A	15.84	monomer	HHblits	X-ray	2.25Å	0.28	0.96	Monogalactosyldiacylglycerol synthase 1, chloroplastic
2acw.1.A	15.54	homo-dimer	HHblits	X-ray	2.60Å	0.28	0.96	triterpene UDP-glucosyl transferase UGT71G1
2acw.1.B	15.54	homo-dimer	HHblits	X-ray	2.60Å	0.28	0.96	triterpene UDP-glucosyl transferase UGT71G1
1f0k.1.A	28.85	homo-dimer	BLAST	X-ray	1.90Å	0.35	0.88	UDP-N-ACETYLGLUCOSAMINE-N-ACETYLMURAMYL-(PENTAPEPTIDE) PYROPHOSPHORYL-UNDECAPRENOL N-ACETYLGLUCOSAMINE TRANSFERASE
1f0k.1.B	28.85	homo-dimer	BLAST	X-ray	1.90Å	0.35	0.88	UDP-N-ACETYLGLUCOSAMINE-N-ACETYLMURAMYL-(PENTAPEPTIDE) PYROPHOSPHORYL-UNDECAPRENOL N-ACETYLGLUCOSAMINE TRANSFERASE
1nlm.1.A	28.85	homo-dimer	BLAST	X-ray	2.50Å	0.35	0.88	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase
1nlm.1.B	28.85	homo-dimer	BLAST	X-ray	2.50Å	0.35	0.88	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase
3wc4.1.A	15.34	monomer	HHblits	X-ray	1.85Å	0.28	0.95	UDP-glucose:anthocyanidin 3-O-glucosyltransferase
2iyf.1.A	18.26	monomer	HHblits	X-ray	1.70Å	0.29	0.94	OLEANDOMYCIN GLYCOSYLTRANSFERASE
2iyf.2.A	18.26	monomer	HHblits	X-ray	1.70Å	0.29	0.94	OLEANDOMYCIN GLYCOSYLTRANSFERASE
4m60.1.A	18.26	monomer	HHblits	X-ray	1.77Å	0.29	0.94	Oleandomycin glycosyltransferase
4m83.1.A	18.26	monomer	HHblits	X-ray	1.70Å	0.29	0.94	Oleandomycin glycosyltransferase
4m83.2.A	18.26	monomer	HHblits	X-ray	1.70Å	0.29	0.94	Oleandomycin glycosyltransferase
5xvm.1.A	16.67	monomer	HHblits	X-ray	2.77Å	0.29	0.94	Sterol 3-beta-glucosyltransferase
2iya.1.A	17.12	monomer	HHblits	X-ray	1.70Å	0.29	0.94	OLEANDOMYCIN GLYCOSYLTRANSFERASE
4rie.1.A	17.61	homo-dimer	HHblits	X-ray	2.16Å	0.28	0.94	Glycosyl transferase homolog
4rie.1.B	17.61	homo-dimer	HHblits	X-ray	2.16Å	0.28	0.94	Glycosyl transferase homolog
4rif.1.A	17.61	homo-dimer	HHblits	X-ray	1.85Å	0.28	0.94	Glycosyl transferase homolog
4rif.1.B	17.61	homo-dimer	HHblits	X-ray	1.85Å	0.28	0.94	Glycosyl transferase homolog
5gl5.1.A	16.42	homo-dimer	HHblits	X-ray	1.90Å	0.28	0.94	Sterol 3-beta-glucosyltransferase
5gl5.1.B	16.42	homo-dimer	HHblits	X-ray	1.90Å	0.28	0.94	Sterol 3-beta-glucosyltransferase
4g2t.1.A	16.12	homo-dimer	HHblits	X-ray	2.41Å	0.28	0.94	SsfS6
2c1x.1.A	13.57	monomer	HHblits	X-ray	1.90Å	0.27	0.95	UDP-GLUCOSE FLAVONOID 3-O GLYCOSYLTRANSFERASE
3hbf.1.A	15.73	monomer	HHblits	X-ray	2.10Å	0.28	0.95	Flavonoid 3-O-glucosyltransferase
3hbj.1.A	15.73	monomer	HHblits	X-ray	2.10Å	0.28	0.95	Flavonoid 3-O-glucosyltransferase
4rii.1.A	17.01	homo-dimer	HHblits	X-ray	2.00Å	0.28	0.94	Glycosyl transferase homolog,Glycosyl transferase
4rih.1.A	17.01	homo-dimer	HHblits	X-ray	2.22Å	0.28	0.94	Glycosyl transferase homolog,Glycosyl transferase
4rig.1.B	17.01	homo-dimer	HHblits	X-ray	1.90Å	0.28	0.94	Glycosyl transferase
4rig.1.A	17.01	homo-dimer	HHblits	X-ray	1.90Å	0.28	0.94	Glycosyl transferase
4fzr.1.A	15.82	homo-dimer	HHblits	X-ray	2.40Å	0.28	0.94	SsfS6
3otg.1.A	14.50	monomer	HHblits	X-ray	2.08Å	0.27	0.95	CalG1
3oth.1.A	14.50	monomer	HHblits	X-ray	2.30Å	0.27	0.95	CalG1
3wad.1.A	15.38	homo-dimer	HHblits	X-ray	2.00Å	0.27	0.95	Glycosyltransferase
3ia7.1.A	14.63	homo-dimer	HHblits	X-ray	1.91Å	0.28	0.94	CalG4
3ia7.1.B	14.63	homo-dimer	HHblits	X-ray	1.91Å	0.28	0.94	CalG4
5tmd.1.A	12.35	monomer	HHblits	X-ray	2.19Å	0.27	0.96	Glycosyltransferase, Os79
5tmb.1.A	12.35	monomer	HHblits	X-ray	2.34Å	0.27	0.96	Glycosyltransferase, Os79
5du2.1.A	14.03	monomer	HHblits	X-ray	2.70Å	0.28	0.94	EspG2 glycosyltransferase
5du2.2.A	14.03	monomer	HHblits	X-ray	2.70Å	0.28	0.94	EspG2 glycosyltransferase
4lei.1.A	15.96	homo-dimer	HHblits	X-ray	3.15Å	0.28	0.93	NDP-forosamyltransferase
4lei.1.B	15.96	homo-dimer	HHblits	X-ray	3.15Å	0.28	0.93	NDP-forosamyltransferase
2yjn.1.A	14.54	hetero-oligomer	HHblits	X-ray	3.09Å	0.27	0.95	GLYCOSYLTRANSFERASE
3rsc.1.A	13.17	monomer	HHblits	X-ray	2.19Å	0.27	0.94	CalG2
3iaa.1.A	12.87	homo-dimer	HHblits	X-ray	2.51Å	0.27	0.94	CalG2
5enz.1.A	17.43	homo-dimer	HHblits	X-ray	1.91Å	0.29	0.92	UDP-GlcNAc 2-epimerase
5enz.1.B	17.43	homo-dimer	HHblits	X-ray	1.91Å	0.29	0.92	UDP-GlcNAc 2-epimerase
3guh.1.A	13.27	monomer	HHblits	X-ray	2.79Å	0.26	0.95	Glycogen synthase
1rzu.1.A	11.73	monomer	HHblits	X-ray	2.30Å	0.25	0.96	Glycogen synthase 1
1rzu.2.A	11.73	monomer	HHblits	X-ray	2.30Å	0.25	0.96	Glycogen synthase 1
3d1j.1.A	14.03	monomer	HHblits	X-ray	3.00Å	0.26	0.94	Glycogen synthase
1f6d.1.B	15.29	homo-dimer	HHblits	X-ray	2.50Å	0.28	0.92	UDP-N-ACETYLGLUCOSAMINE 2-EPIMERASE
1f6d.1.A	15.29	homo-dimer	HHblits	X-ray	2.50Å	0.28	0.92	UDP-N-ACETYLGLUCOSAMINE 2-EPIMERASE
4amb.1.A	12.91	homo-dimer	HHblits	X-ray	2.62Å	0.26	0.94	SNOGD
4amg.1.A	12.91	homo-dimer	HHblits	X-ray	2.59Å	0.26	0.94	SNOGD
4amg.1.B	12.91	homo-dimer	HHblits	X-ray	2.59Å	0.26	0.94	SNOGD
4an4.1.A	12.91	homo-dimer	HHblits	X-ray	2.70Å	0.26	0.94	GLYCOSYL TRANSFERASE
4an4.1.B	12.91	homo-dimer	HHblits	X-ray	2.70Å	0.26	0.94	GLYCOSYL TRANSFERASE
4an4.2.A	12.91	homo-dimer	HHblits	X-ray	2.70Å	0.26	0.94	GLYCOSYL TRANSFERASE
2vg8.1.A	17.18	monomer	HHblits	X-ray	1.75Å	0.28	0.92	HYDROQUINONE GLUCOSYLTRANSFERASE
4hwg.1.A	18.15	homo-hexamer	HHblits	X-ray	2.00Å	0.28	0.91	UDP-N-acetylglucosamine 2-epimerase
3beo.1.A	13.80	homo-dimer	HHblits	X-ray	1.70Å	0.28	0.92	UDP-N-acetylglucosamine 2-epimerase
1vgv.1.B	15.29	homo-dimer	HHblits	X-ray	2.31Å	0.28	0.92	UDP-N-acetylglucosamine 2-epimerase
1vgv.1.A	15.29	homo-dimer	HHblits	X-ray	2.31Å	0.28	0.92	UDP-N-acetylglucosamine 2-epimerase
1vgv.2.B	15.29	homo-dimer	HHblits	X-ray	2.31Å	0.28	0.92	UDP-N-acetylglucosamine 2-epimerase
3cop.1.A	13.13	monomer	HHblits	X-ray	2.30Å	0.26	0.94	Glycogen synthase
1rrv.1.A	13.81	monomer	HHblits	X-ray	2.00Å	0.26	0.94	GLYCOSYLTRANSFERASE GTFD
2bis.1.A	15.90	monomer	HHblits	X-ray	2.80Å	0.28	0.92	GLGA GLYCOGEN SYNTHASE
2bis.2.A	15.90	monomer	HHblits	X-ray	2.80Å	0.28	0.92	GLGA GLYCOGEN SYNTHASE
2acv.1.A	15.60	homo-dimer	HHblits	X-ray	2.00Å	0.27	0.92	triterpene UDP-glucosyl transferase UGT71G1
2acv.1.B	15.60	homo-dimer	HHblits	X-ray	2.00Å	0.27	0.92	triterpene UDP-glucosyl transferase UGT71G1
3tsa.1.A	12.73	homo-dimer	HHblits	X-ray	1.70Å	0.27	0.93	NDP-rhamnosyltransferase
3tsa.1.B	12.73	homo-dimer	HHblits	X-ray	1.70Å	0.27	0.93	NDP-rhamnosyltransferase
2p6p.1.A	14.02	homo-dimer	HHblits	X-ray	1.88Å	0.27	0.92	Glycosyl transferase
2p6p.1.B	14.02	homo-dimer	HHblits	X-ray	1.88Å	0.27	0.92	Glycosyl transferase
1pnv.1.A	15.32	homo-dimer	HHblits	X-ray	2.80Å	0.26	0.94	GLYCOSYLTRANSFERASE GTFA
1pnv.1.B	15.32	homo-dimer	HHblits	X-ray	2.80Å	0.26	0.94	GLYCOSYLTRANSFERASE GTFA
5dld.1.A	14.11	monomer	HHblits	X-ray	1.45Å	0.28	0.92	UDP-N-Acetylglucosamine 2-epimerase
3dzc.1.A	16.26	homo-dimer	HHblits	X-ray	2.35Å	0.27	0.92	UDP-N-acetylglucosamine 2-epimerase
3dzc.1.B	16.26	homo-dimer	HHblits	X-ray	2.35Å	0.27	0.92	UDP-N-acetylglucosamine 2-epimerase
1iir.1.A	15.36	monomer	HHblits	X-ray	1.80Å	0.26	0.93	glycosyltransferase GtfB
3uyl.1.A	12.77	homo-dimer	HHblits	X-ray	1.85Å	0.27	0.92	NDP-rhamnosyltransferase
3h4i.1.A	16.01	monomer	HHblits	X-ray	1.30Å	0.26	0.93	Glycosyltransferase GtfA, Glycosyltransferase
3l01.1.A	14.94	monomer	HHblits	X-ray	2.60Å	0.27	0.92	GlgA glycogen synthase
3ot5.1.A	11.85	monomer	HHblits	X-ray	2.20Å	0.26	0.92	UDP-N-acetylglucosamine 2-epimerase
3ot5.2.A	11.85	monomer	HHblits	X-ray	2.20Å	0.26	0.92	UDP-N-acetylglucosamine 2-epimerase
5d00.1.A	13.27	homo-dimer	HHblits	X-ray	2.15Å	0.27	0.91	N-acetyl-alpha-D-glucosaminyl L-malate synthase
5u6m.1.A	14.86	monomer	HHblits	X-ray	2.57Å	0.28	0.91	UDP-glycosyltransferase 74F2
5u6m.2.A	14.86	monomer	HHblits	X-ray	2.57Å	0.28	0.91	UDP-glycosyltransferase 74F2
5u6s.1.A	14.86	monomer	HHblits	X-ray	2.00Å	0.28	0.91	UDP-glycosyltransferase 74F2
5u6s.2.A	14.86	monomer	HHblits	X-ray	2.00Å	0.28	0.91	UDP-glycosyltransferase 74F2
4neq.1.A	14.64	homo-dimer	HHblits	X-ray	2.85Å	0.28	0.90	UDP-N-acetylglucosamine 2-epimerase
4nes.1.A	14.64	homo-dimer	HHblits	X-ray	1.42Å	0.28	0.90	UDP-N-acetylglucosamine 2-epimerase
5v2k.1.A	14.55	monomer	HHblits	X-ray	2.00Å	0.27	0.91	UDP-glycosyltransferase 74F2
5v2k.2.A	14.55	monomer	HHblits	X-ray	2.00Å	0.27	0.91	UDP-glycosyltransferase 74F2
5u6n.2.A	14.86	monomer	HHblits	X-ray	2.00Å	0.27	0.91	UDP-glycosyltransferase 74F2
5u6n.1.A	14.86	monomer	HHblits	X-ray	2.00Å	0.27	0.91	UDP-glycosyltransferase 74F2
1o6c.1.A	11.31	homo-dimer	HHblits	X-ray	2.90Å	0.26	0.92	UDP-N-acetylglucosamine 2-epimerase
1o6c.1.B	11.31	homo-dimer	HHblits	X-ray	2.90Å	0.26	0.92	UDP-N-acetylglucosamine 2-epimerase
4fkz.1.A	11.31	homo-dimer	HHblits	X-ray	1.69Å	0.26	0.92	UDP-N-acetylglucosamine 2-epimerase
3fro.1.A	14.86	homo-trimer	HHblits	X-ray	2.50Å	0.27	0.91	GlgA glycogen synthase
3fro.1.B	14.86	homo-trimer	HHblits	X-ray	2.50Å	0.27	0.91	GlgA glycogen synthase
3fro.1.C	14.86	homo-trimer	HHblits	X-ray	2.50Å	0.27	0.91	GlgA glycogen synthase
2iv7.1.A	14.73	monomer	HHblits	X-ray	1.60Å	0.27	0.90	LIPOPOLYSACCHARIDE CORE BIOSYNTHESIS PROTEIN RFAG
4xsr.1.A	15.31	homo-dimer	HHblits	X-ray	2.39Å	0.27	0.90	Alr3699 protein
4xsp.1.B	15.31	homo-dimer	HHblits	X-ray	2.15Å	0.27	0.90	Alr3699 protein
4xso.1.A	15.31	homo-dimer	HHblits	X-ray	2.01Å	0.27	0.90	Alr3699 protein
2pq6.1.A	13.66	monomer	HHblits	X-ray	2.10Å	0.27	0.90	UDP-glucuronosyl/UDP-glucosyltransferase
1v4v.1.A	11.35	homo-dimer	HHblits	X-ray	1.80Å	0.25	0.92	UDP-N-Acetylglucosamine 2-Epimerase
1v4v.1.B	11.35	homo-dimer	HHblits	X-ray	1.80Å	0.25	0.92	UDP-N-Acetylglucosamine 2-Epimerase
2r68.1.A	11.15	monomer	HHblits	X-ray	2.40Å	0.26	0.91	Glycosyl transferase, group 1
2jjm.1.A	11.67	homo-tetramer	HHblits	X-ray	3.10Å	0.27	0.89	GLYCOSYL TRANSFERASE, GROUP 1 FAMILY PROTEIN
3oka.1.A	9.94	hetero-oligomer	HHblits	X-ray	2.20Å	0.26	0.90	GDP-mannose-dependent alpha-(1-6)-phosphatidylinositol monomannoside mannosyltransferase
3c4q.1.A	12.46	homo-dimer	HHblits	X-ray	2.80Å	0.26	0.90	Predicted glycosyltransferases
3oti.1.A	11.80	monomer	HHblits	X-ray	1.60Å	0.26	0.90	CalG3
3d0r.1.B	11.80	homo-dimer	HHblits	X-ray	1.90Å	0.26	0.90	Protein CalG3
3d0r.1.A	11.80	homo-dimer	HHblits	X-ray	1.90Å	0.26	0.90	Protein CalG3
3d0q.1.A	11.80	homo-dimer	HHblits	X-ray	2.79Å	0.26	0.90	Protein CalG3
3c48.1.A	12.46	homo-dimer	HHblits	X-ray	2.10Å	0.26	0.90	Predicted glycosyltransferases
3oy2.1.A	10.09	homo-dimer	HHblits	X-ray	2.31Å	0.26	0.89	Glycosyltransferase B736L
3okp.1.A	10.41	monomer	HHblits	X-ray	2.00Å	0.26	0.89	GDP-mannose-dependent alpha-(1-6)-phosphatidylinositol monomannoside mannosyltransferase
2gek.1.A	11.60	monomer	HHblits	X-ray	2.40Å	0.25	0.90	PHOSPHATIDYLINOSITOL MANNOSYLTRANSFERASE (PimA)
4nc9.2.A	11.95	monomer	HHblits	X-ray	3.19Å	0.25	0.89	GDP-mannose-dependent alpha-(1-2)-phosphatidylinositol mannosyltransferase
4nc9.1.A	11.95	monomer	HHblits	X-ray	3.19Å	0.25	0.89	GDP-mannose-dependent alpha-(1-2)-phosphatidylinositol mannosyltransferase
4n9w.1.A	11.95	monomer	HHblits	X-ray	1.94Å	0.25	0.89	GDP-mannose-dependent alpha-(1-2)-phosphatidylinositol mannosyltransferase
2xa1.1.A	10.28	monomer	HHblits	X-ray	2.47Å	0.25	0.90	TREHALOSE-SYNTHASE TRET
2x6r.1.A	10.28	monomer	HHblits	X-ray	2.20Å	0.25	0.90	TREHALOSE-SYNTHASE TRET
2xa9.1.A	10.31	monomer	HHblits	X-ray	2.50Å	0.24	0.90	TREHALOSE-SYNTHASE TRET
3mbo.1.A	12.70	homo-dimer	HHblits	X-ray	3.31Å	0.27	0.86	Glycosyltransferase, group 1 family
3mbo.1.B	12.70	homo-dimer	HHblits	X-ray	3.31Å	0.27	0.86	Glycosyltransferase, group 1 family
3mbo.2.A	12.70	homo-dimer	HHblits	X-ray	3.31Å	0.27	0.86	Glycosyltransferase, group 1 family
3mbo.2.B	12.70	homo-dimer	HHblits	X-ray	3.31Å	0.27	0.86	Glycosyltransferase, group 1 family
3mbo.3.A	12.70	homo-dimer	HHblits	X-ray	3.31Å	0.27	0.86	Glycosyltransferase, group 1 family
3mbo.3.B	12.70	homo-dimer	HHblits	X-ray	3.31Å	0.27	0.86	Glycosyltransferase, group 1 family
3mbo.4.A	12.70	homo-dimer	HHblits	X-ray	3.31Å	0.27	0.86	Glycosyltransferase, group 1 family
3mbo.4.B	12.70	homo-dimer	HHblits	X-ray	3.31Å	0.27	0.86	Glycosyltransferase, group 1 family
2xgs.1.A	11.78	monomer	HHblits	X-ray	2.39Å	0.25	0.88	XCOGT
2xgm.2.A	11.78	monomer	HHblits	X-ray	2.55Å	0.25	0.88	XCOGT
2vsy.1.A	11.78	monomer	HHblits	X-ray	2.10Å	0.25	0.88	XCC0866
2vsy.2.A	11.78	monomer	HHblits	X-ray	2.10Å	0.25	0.88	XCC0866
4xyw.1.A	13.20	monomer	HHblits	X-ray	2.20Å	0.26	0.85	O-antigen biosynthesis glycosyltransferase WbnH
2vsn.1.A	10.71	monomer	HHblits	X-ray	2.75Å	0.25	0.87	XCOGT
2h1f.1.A	12.88	monomer	HHblits	X-ray	2.40Å	0.26	0.83	Lipopolysaccharide heptosyltransferase-1
2h1f.2.A	12.88	monomer	HHblits	X-ray	2.40Å	0.26	0.83	Lipopolysaccharide heptosyltransferase-1
2gt1.1.A	13.27	monomer	HHblits	X-ray	1.90Å	0.27	0.83	Lipopolysaccharide heptosyltransferase-1
2gt1.2.A	13.27	monomer	HHblits	X-ray	1.90Å	0.27	0.83	Lipopolysaccharide heptosyltransferase-1
2xci.1.A	14.13	homo-dimer	HHblits	X-ray	2.00Å	0.28	0.78	3-DEOXY-D-MANNO-2-OCTULOSONIC ACID TRANSFERASE
3hbm.1.A	17.58	monomer	HHblits	X-ray	1.80Å	0.28	0.72	UDP-sugar hydrolase
3hbn.1.A	17.58	monomer	HHblits	X-ray	1.85Å	0.28	0.72	UDP-sugar hydrolase
4zht.1.A	15.18	homo-tetramer	HHblits	X-ray	2.69Å	0.27	0.72	Bifunctional UDP-N-acetylglucosamine 2-epimerase/N-acetylmannosamine kinase
1psw.1.A	14.68	monomer	HHblits	X-ray	2.00Å	0.28	0.71	ADP-HEPTOSE LPS HEPTOSYLTRANSFERASE II
4x7r.1.A	11.24	monomer	HHblits	X-ray	2.15Å	0.28	0.70	TarM
4x7m.2.A	11.24	monomer	HHblits	X-ray	2.40Å	0.28	0.70	Uncharacterized protein
4x7m.1.A	11.24	monomer	HHblits	X-ray	2.40Å	0.28	0.70	Uncharacterized protein
4wac.1.A	11.69	homo-trimer	HHblits	X-ray	2.40Å	0.28	0.70	Glycosyl transferase, group 1 family protein
4wad.1.A	11.69	homo-trimer	HHblits	X-ray	2.80Å	0.28	0.70	Glycosyl transferase, group 1 family protein
4x6l.1.A	11.29	homo-trimer	HHblits	X-ray	3.19Å	0.28	0.70	TarM
4x7p.1.A	11.29	homo-trimer	HHblits	X-ray	3.40Å	0.28	0.70	TarM
5djs.1.A	8.24	monomer	HHblits	X-ray	2.80Å	0.25	0.72	Tetratricopeptide TPR_2 repeat protein
3q3h.1.A	11.07	monomer	HHblits	X-ray	2.25Å	0.25	0.71	HMW1C-like glycosyltransferase
2iv3.1.A	14.80	homo-dimer	HHblits	X-ray	2.30Å	0.26	0.70	GLYCOSYLTRANSFERASE
4rbn.1.A	12.60	homo-tetramer	HHblits	X-ray	3.05Å	0.27	0.69	Sucrose synthase:Glycosyl transferases group 1
4rbn.1.B	12.60	homo-tetramer	HHblits	X-ray	3.05Å	0.27	0.69	Sucrose synthase:Glycosyl transferases group 1
4rbn.1.C	12.60	homo-tetramer	HHblits	X-ray	3.05Å	0.27	0.69	Sucrose synthase:Glycosyl transferases group 1
4rbn.1.D	12.60	homo-tetramer	HHblits	X-ray	3.05Å	0.27	0.69	Sucrose synthase:Glycosyl transferases group 1
3s27.1.A	13.01	homo-tetramer	HHblits	X-ray	2.91Å	0.26	0.69	Sucrose synthase 1
3s27.1.B	13.01	homo-tetramer	HHblits	X-ray	2.91Å	0.26	0.69	Sucrose synthase 1
4pqg.1.A	11.02	monomer	HHblits	X-ray	2.00Å	0.26	0.69	Glycosyltransferase Gtf1
5e9t.1.A	8.26	hetero-oligomer	HHblits	X-ray	2.92Å	0.25	0.68	Glycosyltransferase Gtf1
5e9t.1.C	8.26	hetero-oligomer	HHblits	X-ray	2.92Å	0.25	0.68	Glycosyltransferase Gtf1
5e9u.1.A	8.26	hetero-oligomer	HHblits	X-ray	3.84Å	0.25	0.68	Glycosyltransferase Gtf1
5e9u.1.C	8.26	hetero-oligomer	HHblits	X-ray	3.84Å	0.25	0.68	Glycosyltransferase Gtf1
5e9u.2.A	8.26	hetero-oligomer	HHblits	X-ray	3.84Å	0.25	0.68	Glycosyltransferase Gtf1
5e9u.2.C	8.26	hetero-oligomer	HHblits	X-ray	3.84Å	0.25	0.68	Glycosyltransferase Gtf1
4w6q.1.A	11.64	homo-tetramer	HHblits	X-ray	2.70Å	0.26	0.65	glucosyltransferase
4w6q.1.B	11.64	homo-tetramer	HHblits	X-ray	2.70Å	0.26	0.65	glucosyltransferase
4w6q.1.C	11.64	homo-tetramer	HHblits	X-ray	2.70Å	0.26	0.65	glucosyltransferase
4w6q.1.D	11.64	homo-tetramer	HHblits	X-ray	2.70Å	0.26	0.65	glucosyltransferase
3vue.1.A	10.62	monomer	HHblits	X-ray	2.70Å	0.25	0.63	Granule-bound starch synthase 1, chloroplastic/amyloplastic
3rhz.1.A	9.68	homo-tetramer	HHblits	X-ray	1.90Å	0.26	0.61	Nucleotide sugar synthetase-like protein
3qkw.1.A	9.72	homo-tetramer	HHblits	X-ray	2.29Å	0.26	0.61	Nucleotide sugar synthetase-like protein
3l7i.1.A	13.73	homo-tetramer	HHblits	X-ray	2.70Å	0.28	0.57	Teichoic acid biosynthesis protein F
2q6v.1.A	11.48	monomer	HHblits	X-ray	2.28Å	0.26	0.59	Glucuronosyltransferase GumK
3cv3.1.A	11.00	monomer	HHblits	X-ray	2.25Å	0.26	0.59	Glucuronosyltransferase GumK
4hln.1.A	14.57	monomer	HHblits	X-ray	2.70Å	0.26	0.56	Starch synthase I
2ks6.1.A	19.48	monomer	HHblits	NMR	NA	0.29	0.43	UDP-N-acetylglucosamine transferase subunit ALG13
2o6l.1.A	24.00	homo-dimer	HHblits	X-ray	1.80Å	0.31	0.42	UDP-glucuronosyltransferase 2B7
2o6l.1.B	24.00	homo-dimer	HHblits	X-ray	1.80Å	0.31	0.42	UDP-glucuronosyltransferase 2B7
5i45.1.A	11.69	monomer	HHblits	X-ray	1.35Å	0.27	0.43	Glycosyl transferases group 1 family protein
5e9t.1.B	11.56	hetero-oligomer	HHblits	X-ray	2.92Å	0.26	0.41	Glycosyltransferase-stabilizing protein Gtf2
5e9t.1.D	11.56	hetero-oligomer	HHblits	X-ray	2.92Å	0.26	0.41	Glycosyltransferase-stabilizing protein Gtf2
5e9u.1.B	11.64	hetero-oligomer	HHblits	X-ray	3.84Å	0.26	0.41	Glycosyltransferase-stabilizing protein Gtf2
5e9u.1.D	11.64	hetero-oligomer	HHblits	X-ray	3.84Å	0.26	0.41	Glycosyltransferase-stabilizing protein Gtf2
5e9u.2.B	11.64	hetero-oligomer	HHblits	X-ray	3.84Å	0.26	0.41	Glycosyltransferase-stabilizing protein Gtf2
5e9u.2.D	11.64	hetero-oligomer	HHblits	X-ray	3.84Å	0.26	0.41	Glycosyltransferase-stabilizing protein Gtf2
2f9f.1.A	11.81	monomer	HHblits	X-ray	1.80Å	0.26	0.40	first mannosyl transferase (wbaZ-1)
2bfw.1.A	14.60	monomer	HHblits	X-ray	1.80Å	0.27	0.38	GLGA GLYCOGEN SYNTHASE
2jzc.1.A	22.14	monomer	HHblits	NMR	NA	0.30	0.37	UDP-N-acetylglucosamine transferase subunit ALG13
3qhp.1.A	17.97	monomer	HHblits	X-ray	1.50Å	0.30	0.36	Type 1 capsular polysaccharide biosynthesis protein J (CapJ)
3qhp.2.A	17.97	monomer	HHblits	X-ray	1.50Å	0.30	0.36	Type 1 capsular polysaccharide biosynthesis protein J (CapJ)
2x0d.1.A	17.69	homo-dimer	HHblits	X-ray	2.28Å	0.28	0.37	WSAF
2x0f.1.A	17.83	homo-dimer	HHblits	X-ray	2.55Å	0.28	0.36	WSAF
5mrc.41.A	20.18	monomer	HHblits	EM	NA	0.31	0.32	uS2m
4i36.1.A	22.41	homo-tetramer	HHblits	X-ray	2.30Å	0.29	0.33	6-phosphofructokinase
4i7e.1.B	22.41	homo-tetramer	HHblits	X-ray	2.00Å	0.29	0.33	6-phosphofructokinase
3pfk.1.A	22.41	homo-tetramer	HHblits	X-ray	2.40Å	0.29	0.33	PHOSPHOFRUCTOKINASE
6pfk.1.A	20.69	homo-tetramer	HHblits	X-ray	2.60Å	0.28	0.33	PHOSPHOFRUCTOKINASE
3u39.1.A	20.69	homo-tetramer	HHblits	X-ray	2.79Å	0.28	0.33	6-phosphofructokinase
1mto.1.A	20.69	homo-tetramer	HHblits	X-ray	3.20Å	0.28	0.33	6-phosphofructokinase
3f5m.1.A	13.79	homo-tetramer	HHblits	X-ray	2.70Å	0.26	0.33	6-phospho-1-fructokinase (ATP-dependent phosphofructokinase)
2hig.1.A	13.79	homo-tetramer	HHblits	X-ray	2.40Å	0.26	0.33	6-phospho-1-fructokinase
4mie.1.A	17.43	homo-tetramer	HHblits	X-ray	2.00Å	0.28	0.31	Inositol 2-dehydrogenase/D-chiro-inositol 3-dehydrogenase
4mie.1.D	17.43	homo-tetramer	HHblits	X-ray	2.00Å	0.28	0.31	Inositol 2-dehydrogenase/D-chiro-inositol 3-dehydrogenase
3cmv.1.A	10.00	monomer	HHblits	X-ray	4.30Å	0.26	0.31	Protein recA
2yxb.1.A	17.92	monomer	HHblits	X-ray	1.80Å	0.29	0.30	Coenzyme B12-dependent mutase
4r3u.1.B	16.04	hetero-oligomer	HHblits	X-ray	2.50Å	0.28	0.30	2-hydroxyisobutyryl-CoA mutase small subunit
5hgv.1.A	11.01	hetero-oligomer	HHblits	X-ray	2.05Å	0.25	0.31	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit
5lwv.1.A	11.01	monomer	HHblits	X-ray	1.90Å	0.25	0.31	Host cell factor 1,UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit
5a01.1.A	11.11	monomer	HHblits	X-ray	2.66Å	0.25	0.30	O-GLYCOSYLTRANSFERASE
1req.1.A	16.04	hetero-oligomer	HHblits	X-ray	2.00Å	0.27	0.30	METHYLMALONYL-COA MUTASE
2req.1.A	16.04	hetero-oligomer	HHblits	X-ray	2.50Å	0.27	0.30	METHYLMALONYL-COA MUTASE
5vyw.1.A	14.42	homo-tetramer	HHblits	X-ray	3.10Å	0.28	0.29	Pyruvate carboxylase
5vyw.1.C	14.42	homo-tetramer	HHblits	X-ray	3.10Å	0.28	0.29	Pyruvate carboxylase
1e1c.1.A	16.04	hetero-oligomer	HHblits	X-ray	2.62Å	0.27	0.30	METHYLMALONYL-COA MUTASE ALPHA CHAIN
5lvv.1.A	11.11	monomer	HHblits	X-ray	2.54Å	0.25	0.30	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit,UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit
4bfc.1.A	14.42	homo-trimer	HHblits	X-ray	1.70Å	0.28	0.29	3-DEOXY-D-MANNO-OCTULOSONIC-ACID TRANSFERASE
5ks8.1.A	16.67	hetero-oligomer	HHblits	X-ray	3.01Å	0.29	0.29	Pyruvate carboxylase subunit alpha
4ay5.1.A	10.28	hetero-oligomer	HHblits	X-ray	3.15Å	0.25	0.30	UDP-N-ACETYLGLUCOSAMINE--PEPTIDE N-ACETYLGLUCOSAMINYL TRANSFERASE 110 KDA SUBUNIT
4gyw.1.A	10.28	hetero-oligomer	HHblits	X-ray	1.70Å	0.25	0.30	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit
4n3c.1.A	10.28	hetero-oligomer	HHblits	X-ray	2.55Å	0.25	0.30	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit
5c1d.1.A	10.28	monomer	HHblits	X-ray	2.05Å	0.25	0.30	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit
4qsk.1.A	13.86	homo-tetramer	HHblits	X-ray	2.70Å	0.28	0.28	Pyruvate carboxylase
5vz0.1.A	13.86	homo-tetramer	HHblits	X-ray	2.00Å	0.28	0.28	Pyruvate carboxylase
5vz0.1.D	13.86	homo-tetramer	HHblits	X-ray	2.00Å	0.28	0.28	Pyruvate carboxylase
4qsh.1.A	13.86	homo-tetramer	HHblits	X-ray	2.51Å	0.28	0.28	Pyruvate carboxylase
5vyz.1.A	13.86	homo-tetramer	HHblits	X-ray	2.30Å	0.28	0.28	Pyruvate carboxylase
5vyz.1.B	13.86	homo-tetramer	HHblits	X-ray	2.30Å	0.28	0.28	Pyruvate carboxylase
4qsl.1.A	13.86	homo-tetramer	HHblits	X-ray	3.28Å	0.28	0.28	Pyruvate carboxylase
4qsl.1.B	13.86	homo-tetramer	HHblits	X-ray	3.28Å	0.28	0.28	Pyruvate carboxylase
4qsl.1.C	13.86	homo-tetramer	HHblits	X-ray	3.28Å	0.28	0.28	Pyruvate carboxylase
4qsl.1.D	13.86	homo-tetramer	HHblits	X-ray	3.28Å	0.28	0.28	Pyruvate carboxylase
3bic.1.A	10.48	monomer	HHblits	X-ray	2.60Å	0.25	0.29	Methylmalonyl-CoA mutase, mitochondrial precursor
2xij.1.A	10.48	homo-dimer	HHblits	X-ray	1.95Å	0.25	0.29	METHYLMALONYL-COA MUTASE, MITOCHONDRIAL
2xiq.2.A	10.48	monomer	HHblits	X-ray	1.95Å	0.25	0.29	METHYLMALONYL-COA MUTASE, MITOCHONDRIAL
3bg5.1.A	15.84	homo-tetramer	HHblits	X-ray	2.80Å	0.28	0.28	Pyruvate carboxylase
3bg5.1.B	15.84	homo-tetramer	HHblits	X-ray	2.80Å	0.28	0.28	Pyruvate carboxylase
3bg5.1.C	15.84	homo-tetramer	HHblits	X-ray	2.80Å	0.28	0.28	Pyruvate carboxylase
3bg5.1.D	15.84	homo-tetramer	HHblits	X-ray	2.80Å	0.28	0.28	Pyruvate carboxylase
3hb9.1.A	15.84	homo-tetramer	HHblits	X-ray	2.90Å	0.28	0.28	Pyruvate carboxylase
3hb9.1.B	15.84	homo-tetramer	HHblits	X-ray	2.90Å	0.28	0.28	Pyruvate carboxylase
3hb9.1.C	15.84	homo-tetramer	HHblits	X-ray	2.90Å	0.28	0.28	Pyruvate carboxylase
3hb9.1.D	15.84	homo-tetramer	HHblits	X-ray	2.90Å	0.28	0.28	Pyruvate carboxylase
4hnu.1.A	15.84	homo-tetramer	HHblits	X-ray	3.00Å	0.28	0.28	Pyruvate carboxylase
4hnu.1.B	15.84	homo-tetramer	HHblits	X-ray	3.00Å	0.28	0.28	Pyruvate carboxylase
4hnu.1.C	15.84	homo-tetramer	HHblits	X-ray	3.00Å	0.28	0.28	Pyruvate carboxylase
4hnu.1.D	15.84	homo-tetramer	HHblits	X-ray	3.00Å	0.28	0.28	Pyruvate carboxylase
3hbl.1.A	15.84	homo-tetramer	HHblits	X-ray	2.71Å	0.28	0.28	Pyruvate carboxylase
3hbl.1.B	15.84	homo-tetramer	HHblits	X-ray	2.71Å	0.28	0.28	Pyruvate carboxylase
3hbl.1.C	15.84	homo-tetramer	HHblits	X-ray	2.71Å	0.28	0.28	Pyruvate carboxylase
3hbl.1.D	15.84	homo-tetramer	HHblits	X-ray	2.71Å	0.28	0.28	Pyruvate carboxylase
4hnt.1.A	15.84	homo-tetramer	HHblits	X-ray	2.80Å	0.28	0.28	Pyruvate carboxylase
4hnt.1.B	15.84	homo-tetramer	HHblits	X-ray	2.80Å	0.28	0.28	Pyruvate carboxylase
4hnt.1.C	15.84	homo-tetramer	HHblits	X-ray	2.80Å	0.28	0.28	Pyruvate carboxylase
4hnt.1.D	15.84	homo-tetramer	HHblits	X-ray	2.80Å	0.28	0.28	Pyruvate carboxylase
3ho8.1.A	15.84	homo-tetramer	HHblits	X-ray	2.90Å	0.28	0.28	Pyruvate carboxylase
3ho8.1.B	15.84	homo-tetramer	HHblits	X-ray	2.90Å	0.28	0.28	Pyruvate carboxylase
3ho8.1.C	15.84	homo-tetramer	HHblits	X-ray	2.90Å	0.28	0.28	Pyruvate carboxylase
3ho8.1.D	15.84	homo-tetramer	HHblits	X-ray	2.90Å	0.28	0.28	Pyruvate carboxylase
4hnv.1.A	16.00	homo-tetramer	HHblits	X-ray	2.80Å	0.28	0.28	Pyruvate carboxylase
4hnv.1.B	16.00	homo-tetramer	HHblits	X-ray	2.80Å	0.28	0.28	Pyruvate carboxylase
4hnv.1.C	16.00	homo-tetramer	HHblits	X-ray	2.80Å	0.28	0.28	Pyruvate carboxylase
4hnv.1.D	16.00	homo-tetramer	HHblits	X-ray	2.80Å	0.28	0.28	Pyruvate carboxylase
2c00.1.A	10.78	monomer	HHblits	X-ray	2.50Å	0.26	0.29	BIOTIN CARBOXYLASE
2c00.2.A	10.78	monomer	HHblits	X-ray	2.50Å	0.26	0.29	BIOTIN CARBOXYLASE
2vqd.1.A	10.78	monomer	HHblits	X-ray	2.41Å	0.26	0.29	BIOTIN CARBOXYLASE
4x7g.1.A	20.00	monomer	HHblits	X-ray	1.22Å	0.31	0.27	Precorrin-6A reductase
5c4n.1.A	20.00	monomer	HHblits	X-ray	1.63Å	0.31	0.27	Precorrin-6A reductase
5c4r.1.A	18.95	monomer	HHblits	X-ray	3.17Å	0.30	0.27	Precorrin-6A reductase
4hut.1.A	13.68	homo-dimer	HHblits	X-ray	1.95Å	0.28	0.27	Cob(I)yrinic acid a,c-diamide adenosyltransferase
4hut.1.B	13.68	homo-dimer	HHblits	X-ray	1.95Å	0.28	0.27	Cob(I)yrinic acid a,c-diamide adenosyltransferase
1g64.1.A	12.63	homo-dimer	HHblits	X-ray	2.10Å	0.27	0.27	COB(I)ALAMIN ADENOSYLTRANSFERASE
1g5r.1.A	12.63	homo-dimer	HHblits	X-ray	2.10Å	0.27	0.27	COB(I)ALAMIN ADENOSYLTRANSFERASE
4wd3.1.A	11.22	homo-dimer	HHblits	X-ray	2.80Å	0.24	0.28	L-amino acid ligase
3aer.1.B	19.32	hetero-oligomer	HHblits	X-ray	2.80Å	0.31	0.25	Light-independent protochlorophyllide reductase subunit B
3aeq.1.B	19.32	hetero-oligomer	HHblits	X-ray	2.90Å	0.31	0.25	Light-independent protochlorophyllide reductase subunit B
3aek.1.B	19.32	hetero-oligomer	HHblits	X-ray	2.30Å	0.31	0.25	Light-independent protochlorophyllide reductase subunit B
5hut.1.A	15.56	homo-dimer	HHblits	X-ray	1.90Å	0.29	0.25	Alpha,alpha-trehalose-phosphate synthase [UDP-forming]
4ffm.1.A	12.09	monomer	HHblits	X-ray	1.91Å	0.28	0.26	PylC
5huv.1.A	14.44	homo-dimer	HHblits	X-ray	2.00Å	0.29	0.25	Alpha,alpha-trehalose-phosphate synthase [UDP-forming]
1ez1.1.A	13.48	homo-dimer	HHblits	X-ray	1.75Å	0.30	0.25	PHOSPHORIBOSYLGLYCINAMIDE FORMYLTRANSFERASE 2
1ez1.1.B	13.48	homo-dimer	HHblits	X-ray	1.75Å	0.30	0.25	PHOSPHORIBOSYLGLYCINAMIDE FORMYLTRANSFERASE 2
2dwc.1.A	15.56	homo-dimer	HHblits	X-ray	1.70Å	0.29	0.25	433aa long hypothetical phosphoribosylglycinamide formyl transferase
2czg.1.B	15.56	homo-dimer	HHblits	X-ray	2.35Å	0.29	0.25	phosphoribosylglycinamide formyl transferase
3eag.1.A	23.60	homo-dimer	HHblits	X-ray	2.55Å	0.29	0.25	UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-meso-diaminopimelate ligase
3eag.1.B	23.60	homo-dimer	HHblits	X-ray	2.55Å	0.29	0.25	UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-meso-diaminopimelate ligase
5lqd.1.A	8.51	homo-dimer	HHblits	X-ray	1.95Å	0.25	0.26	Alpha,alpha-trehalose-phosphate synthase
5lqd.1.B	8.51	homo-dimer	HHblits	X-ray	1.95Å	0.25	0.26	Alpha,alpha-trehalose-phosphate synthase
5dxf.1.A	14.44	monomer	HHblits	X-ray	2.56Å	0.28	0.25	trehalose-6-phosphate phosphatase
5dxf.2.A	14.44	monomer	HHblits	X-ray	2.56Å	0.28	0.25	trehalose-6-phosphate phosphatase
1kji.1.A	13.64	homo-dimer	HHblits	X-ray	1.60Å	0.29	0.25	phosphoribosylglycinamide formyltransferase 2
1kji.1.B	13.64	homo-dimer	HHblits	X-ray	1.60Å	0.29	0.25	phosphoribosylglycinamide formyltransferase 2
5hvm.1.A	18.18	homo-dimer	HHblits	X-ray	2.82Å	0.29	0.25	Alpha,alpha-trehalose-phosphate synthase (UDP-forming)
3o75.1.A	13.33	homo-dimer	HHblits	X-ray	2.30Å	0.26	0.25	Fructose transport system repressor FruR
3o74.1.B	13.33	homo-dimer	HHblits	X-ray	2.00Å	0.26	0.25	Fructose transport system repressor FruR
5jij.1.A	8.89	homo-tetramer	HHblits	X-ray	1.82Å	0.26	0.25	Alpha,alpha-trehalose-phosphate synthase
5jio.1.A	8.89	homo-tetramer	HHblits	X-ray	1.71Å	0.26	0.25	Alpha,alpha-trehalose-phosphate synthase
5l3k.2.D	8.89	homo-tetramer	HHblits	X-ray	2.31Å	0.26	0.25	Alpha,alpha-trehalose-phosphate synthase
1gz5.1.A	10.00	homo-tetramer	HHblits	X-ray	2.43Å	0.25	0.25	ALPHA-TREHALOSE-PHOSPHATE SYNTHASE
3ec7.1.A	16.09	homo-tetramer	HHblits	X-ray	2.15Å	0.28	0.24	Putative Dehydrogenase
2wtx.1.A	8.89	homo-dimer	HHblits	X-ray	2.20Å	0.25	0.25	ALPHA, ALPHA-TREHALOSE-PHOSPHATE SYNTHASE [UDP-FORMING]
2wtx.1.B	8.89	homo-dimer	HHblits	X-ray	2.20Å	0.25	0.25	ALPHA, ALPHA-TREHALOSE-PHOSPHATE SYNTHASE [UDP-FORMING]
5hxa.1.A	10.00	homo-dimer	HHblits	X-ray	2.00Å	0.25	0.25	Alpha,alpha-trehalose-phosphate synthase (UDP-forming)
5tvg.1.A	8.89	homo-tetramer	HHblits	X-ray	2.30Å	0.24	0.25	Alpha,alpha-trehalose-phosphate synthase (UDP-forming)
5tvg.2.A	8.89	homo-tetramer	HHblits	X-ray	2.30Å	0.24	0.25	Alpha,alpha-trehalose-phosphate synthase (UDP-forming)
5uof.1.A	7.78	homo-dimer	HHblits	X-ray	1.70Å	0.24	0.25	Alpha,alpha-trehalose-phosphate synthase (UDP-forming)
1ydw.1.A	11.24	homo-dimer	HHblits	X-ray	2.49Å	0.25	0.25	AX110P-like protein
2q4e.1.B	11.24	homo-dimer	HHblits	X-ray	2.49Å	0.25	0.25	Probable oxidoreductase At4g09670
2zr9.1.A	14.12	monomer	HHblits	X-ray	2.50Å	0.28	0.24	Protein recA
2zra.1.A	14.12	monomer	HHblits	X-ray	3.10Å	0.28	0.24	Protein recA
2zrb.1.A	14.12	monomer	HHblits	X-ray	3.25Å	0.28	0.24	Protein recA
3hr8.1.A	12.94	monomer	HHblits	X-ray	1.95Å	0.27	0.24	Protein recA
5jrj.1.A	12.94	homo-hexamer	HHblits	X-ray	1.70Å	0.27	0.24	Protein RecA
4zyt.1.A	16.67	monomer	HHblits	X-ray	1.70Å	0.28	0.24	Trifunctional purine biosynthetic protein adenosine-3
5j9f.1.A	16.67	monomer	HHblits	X-ray	2.10Å	0.27	0.24	Trifunctional purine biosynthetic protein adenosine-3
3p9x.1.A	14.29	homo-dimer	HHblits	X-ray	1.90Å	0.27	0.24	phosphoribosylglycinamide formyltransferase
2ywr.1.A	17.86	monomer	HHblits	X-ray	1.77Å	0.27	0.24	Phosphoribosylglycinamide formyltransferase
3av3.1.A	11.90	monomer	HHblits	X-ray	1.70Å	0.27	0.24	Phosphoribosylglycinamide formyltransferase
4ds3.1.A	16.87	homo-dimer	HHblits	X-ray	1.85Å	0.27	0.23	Phosphoribosylglycinamide formyltransferase
3tqr.1.A	14.46	monomer	HHblits	X-ray	1.97Å	0.27	0.23	Phosphoribosylglycinamide formyltransferase
3auf.1.A	10.71	homo-dimer	HHblits	X-ray	2.07Å	0.25	0.24	Glycinamide ribonucleotide transformylase 1
4s1n.1.A	15.19	monomer	HHblits	X-ray	2.70Å	0.28	0.22	Phosphoribosylglycinamide formyltransferase
1qzu.1.A	12.99	homo-trimer	HHblits	X-ray	2.91Å	0.27	0.22	hypothetical protein MDS018
3kcq.1.A	16.88	homo-dimer	HHblits	X-ray	2.20Å	0.27	0.22	Phosphoribosylglycinamide formyltransferase
3kcq.1.B	16.88	homo-dimer	HHblits	X-ray	2.20Å	0.27	0.22	Phosphoribosylglycinamide formyltransferase
3rsz.1.A	10.67	homo-tetramer	HHblits	X-ray	3.01Å	0.27	0.21	Glycogen [starch] synthase isoform 2
3rt1.1.A	9.33	homo-tetramer	HHblits	X-ray	2.80Å	0.27	0.21	PROTEIN (Glycogen [starch] synthase isoform 2)
3rt1.1.B	9.33	homo-tetramer	HHblits	X-ray	2.80Å	0.27	0.21	PROTEIN (Glycogen [starch] synthase isoform 2)
3rt1.1.C	9.33	homo-tetramer	HHblits	X-ray	2.80Å	0.27	0.21	PROTEIN (Glycogen [starch] synthase isoform 2)
5sul.1.B	9.33	homo-tetramer	HHblits	X-ray	3.30Å	0.27	0.21	Glycogen [starch] synthase isoform 2
5sul.1.C	9.33	homo-tetramer	HHblits	X-ray	3.30Å	0.27	0.21	Glycogen [starch] synthase isoform 2
2khz.1.A	17.81	homo-dimer	HHblits	NMR	NA	0.28	0.21	c-Myc-responsive protein Rcl
5suk.1.A	9.59	homo-tetramer	HHblits	X-ray	2.88Å	0.27	0.21	Glycogen [starch] synthase isoform 2
5suk.1.B	9.59	homo-tetramer	HHblits	X-ray	2.88Å	0.27	0.21	Glycogen [starch] synthase isoform 2
5suk.1.C	9.59	homo-tetramer	HHblits	X-ray	2.88Å	0.27	0.21	Glycogen [starch] synthase isoform 2
4kqm.1.B	9.59	homo-tetramer	HHblits	X-ray	2.77Å	0.27	0.21	Gsy2p
4kqm.1.A	9.59	homo-tetramer	HHblits	X-ray	2.77Å	0.27	0.21	Gsy2p
4kqm.1.C	9.59	homo-tetramer	HHblits	X-ray	2.77Å	0.27	0.21	Gsy2p
4kq1.1.B	9.59	homo-tetramer	HHblits	X-ray	2.66Å	0.27	0.21	Gsy2p
4kq1.1.A	9.59	homo-tetramer	HHblits	X-ray	2.66Å	0.27	0.21	Gsy2p
4kq1.1.C	9.59	homo-tetramer	HHblits	X-ray	2.66Å	0.27	0.21	Gsy2p
4p5e.1.A	15.07	homo-dimer	HHblits	X-ray	1.35Å	0.26	0.21	2'-deoxynucleoside 5'-phosphate N-hydrolase 1
5u09.1.A	16.44	monomer	HHblits	X-ray	2.60Å	0.26	0.21	Cannabinoid receptor 1,GlgA glycogen synthase
3lqk.1.A	10.67	homo-hexamer	HHblits	X-ray	2.10Å	0.24	0.21	Dipicolinate synthase subunit B
2ejb.1.A	12.33	homo-dimer	HHblits	X-ray	2.15Å	0.25	0.21	Probable aromatic acid decarboxylase
5wq3.1.B	8.45	homo-hexamer	HHblits	X-ray	1.95Å	0.27	0.20	Cytokinin riboside 5'-monophosphate phosphoribohydrolase
5wq3.1.A	8.45	homo-hexamer	HHblits	X-ray	1.95Å	0.27	0.20	Cytokinin riboside 5'-monophosphate phosphoribohydrolase
3t5t.1.A	8.22	homo-dimer	HHblits	X-ray	1.70Å	0.25	0.21	Putative glycosyltransferase
3t5t.1.B	8.22	homo-dimer	HHblits	X-ray	1.70Å	0.25	0.21	Putative glycosyltransferase
3t7d.1.A	8.22	homo-dimer	HHblits	X-ray	1.70Å	0.25	0.21	Putative glycosyltransferase
4f96.1.A	8.22	homo-dimer	HHblits	X-ray	2.15Å	0.25	0.21	VldE
4f9f.1.A	8.22	homo-dimer	HHblits	X-ray	2.81Å	0.25	0.21	VldE
4f9f.1.B	8.22	homo-dimer	HHblits	X-ray	2.81Å	0.25	0.21	VldE
4f9f.2.A	8.22	homo-dimer	HHblits	X-ray	2.81Å	0.25	0.21	VldE
2klh.1.A	18.84	homo-dimer	HHblits	NMR	NA	0.28	0.19	c-Myc-responsive protein Rcl
4qlb.1.A	13.24	hetero-oligomer	HHblits	X-ray	2.60Å	0.27	0.19	Probable glycogen [starch] synthase
4qlb.1.B	13.24	hetero-oligomer	HHblits	X-ray	2.60Å	0.27	0.19	Probable glycogen [starch] synthase
1rc0.1.A	14.71	monomer	HHblits	X-ray	2.05Å	0.27	0.19	PHOSPHORIBOSYLGLYCINAMIDE FORMYLTRANSFERASE
1meo.1.A	14.71	monomer	HHblits	X-ray	1.72Å	0.27	0.19	Phosphoribosylglycinamide formyltransferase
1zly.1.A	14.71	monomer	HHblits	X-ray	2.07Å	0.27	0.19	Phosphoribosylglycinamide formyltransferase
1uqu.1.A	10.29	monomer	HHblits	X-ray	2.00Å	0.26	0.19	ALPHA, ALPHA-TREHALOSE-PHOSPHATE SYNTHASE
1uqu.2.A	10.29	monomer	HHblits	X-ray	2.00Å	0.26	0.19	ALPHA, ALPHA-TREHALOSE-PHOSPHATE SYNTHASE
5v0t.1.A	8.82	monomer	HHblits	X-ray	1.95Å	0.25	0.19	Alpha,alpha-trehalose-phosphate synthase (UDP-forming)
1eiw.1.A	16.67	monomer	HHblits	NMR	NA	0.26	0.19	HYPOTHETICAL PROTEIN MTH538
3pfn.1.A	15.52	homo-tetramer	HHblits	X-ray	2.70Å	0.29	0.16	NAD kinase
3mcu.1.A	11.86	homo-hexamer	HHblits	X-ray	2.30Å	0.24	0.17	Dipicolinate synthase, B chain
3mcu.1.E	11.86	homo-hexamer	HHblits	X-ray	2.30Å	0.24	0.17	Dipicolinate synthase, B chain
4hao.1.A	18.52	homo-dimer	HHblits	X-ray	2.55Å	0.29	0.15	Probable inorganic polyphosphate/ATP-NAD kinase
5c8d.1.A	14.55	homo-tetramer	HHblits	X-ray	2.80Å	0.27	0.15	Light-dependent transcriptional regulator CarH
5c8d.1.B	14.55	homo-tetramer	HHblits	X-ray	2.80Å	0.27	0.15	Light-dependent transcriptional regulator CarH
5c8d.1.D	14.55	homo-tetramer	HHblits	X-ray	2.80Å	0.27	0.15	Light-dependent transcriptional regulator CarH
5c8d.2.B	14.55	homo-tetramer	HHblits	X-ray	2.80Å	0.27	0.15	Light-dependent transcriptional regulator CarH
5c8d.2.D	14.55	homo-tetramer	HHblits	X-ray	2.80Å	0.27	0.15	Light-dependent transcriptional regulator CarH
5c8e.1.A	14.55	homo-tetramer	HHblits	X-ray	3.89Å	0.27	0.15	Light-dependent transcriptional regulator CarH
5c8e.1.B	14.55	homo-tetramer	HHblits	X-ray	3.89Å	0.27	0.15	Light-dependent transcriptional regulator CarH
5c8e.1.C	14.55	homo-tetramer	HHblits	X-ray	3.89Å	0.27	0.15	Light-dependent transcriptional regulator CarH
5c8f.1.A	14.55	monomer	HHblits	X-ray	2.65Å	0.27	0.15	Light-dependent transcriptional regulator CarH
1sbz.1.A	18.87	homo-12-mer	HHblits	X-ray	2.00Å	0.28	0.15	Probable aromatic acid decarboxylase
3jzd.1.A	17.02	homo-dimer	HHblits	X-ray	2.10Å	0.28	0.13	Iron-containing alcohol dehydrogenase
3w5s.1.A	14.89	homo-dimer	HHblits	X-ray	1.49Å	0.27	0.13	Maleylacetate reductase
3w5s.1.B	14.89	homo-dimer	HHblits	X-ray	1.49Å	0.27	0.13	Maleylacetate reductase
3q7s.1.A	14.89	homo-dimer	HHblits	X-ray	2.10Å	0.26	0.13	Transcriptional regulatory protein
3q7s.1.B	14.89	homo-dimer	HHblits	X-ray	2.10Å	0.26	0.13	Transcriptional regulatory protein
3q7t.1.A	14.89	homo-dimer	HHblits	X-ray	2.15Å	0.26	0.13	Transcriptional regulatory protein
3q7t.1.B	14.89	homo-dimer	HHblits	X-ray	2.15Å	0.26	0.13	Transcriptional regulatory protein
3uhj.1.A	22.22	homo-tetramer	HHblits	X-ray	2.34Å	0.28	0.13	Probable glycerol dehydrogenase
1jqa.1.A	15.56	homo-octamer	HHblits	X-ray	2.05Å	0.28	0.13	Glycerol Dehydrogenase
1jq5.1.A	15.56	homo-octamer	HHblits	X-ray	1.70Å	0.28	0.13	Glycerol dehydrogenase
3ce9.1.A	17.78	homo-tetramer	HHblits	X-ray	2.37Å	0.28	0.13	Glycerol dehydrogenase
3hl0.1.A	13.04	homo-dimer	HHblits	X-ray	1.60Å	0.26	0.13	Maleylacetate reductase
3hl0.1.B	13.04	homo-dimer	HHblits	X-ray	1.60Å	0.26	0.13	Maleylacetate reductase
1qzu.1.A	13.33	homo-trimer	HHblits	X-ray	2.91Å	0.27	0.13	hypothetical protein MDS018
4mca.1.A	17.78	homo-16-mer	HHblits	X-ray	1.90Å	0.27	0.13	Glycerol dehydrogenase
2ahd.1.A	20.93	monomer	HHblits	X-ray	3.00Å	0.30	0.12	Phosphodiesterase MJ0936
5xn8.1.A	15.56	homo-octamer	HHblits	X-ray	2.33Å	0.27	0.13	Glycerol Dehydrogenase
1u80.1.A	8.89	homo-dimer	HHblits	X-ray	2.85Å	0.25	0.13	Coenzyme A biosynthesis bifunctional protein coaBC
1u7u.1.A	8.89	homo-dimer	HHblits	X-ray	2.40Å	0.25	0.13	Coenzyme A biosynthesis bifunctional protein coaBC
5its.1.A	22.50	homo-dimer	HHblits	X-ray	2.30Å	0.34	0.11	Cytokinin riboside 5'-monophosphate phosphoribohydrolase
5its.2.B	22.50	homo-dimer	HHblits	X-ray	2.30Å	0.34	0.11	Cytokinin riboside 5'-monophosphate phosphoribohydrolase
3o8o.1.A	23.81	hetero-oligomer	HHblits	X-ray	2.90Å	0.30	0.12	6-phosphofructokinase subunit alpha
3zok.1.A	8.89	homo-dimer	HHblits	X-ray	2.40Å	0.24	0.13	3-DEHYDROQUINATE SYNTHASE
5c4r.1.A	25.00	monomer	HHblits	X-ray	3.17Å	0.33	0.11	Precorrin-6A reductase
4x7g.1.A	25.00	monomer	HHblits	X-ray	1.22Å	0.33	0.11	Precorrin-6A reductase
5c4n.1.A	25.00	monomer	HHblits	X-ray	1.63Å	0.33	0.11	Precorrin-6A reductase
2zrd.1.A	21.95	monomer	HHblits	X-ray	3.10Å	0.31	0.12	Protein recA
2zrg.1.A	21.95	monomer	HHblits	X-ray	3.50Å	0.31	0.12	Protein recA
1u6k.1.A	11.90	homo-hexamer	HHblits	X-ray	1.55Å	0.29	0.12	F420-dependent methylenetetrahydromethanopterin dehydrogenase
1t35.1.A	24.39	homo-octamer	HHblits	X-ray	2.72Å	0.30	0.12	HYPOTHETICAL PROTEIN YVDD, Putative Lysine Decarboxylase
1t35.1.B	24.39	homo-octamer	HHblits	X-ray	2.72Å	0.30	0.12	HYPOTHETICAL PROTEIN YVDD, Putative Lysine Decarboxylase
1t35.1.C	24.39	homo-octamer	HHblits	X-ray	2.72Å	0.30	0.12	HYPOTHETICAL PROTEIN YVDD, Putative Lysine Decarboxylase
1t35.1.D	24.39	homo-octamer	HHblits	X-ray	2.72Å	0.30	0.12	HYPOTHETICAL PROTEIN YVDD, Putative Lysine Decarboxylase
1t35.1.G	24.39	homo-octamer	HHblits	X-ray	2.72Å	0.30	0.12	HYPOTHETICAL PROTEIN YVDD, Putative Lysine Decarboxylase
3bq9.1.A	17.07	homo-tetramer	HHblits	X-ray	1.80Å	0.30	0.12	Predicted Rossmann fold nucleotide-binding domain-containing protein
2reb.1.A	17.50	monomer	HHblits	X-ray	2.30Å	0.32	0.11	REC A
4twz.1.A	17.50	monomer	HHblits	X-ray	2.80Å	0.32	0.11	Protein RecA
1xms.1.A	17.50	homo-hexamer	HHblits	X-ray	2.10Å	0.32	0.11	RecA protein
1u94.1.A	17.50	homo-hexamer	HHblits	X-ray	1.90Å	0.32	0.11	RecA protein
1u99.1.A	17.50	homo-hexamer	HHblits	X-ray	2.60Å	0.32	0.11	RecA protein
4oqf.1.A	22.50	monomer	HHblits	X-ray	2.80Å	0.32	0.11	Protein RecA
1g18.1.A	22.50	monomer	HHblits	X-ray	3.80Å	0.32	0.11	RECA PROTEIN
4po1.1.A	22.50	monomer	HHblits	X-ray	3.40Å	0.32	0.11	Protein RecA
1xp8.1.A	14.63	homo-hexamer	HHblits	X-ray	2.50Å	0.30	0.12	RecA protein
2zri.1.A	22.50	monomer	HHblits	X-ray	3.30Å	0.31	0.11	Protein recA
2zrl.1.A	22.50	monomer	HHblits	X-ray	3.70Å	0.31	0.11	Protein recA
2zr7.1.A	22.50	monomer	HHblits	X-ray	3.60Å	0.31	0.11	Protein recA
2zrn.1.A	22.50	monomer	HHblits	X-ray	3.30Å	0.31	0.11	Protein recA
1ubc.1.A	22.50	monomer	HHblits	X-ray	3.80Å	0.31	0.11	RecA
1ubg.1.A	22.50	monomer	HHblits	X-ray	3.50Å	0.31	0.11	RecA
2oe2.1.A	22.50	monomer	HHblits	X-ray	3.45Å	0.31	0.11	Protein recA
2oep.1.A	22.50	monomer	HHblits	X-ray	3.10Å	0.31	0.11	Protein recA
2odn.1.A	22.50	monomer	HHblits	X-ray	3.10Å	0.31	0.11	Protein recA
2ofo.1.A	22.50	monomer	HHblits	X-ray	3.16Å	0.31	0.11	Protein recA
2g88.1.A	22.50	monomer	HHblits	X-ray	3.20Å	0.31	0.11	Protein recA
3hcw.1.A	11.90	homo-dimer	HHblits	X-ray	2.20Å	0.27	0.12	Maltose operon transcriptional repressor
3hcw.1.B	11.90	homo-dimer	HHblits	X-ray	2.20Å	0.27	0.12	Maltose operon transcriptional repressor
1zxx.1.A	21.43	homo-tetramer	HHblits	X-ray	1.85Å	0.27	0.12	6-phosphofructokinase
1i9c.1.A	21.95	hetero-oligomer	HHblits	X-ray	1.90Å	0.28	0.12	GLUTAMATE MUTASE
1cb7.1.A	21.95	hetero-oligomer	HHblits	X-ray	2.00Å	0.28	0.12	PROTEIN (GLUTAMATE MUTASE)
2pfk.1.A	24.39	homo-tetramer	HHblits	X-ray	2.40Å	0.28	0.12	6-PHOSPHOFRUCTOKINASE ISOZYME I
1pfk.1.A	24.39	homo-tetramer	HHblits	X-ray	2.40Å	0.28	0.12	PHOSPHOFRUCTOKINASE
1ydh.1.A	17.07	homo-dimer	HHblits	X-ray	2.15Å	0.28	0.12	At5g11950
2q4d.1.B	17.07	homo-dimer	HHblits	X-ray	2.15Å	0.28	0.12	Lysine decarboxylase-like protein At5g11950
3huu.1.A	12.20	homo-dimer	HHblits	X-ray	1.95Å	0.28	0.12	Transcription regulator like protein
3cmu.1.B	17.95	monomer	HHblits	X-ray	4.20Å	0.31	0.11	Protein recA
1u6k.1.A	20.00	homo-hexamer	HHblits	X-ray	1.55Å	0.29	0.11	F420-dependent methylenetetrahydromethanopterin dehydrogenase
4v02.1.A	26.32	hetero-oligomer	HHblits	X-ray	2.70Å	0.33	0.11	SITE-DETERMINING PROTEIN
4v03.1.A	26.32	homo-dimer	HHblits	X-ray	1.90Å	0.33	0.11	SITE-DETERMINING PROTEIN
2ejb.1.A	23.08	homo-dimer	HHblits	X-ray	2.15Å	0.31	0.11	Probable aromatic acid decarboxylase
3k4h.1.A	7.14	homo-dimer	HHblits	X-ray	2.80Å	0.25	0.12	putative transcriptional regulator
3k4h.1.B	7.14	homo-dimer	HHblits	X-ray	2.80Å	0.25	0.12	putative transcriptional regulator
2fep.1.A	17.50	hetero-oligomer	HHblits	X-ray	2.45Å	0.29	0.11	Catabolite control protein A
4rz3.1.A	28.95	homo-dimer	HHblits	X-ray	1.90Å	0.33	0.11	Site-determining protein
4rz3.1.B	28.95	homo-dimer	HHblits	X-ray	1.90Å	0.33	0.11	Site-determining protein
3r9i.1.B	23.68	hetero-oligomer	HHblits	X-ray	2.60Å	0.33	0.11	Septum site-determining protein minD
3q9l.1.A	23.68	homo-dimer	HHblits	X-ray	2.34Å	0.33	0.11	Septum site-determining protein minD
3gv0.1.A	20.00	monomer	HHblits	X-ray	2.35Å	0.28	0.11	Transcriptional regulator, LacI family
3h5t.1.A	12.50	monomer	HHblits	X-ray	2.53Å	0.28	0.11	Transcriptional regulator, LacI family
1be1.1.A	20.00	monomer	HHblits	NMR	NA	0.28	0.11	GLUTAMATE MUTASE
1id8.1.A	20.00	monomer	HHblits	NMR	NA	0.28	0.11	METHYLASPARTATE MUTASE S CHAIN
1fmf.1.A	20.00	monomer	HHblits	NMR	NA	0.28	0.11	METHYLASPARTATE MUTASE S CHAIN
1e4e.1.A	29.73	hetero-oligomer	HHblits	X-ray	2.50Å	0.34	0.10	VANCOMYCIN/TEICOPLANIN A-TYPE RESISTANCE PROTEIN VANA
1xd9.1.A	21.62	homo-dimer	HHblits	X-ray	2.80Å	0.34	0.10	Nitrogenase iron protein 1
1xdb.1.A	21.62	homo-dimer	HHblits	X-ray	2.80Å	0.34	0.10	Nitrogenase iron protein 1
1m34.1.E	21.62	hetero-oligomer	HHblits	X-ray	2.30Å	0.34	0.10	Nitrogenase Iron Protein 1
1m1y.1.E	21.62	hetero-oligomer	HHblits	X-ray	3.20Å	0.34	0.10	nitrogenase IRON protein 1
1m1y.1.F	21.62	hetero-oligomer	HHblits	X-ray	3.20Å	0.34	0.10	nitrogenase IRON protein 1
2afi.1.E	21.62	hetero-oligomer	HHblits	X-ray	3.10Å	0.34	0.10	Nitrogenase iron protein 1
2afh.1.E	21.62	hetero-oligomer	HHblits	X-ray	2.10Å	0.34	0.10	Nitrogenase iron protein 1
2afh.1.F	21.62	hetero-oligomer	HHblits	X-ray	2.10Å	0.34	0.10	Nitrogenase iron protein 1
1g5p.1.A	21.62	homo-dimer	HHblits	X-ray	2.20Å	0.34	0.10	NITROGENASE IRON PROTEIN
1g5p.1.B	21.62	homo-dimer	HHblits	X-ray	2.20Å	0.34	0.10	NITROGENASE IRON PROTEIN
1g1m.1.A	21.62	homo-dimer	HHblits	X-ray	2.25Å	0.34	0.10	NITROGENASE IRON PROTEIN
1g1m.1.B	21.62	homo-dimer	HHblits	X-ray	2.25Å	0.34	0.10	NITROGENASE IRON PROTEIN
1fp6.1.A	21.62	homo-dimer	HHblits	X-ray	2.15Å	0.34	0.10	NITROGENASE IRON PROTEIN
1nip.1.A	21.62	homo-dimer	HHblits	X-ray	2.90Å	0.34	0.10	NITROGENASE IRON PROTEIN
1nip.1.B	21.62	homo-dimer	HHblits	X-ray	2.90Å	0.34	0.10	NITROGENASE IRON PROTEIN
1de0.1.A	21.62	homo-dimer	HHblits	X-ray	2.40Å	0.34	0.10	NITROGENASE IRON PROTEIN
1xcp.1.A	21.62	homo-dimer	HHblits	X-ray	3.20Å	0.34	0.10	Nitrogenase iron protein 1
1xcp.2.A	21.62	homo-dimer	HHblits	X-ray	3.20Å	0.34	0.10	Nitrogenase iron protein 1
4wzb.1.F	21.62	hetero-oligomer	HHblits	X-ray	2.30Å	0.34	0.10	Nitrogenase iron protein 1
4wzb.1.E	21.62	hetero-oligomer	HHblits	X-ray	2.30Å	0.34	0.10	Nitrogenase iron protein 1
2c8v.1.A	21.62	monomer	HHblits	X-ray	2.50Å	0.34	0.10	NITROGENASE IRON PROTEIN 1
1rw4.1.A	21.62	homo-dimer	HHblits	X-ray	2.50Å	0.34	0.10	Nitrogenase iron protein 1
1g20.1.E	21.62	hetero-oligomer	HHblits	X-ray	2.20Å	0.34	0.10	NITROGENASE IRON PROTEIN
1g21.1.H	21.62	hetero-oligomer	HHblits	X-ray	3.00Å	0.34	0.10	NITROGENASE IRON PROTEIN
1g21.1.E	21.62	hetero-oligomer	HHblits	X-ray	3.00Å	0.34	0.10	NITROGENASE IRON PROTEIN
4wza.1.E	21.62	hetero-oligomer	HHblits	X-ray	1.90Å	0.34	0.10	Nitrogenase iron protein 1
4wza.1.F	21.62	hetero-oligomer	HHblits	X-ray	1.90Å	0.34	0.10	Nitrogenase iron protein 1
1b1a.1.A	20.00	monomer	HHblits	NMR	NA	0.27	0.11	GLUTAMATE MUTASE
3pg5.1.A	27.03	monomer	HHblits	X-ray	3.30Å	0.33	0.10	Uncharacterized protein
3pg5.2.A	27.03	monomer	HHblits	X-ray	3.30Å	0.33	0.10	Uncharacterized protein
3pg5.3.A	27.03	monomer	HHblits	X-ray	3.30Å	0.33	0.10	Uncharacterized protein
3pg5.4.A	27.03	monomer	HHblits	X-ray	3.30Å	0.33	0.10	Uncharacterized protein
1ion.1.A	27.03	monomer	HHblits	X-ray	2.30Å	0.33	0.10	PROBABLE CELL DIVISION INHIBITOR MIND
4rz2.1.A	29.73	monomer	HHblits	X-ray	2.80Å	0.33	0.10	Site-determining protein
5j1j.1.A	27.03	homo-dimer	HHblits	X-ray	1.55Å	0.33	0.10	Site-determining protein
5j1j.1.B	27.03	homo-dimer	HHblits	X-ray	1.55Å	0.33	0.10	Site-determining protein
5jvf.1.A	27.03	monomer	HHblits	X-ray	1.66Å	0.33	0.10	Site-determining protein
3f6r.1.A	21.05	monomer	HHblits	X-ray	2.00Å	0.31	0.11	Flavodoxin
3f6s.1.A	21.05	monomer	HHblits	X-ray	2.50Å	0.31	0.11	Flavodoxin
5u1g.1.A	18.42	hetero-oligomer	HHblits	X-ray	3.64Å	0.31	0.11	ParA
5u1g.2.B	18.42	hetero-oligomer	HHblits	X-ray	3.64Å	0.31	0.11	ParA
4i4i.1.A	19.51	homo-tetramer	HHblits	X-ray	2.49Å	0.25	0.12	6-phosphofructokinase
5myj.1.B	24.32	hetero-oligomer	HHblits	EM	5.60Å	0.33	0.10	30S ribosomal protein S2
3igf.1.A	27.03	homo-dimer	HHblits	X-ray	2.00Å	0.33	0.10	All4481 protein
3igf.1.B	27.03	homo-dimer	HHblits	X-ray	2.00Å	0.33	0.10	All4481 protein
3j9w.1.B	29.73	hetero-oligomer	HHblits	EM	NA	0.33	0.10	30S ribosomal protein uS2
5njt.1.B	29.73	hetero-oligomer	HHblits	EM	NA	0.33	0.10	30S ribosomal protein S2
4v9l.2.A	27.03	hetero-oligomer	HHblits	X-ray	3.50Å	0.33	0.10	30S ribosomal protein S2
4v68.1.B	27.03	hetero-oligomer	HHblits	EM	NA	0.33	0.10	30S ribosomal protein S2
4w29.2.A	27.03	hetero-oligomer	HHblits	X-ray	3.80Å	0.33	0.10	30S ribosomal protein S2
4w29.1.A	27.03	hetero-oligomer	HHblits	X-ray	3.80Å	0.33	0.10	30S ribosomal protein S2
4k0k.1.B	27.03	hetero-oligomer	HHblits	X-ray	3.40Å	0.33	0.10	30S ribosomal protein S2
4v9j.2.A	27.03	hetero-oligomer	HHblits	X-ray	3.86Å	0.33	0.10	30S ribosomal protein S2
4v9k.2.A	27.03	hetero-oligomer	HHblits	X-ray	3.50Å	0.33	0.10	30S ribosomal protein S2
1fjg.1.B	27.03	hetero-oligomer	HHblits	X-ray	3.00Å	0.33	0.10	30S RIBOSOMAL PROTEIN S2
2om7.1.N	27.03	hetero-oligomer	HHblits	EM	NA	0.33	0.10	30S ribosomal protein S2
3t1h.1.B	27.03	hetero-oligomer	HHblits	X-ray	3.11Å	0.33	0.10	30S ribosomal protein S2
3oto.1.B	27.03	hetero-oligomer	HHblits	X-ray	3.69Å	0.33	0.10	30S RIBOSOMAL PROTEIN S2
4dr2.1.B	27.03	hetero-oligomer	HHblits	X-ray	3.25Å	0.33	0.10	30S ribosomal protein S2
4kvb.1.B	27.03	hetero-oligomer	HHblits	X-ray	4.20Å	0.33	0.10	30S ribosomal protein S2
4lfa.1.B	27.03	hetero-oligomer	HHblits	X-ray	3.65Å	0.33	0.10	ribosomal protein S2
4lf7.1.B	27.03	hetero-oligomer	HHblits	X-ray	3.15Å	0.33	0.10	ribosomal protein S2
4lfz.2.B	27.03	hetero-oligomer	HHblits	X-ray	3.92Å	0.33	0.10	30S ribosomal protein S2
4v8n.2.B	27.03	hetero-oligomer	HHblits	X-ray	3.10Å	0.33	0.10	30S RIBOSOMAL PROTEIN S2
4v5q.1.B	27.03	hetero-oligomer	HHblits	X-ray	3.10Å	0.33	0.10	30S RIBOSOMAL PROTEIN S2
4v9s.1.B	27.03	hetero-oligomer	HHblits	X-ray	3.10Å	0.33	0.10	30S Ribosomal Protein S2
4v5c.2.B	27.03	hetero-oligomer	HHblits	X-ray	3.30Å	0.33	0.10	30S RIBOSOMAL PROTEIN S2
4v8c.2.5	27.03	hetero-oligomer	HHblits	X-ray	3.30Å	0.33	0.10	30S RIBOSOMAL PROTEIN S2
4v8h.2.B	27.03	hetero-oligomer	HHblits	X-ray	3.10Å	0.33	0.10	30S Ribosomal Protein S2
4v4i.1.8	27.03	hetero-oligomer	HHblits	X-ray	3.71Å	0.33	0.10	30S ribosomal protein S2
4v67.1.E	27.03	hetero-oligomer	HHblits	X-ray	3.00Å	0.33	0.10	30S ribosomal protein S2
4v4p.1.c	27.03	hetero-oligomer	HHblits	X-ray	5.50Å	0.33	0.10	30S ribosomal protein S2
4v4x.1.D	27.03	hetero-oligomer	HHblits	X-ray	5.00Å	0.33	0.10	30S ribosomal protein S2
4v9a.1.B	27.03	hetero-oligomer	HHblits	X-ray	3.30Å	0.33	0.10	30S RIBOSOMAL PROTEIN S2
4v90.1.B	27.03	hetero-oligomer	HHblits	X-ray	2.95Å	0.33	0.10	30S RIBOSOMAL PROTEIN S2
4v9s.2.B	27.03	hetero-oligomer	HHblits	X-ray	3.10Å	0.33	0.10	30S Ribosomal Protein S2
4v8f.1.5	27.03	hetero-oligomer	HHblits	X-ray	3.30Å	0.33	0.10	30S RIBOSOMAL PROTEIN S2
4v9b.1.B	27.03	hetero-oligomer	HHblits	X-ray	3.10Å	0.33	0.10	30S RIBOSOMAL PROTEIN S2
4v5k.2.B	27.03	hetero-oligomer	HHblits	X-ray	3.20Å	0.33	0.10	30S RIBOSOMAL PROTEIN S2
4v5l.1.B	27.03	hetero-oligomer	HHblits	X-ray	3.10Å	0.33	0.10	30S RIBOSOMAL PROTEIN S2
4v95.2.B	27.03	hetero-oligomer	HHblits	X-ray	3.20Å	0.33	0.10	30S Ribosomal Protein S2
4v63.1.E	27.03	hetero-oligomer	HHblits	X-ray	3.21Å	0.33	0.10	30S ribosomal protein S2
4v9a.2.B	27.03	hetero-oligomer	HHblits	X-ray	3.30Å	0.33	0.10	30S RIBOSOMAL PROTEIN S2
4v9b.2.B	27.03	hetero-oligomer	HHblits	X-ray	3.10Å	0.33	0.10	30S RIBOSOMAL PROTEIN S2
4v8u.1.B	27.03	hetero-oligomer	HHblits	X-ray	3.70Å	0.33	0.10	30S RIBOSOMAL PROTEIN S2
4v95.1.B	27.03	hetero-oligomer	HHblits	X-ray	3.20Å	0.33	0.10	30S Ribosomal Protein S2
4v4j.1.8	27.03	hetero-oligomer	HHblits	X-ray	3.83Å	0.33	0.10	30S ribosomal protein S2
4v6g.1.B	27.03	hetero-oligomer	HHblits	X-ray	3.50Å	0.33	0.10	30S RIBOSOMAL PROTEIN S2
4v5e.2.B	27.03	hetero-oligomer	HHblits	X-ray	3.45Å	0.33	0.10	30S RIBOSOMAL PROTEIN S2
4v8f.2.B	27.03	hetero-oligomer	HHblits	X-ray	3.30Å	0.33	0.10	30S RIBOSOMAL PROTEIN S2
5j8b.1.8	27.03	hetero-oligomer	HHblits	X-ray	2.60Å	0.33	0.10	30S ribosomal protein S2
4y4p.2.6	27.03	hetero-oligomer	HHblits	X-ray	2.50Å	0.33	0.10	30S ribosomal protein S2
4wzd.2.B	27.03	hetero-oligomer	HHblits	X-ray	3.10Å	0.33	0.10	30S ribosomal protein S2
4wzo.2.B	27.03	hetero-oligomer	HHblits	X-ray	3.30Å	0.33	0.10	30S ribosomal protein S2
4wzo.1.B	27.03	hetero-oligomer	HHblits	X-ray	3.30Å	0.33	0.10	30S ribosomal protein S2
4wr6.1.B	27.03	hetero-oligomer	HHblits	X-ray	3.05Å	0.33	0.10	30S ribosomal protein S2
4wr6.2.B	27.03	hetero-oligomer	HHblits	X-ray	3.05Å	0.33	0.10	30S ribosomal protein S2
4wsm.2.B	27.03	hetero-oligomer	HHblits	X-ray	3.30Å	0.33	0.10	30S ribosomal protein S2
4wqr.2.B	27.03	hetero-oligomer	HHblits	X-ray	3.15Å	0.33	0.10	30S ribosomal protein S2
5el5.2.B	27.03	hetero-oligomer	HHblits	X-ray	3.15Å	0.33	0.10	30S ribosomal protein S2
5el4.1.B	27.03	hetero-oligomer	HHblits	X-ray	3.15Å	0.33	0.10	30S ribosomal protein S2
5el6.1.B	27.03	hetero-oligomer	HHblits	X-ray	3.10Å	0.33	0.10	30S ribosomal protein S2
5el6.2.B	27.03	hetero-oligomer	HHblits	X-ray	3.10Å	0.33	0.10	30S ribosomal protein S2
5el4.2.B	27.03	hetero-oligomer	HHblits	X-ray	3.15Å	0.33	0.10	30S ribosomal protein S2
5e81.2.B	27.03	hetero-oligomer	HHblits	X-ray	2.95Å	0.33	0.10	30S ribosomal protein S2
5el7.2.B	27.03	hetero-oligomer	HHblits	X-ray	3.15Å	0.33	0.10	30S ribosomal protein S2
5e7k.2.B	27.03	hetero-oligomer	HHblits	X-ray	3.20Å	0.33	0.10	30S ribosomal protein S2
4wu1.1.B	27.03	hetero-oligomer	HHblits	X-ray	3.20Å	0.33	0.10	30S ribosomal protein S2
5el5.1.B	27.03	hetero-oligomer	HHblits	X-ray	3.15Å	0.33	0.10	30S ribosomal protein S2
4wqu.2.8	27.03	hetero-oligomer	HHblits	X-ray	2.80Å	0.33	0.10	30S ribosomal protein S2
5imq.1.I	27.03	hetero-oligomer	HHblits	EM	NA	0.33	0.10	30S ribosomal protein S2
5imr.1.B	27.03	hetero-oligomer	HHblits	EM	NA	0.33	0.10	30S ribosomal protein S2
5ibb.1.B	27.03	hetero-oligomer	HHblits	X-ray	2.96Å	0.33	0.10	30S ribosomal protein S2
5ibb.2.B	27.03	hetero-oligomer	HHblits	X-ray	2.96Å	0.33	0.10	30S ribosomal protein S2
4v5a.2.B	27.03	hetero-oligomer	HHblits	X-ray	3.50Å	0.33	0.10	30S RIBOSOMAL PROTEIN S2
2uua.1.B	27.03	hetero-oligomer	HHblits	X-ray	2.90Å	0.33	0.10	30S RIBOSOMAL PROTEIN S2
2vqe.1.B	27.03	hetero-oligomer	HHblits	X-ray	2.50Å	0.33	0.10	30S RIBOSOMAL PROTEIN S2
5lmr.1.B	27.03	hetero-oligomer	HHblits	EM	NA	0.33	0.10	30S ribosomal protein S2
5lmp.1.B	27.03	hetero-oligomer	HHblits	EM	NA	0.33	0.10	30S ribosomal protein S2
5lmn.1.B	27.03	hetero-oligomer	HHblits	EM	NA	0.33	0.10	30S ribosomal protein S2
5lmu.1.B	27.03	hetero-oligomer	HHblits	EM	NA	0.33	0.10	30S ribosomal protein S2
5lmt.1.B	27.03	hetero-oligomer	HHblits	EM	NA	0.33	0.10	30S ribosomal protein S2
5lms.1.B	27.03	hetero-oligomer	HHblits	EM	NA	0.33	0.10	30S ribosomal protein S2
5lmq.1.B	27.03	hetero-oligomer	HHblits	EM	NA	0.33	0.10	30S ribosomal protein S2
5j4d.1.a	27.03	hetero-oligomer	HHblits	X-ray	3.10Å	0.33	0.10	30S ribosomal protein S2
5w4k.2.6	27.03	hetero-oligomer	HHblits	X-ray	2.70Å	0.33	0.10	30S ribosomal protein S2
5dox.1.6	27.03	hetero-oligomer	HHblits	X-ray	3.10Å	0.33	0.10	30S ribosomal protein S2
4z8c.2.6	27.03	hetero-oligomer	HHblits	X-ray	2.90Å	0.33	0.10	30S ribosomal protein S2
5dox.2.6	27.03	hetero-oligomer	HHblits	X-ray	3.10Å	0.33	0.10	30S ribosomal protein S2
4x62.1.B	27.03	hetero-oligomer	HHblits	X-ray	3.45Å	0.33	0.10	30S ribosomal protein S2
2e5l.1.B	27.03	hetero-oligomer	HHblits	X-ray	3.30Å	0.33	0.10	30S ribosomal protein S2
4v7p.2.6	27.03	hetero-oligomer	HHblits	X-ray	3.62Å	0.33	0.10	30S ribosomal protein S2
4gkk.1.B	27.03	hetero-oligomer	HHblits	X-ray	3.20Å	0.33	0.10	30S ribosomal protein S2
4gkj.1.B	27.03	hetero-oligomer	HHblits	X-ray	3.30Å	0.33	0.10	30S ribosomal protein S2
4v4g.2.B	27.03	hetero-oligomer	HHblits	X-ray	11.50Å	0.33	0.10	30S ribosomal protein S2
4v9q.2.5	27.03	hetero-oligomer	HHblits	X-ray	3.40Å	0.33	0.10	30S ribosomal protein S2
4v9i.2.B	27.03	hetero-oligomer	HHblits	X-ray	3.30Å	0.33	0.10	30S Ribosomal protein S2
4jv5.1.B	27.03	hetero-oligomer	HHblits	X-ray	3.16Å	0.33	0.10	30S ribosomal protein S2
4v9h.1.O	27.03	hetero-oligomer	HHblits	X-ray	2.86Å	0.33	0.10	30S ribosomal protein S2
4wt8.2.D	27.03	hetero-oligomer	HHblits	X-ray	3.40Å	0.33	0.10	30S ribosomal protein S2
4v4a.1.B	27.03	hetero-oligomer	HHblits	X-ray	9.50Å	0.33	0.10	30S ribosomal protein S2
4xej.2.2	27.03	hetero-oligomer	HHblits	X-ray	3.80Å	0.33	0.10	30S ribosomal protein S2
5aa0.1.8	27.03	hetero-oligomer	HHblits	EM	5.00Å	0.33	0.10	30S ribosomal protein S2
4zer.1.6	27.03	hetero-oligomer	HHblits	X-ray	3.10Å	0.33	0.10	30S ribosomal protein S2
4zer.2.6	27.03	hetero-oligomer	HHblits	X-ray	3.10Å	0.33	0.10	30S ribosomal protein S2
4yhh.1.B	27.03	hetero-oligomer	HHblits	X-ray	3.42Å	0.33	0.10	30S ribosomal protein S2
5iwa.1.A	27.03	hetero-oligomer	HHblits	X-ray	3.50Å	0.33	0.10	30S ribosomal protein S2
1i94.1.B	27.03	hetero-oligomer	HHblits	X-ray	3.20Å	0.33	0.10	30S RIBOSOMAL PROTEIN S2
2zm6.1.B	27.03	hetero-oligomer	HHblits	X-ray	3.30Å	0.33	0.10	30S ribosomal protein S2
3sbx.1.A	7.32	homo-dimer	HHblits	X-ray	2.50Å	0.25	0.12	Putative uncharacterized protein
3sbx.2.A	7.32	homo-dimer	HHblits	X-ray	2.50Å	0.25	0.12	Putative uncharacterized protein
2oen.1.A	17.95	hetero-oligomer	HHblits	X-ray	3.17Å	0.28	0.11	Catabolite control protein
1sxi.1.B	17.95	homo-dimer	HHblits	X-ray	3.00Å	0.28	0.11	Glucose-resistance amylase regulator
1sxi.2.A	17.95	homo-dimer	HHblits	X-ray	3.00Å	0.28	0.11	Glucose-resistance amylase regulator
1sxi.2.B	17.95	homo-dimer	HHblits	X-ray	3.00Å	0.28	0.11	Glucose-resistance amylase regulator
1sxi.3.A	17.95	homo-dimer	HHblits	X-ray	3.00Å	0.28	0.11	Glucose-resistance amylase regulator
1sxi.3.B	17.95	homo-dimer	HHblits	X-ray	3.00Å	0.28	0.11	Glucose-resistance amylase regulator
1sxi.4.A	17.95	homo-dimer	HHblits	X-ray	3.00Å	0.28	0.11	Glucose-resistance amylase regulator
1sxi.4.B	17.95	homo-dimer	HHblits	X-ray	3.00Å	0.28	0.11	Glucose-resistance amylase regulator
1sxi.5.A	17.95	homo-dimer	HHblits	X-ray	3.00Å	0.28	0.11	Glucose-resistance amylase regulator
1sxi.5.B	17.95	homo-dimer	HHblits	X-ray	3.00Å	0.28	0.11	Glucose-resistance amylase regulator
1sxi.6.A	17.95	homo-dimer	HHblits	X-ray	3.00Å	0.28	0.11	Glucose-resistance amylase regulator
1sxi.6.B	17.95	homo-dimer	HHblits	X-ray	3.00Å	0.28	0.11	Glucose-resistance amylase regulator
1sxh.1.A	17.95	homo-dimer	HHblits	X-ray	2.75Å	0.28	0.11	Glucose-resistance amylase regulator
1sxh.1.B	17.95	homo-dimer	HHblits	X-ray	2.75Å	0.28	0.11	Glucose-resistance amylase regulator
1sxg.1.A	17.95	homo-dimer	HHblits	X-ray	2.75Å	0.28	0.11	Glucose-resistance amylase regulator
1sxg.1.B	17.95	homo-dimer	HHblits	X-ray	2.75Å	0.28	0.11	Glucose-resistance amylase regulator
1sxg.2.A	17.95	homo-dimer	HHblits	X-ray	2.75Å	0.28	0.11	Glucose-resistance amylase regulator
1sxg.2.B	17.95	homo-dimer	HHblits	X-ray	2.75Å	0.28	0.11	Glucose-resistance amylase regulator
1sxg.3.A	17.95	homo-dimer	HHblits	X-ray	2.75Å	0.28	0.11	Glucose-resistance amylase regulator
1sxg.3.B	17.95	homo-dimer	HHblits	X-ray	2.75Å	0.28	0.11	Glucose-resistance amylase regulator
1sxi.1.A	17.95	homo-dimer	HHblits	X-ray	3.00Å	0.28	0.11	Glucose-resistance amylase regulator
2nzu.1.A	17.95	hetero-oligomer	HHblits	X-ray	2.50Å	0.28	0.11	Catabolite control protein
1cp2.1.A	21.62	homo-dimer	HHblits	X-ray	1.93Å	0.32	0.10	NITROGENASE IRON PROTEIN
1cp2.1.B	21.62	homo-dimer	HHblits	X-ray	1.93Å	0.32	0.10	NITROGENASE IRON PROTEIN
3kjg.2.A	27.03	homo-dimer	HHblits	X-ray	2.30Å	0.32	0.10	CO dehydrogenase/acetyl-CoA synthase complex, accessory protein CooC
3kjg.1.A	27.03	monomer	HHblits	X-ray	2.30Å	0.32	0.10	CO dehydrogenase/acetyl-CoA synthase complex, accessory protein CooC
3kji.1.A	27.03	homo-dimer	HHblits	X-ray	2.13Å	0.32	0.10	CO dehydrogenase/acetyl-CoA synthase complex, accessory protein CooC
3kji.2.A	27.03	homo-dimer	HHblits	X-ray	2.13Å	0.32	0.10	CO dehydrogenase/acetyl-CoA synthase complex, accessory protein CooC
3kjh.1.A	27.03	homo-dimer	HHblits	X-ray	1.90Å	0.32	0.10	CO dehydrogenase/acetyl-CoA synthase complex, accessory protein CooC
3kje.1.A	27.03	monomer	HHblits	X-ray	2.30Å	0.32	0.10	CO dehydrogenase/acetyl-CoA synthase complex, accessory protein CooC
3qua.1.A	4.88	homo-dimer	HHblits	X-ray	2.10Å	0.24	0.12	Putative uncharacterized protein
1g3r.1.A	24.32	monomer	HHblits	X-ray	2.70Å	0.32	0.10	CELL DIVISION INHIBITOR
1vi5.1.A	18.92	monomer	HHblits	X-ray	2.65Å	0.32	0.10	30S ribosomal protein S2P
1vi5.2.A	18.92	monomer	HHblits	X-ray	2.65Å	0.32	0.10	30S ribosomal protein S2P
1vi5.4.A	18.92	monomer	HHblits	X-ray	2.65Å	0.32	0.10	30S ribosomal protein S2P
5b51.1.A	12.82	monomer	HHblits	X-ray	1.30Å	0.28	0.11	ABC-type transporter, periplasmic component
5b50.1.A	12.82	monomer	HHblits	X-ray	1.65Å	0.28	0.11	ABC-type transporter, periplasmic component
5b4z.1.A	12.82	monomer	HHblits	X-ray	1.30Å	0.28	0.11	ABC-type transporter, periplasmic component
1hyq.1.A	18.92	monomer	HHblits	X-ray	2.60Å	0.32	0.10	CELL DIVISION INHIBITOR (MIND-1)
2obn.1.A	18.92	homo-dimer	HHblits	X-ray	2.30Å	0.32	0.10	Hypothetical protein
2obn.1.B	18.92	homo-dimer	HHblits	X-ray	2.30Å	0.32	0.10	Hypothetical protein
4a3s.1.A	19.51	homo-tetramer	HHblits	X-ray	2.30Å	0.24	0.12	6-PHOSPHOFRUCTOKINASE
3bfv.1.A	18.92	monomer	HHblits	X-ray	1.80Å	0.31	0.10	Membrane protein CapA1, Protein tyrosine kinase
5li0.1.B	24.32	hetero-oligomer	HHblits	EM	NA	0.31	0.10	30S ribosomal protein S2
5nd8.1.B	24.32	hetero-oligomer	HHblits	EM	NA	0.31	0.10	30S ribosomal protein S2
5nd9.1.B	24.32	hetero-oligomer	HHblits	EM	NA	0.31	0.10	30S ribosomal protein S2
5ngm.1.B	24.32	hetero-oligomer	HHblits	EM	NA	0.31	0.10	30S ribosomal protein S2
5ng8.1.A	24.32	monomer	HHblits	EM	NA	0.31	0.10	30S ribosomal protein S2
2ynm.1.A	27.03	hetero-oligomer	HHblits	X-ray	2.10Å	0.31	0.10	LIGHT-INDEPENDENT PROTOCHLOROPHYLLIDE REDUCTASE IRON-SULFUR ATP-BINDING PROTEIN
3fkq.1.A	21.62	homo-dimer	HHblits	X-ray	2.10Å	0.31	0.10	NtrC-like two-domain protein
4rk6.1.A	7.32	homo-dimer	HHblits	X-ray	1.76Å	0.23	0.12	Glucose-resistance amylase regulator
4qji.1.A	18.92	monomer	HHblits	X-ray	2.65Å	0.31	0.10	Phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase
2ved.1.A	18.92	homo-octamer	HHblits	X-ray	2.60Å	0.31	0.10	MEMBRANE PROTEIN CAPA1, PROTEIN TYROSINE KINASE
4e07.1.A	18.92	monomer	HHblits	X-ray	2.90Å	0.31	0.10	Plasmid partitioning protein ParF
4e09.1.A	18.92	homo-dimer	HHblits	X-ray	2.99Å	0.31	0.10	Plasmid partitioning protein ParF
4e03.1.A	18.92	monomer	HHblits	X-ray	2.45Å	0.31	0.10	Plasmid partitioning protein ParF
4e03.2.A	18.92	monomer	HHblits	X-ray	2.45Å	0.31	0.10	Plasmid partitioning protein ParF
4dzz.1.A	18.92	monomer	HHblits	X-ray	1.80Å	0.31	0.10	Plasmid partitioning protein ParF
4dzz.2.A	18.92	monomer	HHblits	X-ray	1.80Å	0.31	0.10	Plasmid partitioning protein ParF
4v5o.1.K	24.32	hetero-oligomer	HHblits	X-ray	3.93Å	0.31	0.10	RPS0E
3bil.1.A	7.50	homo-dimer	HHblits	X-ray	2.50Å	0.25	0.11	Probable LacI-family transcriptional regulator
4jmp.1.A	18.92	monomer	HHblits	X-ray	1.30Å	0.31	0.10	C-terminal fragment of CapA, Protein tyrosine kinase
4jlv.1.A	21.62	monomer	HHblits	X-ray	2.20Å	0.31	0.10	C-terminal fragment of Membrane protein CapA1, Putative uncharacterized protein capB1
3e3m.1.A	7.69	homo-dimer	HHblits	X-ray	1.60Å	0.27	0.11	Transcriptional regulator, LacI family
1weh.1.A	12.50	monomer	HHblits	X-ray	1.80Å	0.25	0.11	Conserved hypothetical protein TT1887
3qk7.1.A	12.50	homo-dimer	HHblits	X-ray	2.70Å	0.25	0.11	Transcriptional regulators
3qk7.2.A	12.50	homo-dimer	HHblits	X-ray	2.70Å	0.25	0.11	Transcriptional regulators
3qk7.2.B	12.50	homo-dimer	HHblits	X-ray	2.70Å	0.25	0.11	Transcriptional regulators
3kpk.1.A	22.22	monomer	HHblits	X-ray	2.05Å	0.33	0.10	Sulfide-quinone reductase, putative
3t2y.1.A	22.22	monomer	HHblits	X-ray	2.50Å	0.33	0.10	Sulfide-quinone reductase, putative
1sbz.1.A	18.42	homo-12-mer	HHblits	X-ray	2.00Å	0.29	0.11	Probable aromatic acid decarboxylase
3fmi.1.A	30.56	homo-dimer	HHblits	X-ray	2.18Å	0.33	0.10	Dethiobiotin synthetase
3fmi.1.B	30.56	homo-dimer	HHblits	X-ray	2.18Å	0.33	0.10	Dethiobiotin synthetase
3fmf.2.A	30.56	homo-dimer	HHblits	X-ray	2.05Å	0.33	0.10	Dethiobiotin synthetase
3zq6.1.A	25.00	homo-dimer	HHblits	X-ray	2.11Å	0.33	0.10	PUTATIVE ARSENICAL PUMP-DRIVING ATPASE
3zq6.1.B	25.00	homo-dimer	HHblits	X-ray	2.11Å	0.33	0.10	PUTATIVE ARSENICAL PUMP-DRIVING ATPASE
3zq6.2.A	25.00	homo-dimer	HHblits	X-ray	2.11Å	0.33	0.10	PUTATIVE ARSENICAL PUMP-DRIVING ATPASE
3zq6.2.B	25.00	homo-dimer	HHblits	X-ray	2.11Å	0.33	0.10	PUTATIVE ARSENICAL PUMP-DRIVING ATPASE
4heq.1.A	24.32	homo-dimer	HHblits	X-ray	1.30Å	0.31	0.10	Flavodoxin
4v7h.1.B	18.92	hetero-oligomer	HHblits	EM	8.90Å	0.31	0.10	40S ribosomal protein S0(A)
3qua.1.A	25.00	homo-dimer	HHblits	X-ray	2.10Å	0.33	0.10	Putative uncharacterized protein
4v9d.2.B	24.32	hetero-oligomer	HHblits	X-ray	3.00Å	0.30	0.10	30S ribosomal protein S2
4v7s.2.B	24.32	hetero-oligomer	HHblits	X-ray	3.25Å	0.30	0.10	30S ribosomal protein S2
4v9d.1.B	24.32	hetero-oligomer	HHblits	X-ray	3.00Å	0.30	0.10	30S ribosomal protein S2
4v7u.1.B	24.32	hetero-oligomer	HHblits	X-ray	3.10Å	0.30	0.10	30S ribosomal protein S2
4u24.1.B	24.32	hetero-oligomer	HHblits	X-ray	2.90Å	0.30	0.10	30S ribosomal protein S2
4v69.1.M	24.32	hetero-oligomer	HHblits	EM	NA	0.30	0.10	30S ribosomal protein S2
5mgp.1.6	24.32	hetero-oligomer	HHblits	EM	NA	0.30	0.10	30S ribosomal protein S2
4v5h.1.B	24.32	hetero-oligomer	HHblits	EM	5.80Å	0.30	0.10	30S RIBOSOMAL PROTEIN S2
5np6.1.E	24.32	hetero-oligomer	HHblits	EM	NA	0.30	0.10	30S ribosomal protein S2
4a2i.1.B	24.32	hetero-oligomer	HHblits	EM	16.50Å	0.30	0.10	30S RIBOSOMAL PROTEIN S2
5lze.1.B	24.32	hetero-oligomer	HHblits	EM	NA	0.30	0.10	30S ribosomal protein S2
5lzb.1.B	24.32	hetero-oligomer	HHblits	EM	NA	0.30	0.10	30S ribosomal protein S2
5lzc.1.B	24.32	hetero-oligomer	HHblits	EM	NA	0.30	0.10	30S ribosomal protein S2
2ykr.1.B	24.32	hetero-oligomer	HHblits	EM	9.80Å	0.30	0.10	30S RIBOSOMAL PROTEIN S2
5lzf.1.B	24.32	hetero-oligomer	HHblits	EM	NA	0.30	0.10	30S ribosomal protein S2
5uyl.1.5	24.32	hetero-oligomer	HHblits	EM	NA	0.30	0.10	30S ribosomal protein S2
5uyn.1.5	24.32	hetero-oligomer	HHblits	EM	NA	0.30	0.10	30S ribosomal protein S2
5uyk.1.5	24.32	hetero-oligomer	HHblits	EM	NA	0.30	0.10	30S ribosomal protein S2
5uyp.1.5	24.32	hetero-oligomer	HHblits	EM	NA	0.30	0.10	30S ribosomal protein S2
5uyq.1.5	24.32	hetero-oligomer	HHblits	EM	NA	0.30	0.10	30S ribosomal protein S2
5o2r.1.8	24.32	hetero-oligomer	HHblits	EM	NA	0.30	0.10	30S ribosomal protein S2
6awd.1.G	24.32	hetero-oligomer	HHblits	EM	NA	0.30	0.10	30S ribosomal protein S2
6awc.1.H	24.32	hetero-oligomer	HHblits	EM	NA	0.30	0.10	30S ribosomal protein S2
6awb.1.H	24.32	hetero-oligomer	HHblits	EM	NA	0.30	0.10	30S ribosomal protein S2
4v4v.1.E	24.32	hetero-oligomer	HHblits	EM	NA	0.30	0.10	30S ribosomal subunit protein S2
4ybb.1.B	24.32	hetero-oligomer	HHblits	X-ray	2.10Å	0.30	0.10	30S ribosomal protein S2
5no3.1.B	24.32	hetero-oligomer	HHblits	EM	NA	0.30	0.10	30S ribosomal protein S2
5nwy.1.9	24.32	hetero-oligomer	HHblits	EM	2.93Å	0.30	0.10	30S ribosomal protein S2
4v75.1.A	24.32	hetero-oligomer	HHblits	EM	NA	0.30	0.10	30S ribosomal protein S2
4v72.1.A	24.32	hetero-oligomer	HHblits	EM	NA	0.30	0.10	30S ribosomal protein S2
4v70.1.A	24.32	hetero-oligomer	HHblits	EM	NA	0.30	0.10	30S ribosomal protein S2
4v73.1.A	24.32	hetero-oligomer	HHblits	EM	NA	0.30	0.10	30S ribosomal protein S2
4v6y.1.A	24.32	hetero-oligomer	HHblits	EM	NA	0.30	0.10	30S ribosomal protein S2
4v71.1.A	24.32	hetero-oligomer	HHblits	EM	NA	0.30	0.10	30S ribosomal protein S2
4v6z.1.A	24.32	hetero-oligomer	HHblits	EM	NA	0.30	0.10	30S ribosomal protein S2
4v74.1.A	24.32	hetero-oligomer	HHblits	EM	NA	0.30	0.10	30S ribosomal protein S2
4v77.1.A	24.32	hetero-oligomer	HHblits	EM	NA	0.30	0.10	30S ribosomal protein S2
4v76.1.A	24.32	hetero-oligomer	HHblits	EM	NA	0.30	0.10	30S ribosomal protein S2
4v7a.1.A	24.32	hetero-oligomer	HHblits	EM	NA	0.30	0.10	30S ribosomal protein S2
4v79.1.A	24.32	hetero-oligomer	HHblits	EM	NA	0.30	0.10	30S ribosomal protein S2
4v78.1.A	24.32	hetero-oligomer	HHblits	EM	NA	0.30	0.10	30S ribosomal protein S2
4v5y.1.T	24.32	hetero-oligomer	HHblits	X-ray	4.45Å	0.30	0.10	30S ribosomal protein S2
4v4q.1.T	24.32	hetero-oligomer	HHblits	X-ray	3.46Å	0.30	0.10	30S ribosomal protein S2
4v50.2.C	24.32	hetero-oligomer	HHblits	X-ray	3.22Å	0.30	0.10	30S ribosomal protein S2
4v5b.1.7	24.32	hetero-oligomer	HHblits	X-ray	3.74Å	0.30	0.10	30S RIBOSOMAL PROTEIN S2
4v54.2.S	24.32	hetero-oligomer	HHblits	X-ray	3.30Å	0.30	0.10	30S ribosomal protein S2
4v4q.2.T	24.32	hetero-oligomer	HHblits	X-ray	3.46Å	0.30	0.10	30S ribosomal protein S2
4v64.2.T	24.32	hetero-oligomer	HHblits	X-ray	3.50Å	0.30	0.10	30S ribosomal protein S2
4v57.1.R	24.32	hetero-oligomer	HHblits	X-ray	3.50Å	0.30	0.10	30S ribosomal protein S2
4v5b.2.6	24.32	hetero-oligomer	HHblits	X-ray	3.74Å	0.30	0.10	30S RIBOSOMAL PROTEIN S2
4v57.2.T	24.32	hetero-oligomer	HHblits	X-ray	3.50Å	0.30	0.10	30S ribosomal protein S2
4v50.1.C	24.32	hetero-oligomer	HHblits	X-ray	3.22Å	0.30	0.10	30S ribosomal protein S2
4v56.1.R	24.32	hetero-oligomer	HHblits	X-ray	3.93Å	0.30	0.10	30S ribosomal protein S2
4v56.2.T	24.32	hetero-oligomer	HHblits	X-ray	3.93Å	0.30	0.10	30S ribosomal protein S2
4v6q.1.E	24.32	hetero-oligomer	HHblits	EM	NA	0.30	0.10	30S ribosomal protein S2
4v6s.1.b	24.32	hetero-oligomer	HHblits	EM	NA	0.30	0.10	30S ribosomal protein S2
4v6p.1.E	24.32	hetero-oligomer	HHblits	EM	NA	0.30	0.10	30S ribosomal protein S2
4v6r.1.E	24.32	hetero-oligomer	HHblits	EM	NA	0.30	0.10	30S ribosomal protein S2
4v6o.1.E	24.32	hetero-oligomer	HHblits	EM	NA	0.30	0.10	30S ribosomal protein S2
4v6v.1.K	24.32	hetero-oligomer	HHblits	EM	NA	0.30	0.10	30S ribosomal protein S2
4v6m.1.G	24.32	hetero-oligomer	HHblits	EM	NA	0.30	0.10	30S ribosomal protein S2
4v6n.1.c	24.32	hetero-oligomer	HHblits	EM	NA	0.30	0.10	30S ribosomal protein S2
4v7d.1.9	24.32	hetero-oligomer	HHblits	EM	NA	0.30	0.10	30S ribosomal protein S2
3j9z.1.N	24.32	hetero-oligomer	HHblits	EM	NA	0.30	0.10	30S ribosomal protein S2
3ja1.1.R	24.32	hetero-oligomer	HHblits	EM	NA	0.30	0.10	30S ribosomal protein S2
5h5u.1.c	24.32	hetero-oligomer	HHblits	EM	3.00Å	0.30	0.10	30S ribosomal protein S2
4v6c.1.A	24.32	hetero-oligomer	HHblits	X-ray	3.19Å	0.30	0.10	30S ribosomal protein S2
4v4h.2.T	24.32	hetero-oligomer	HHblits	X-ray	3.46Å	0.30	0.10	30S RIBOSOMAL PROTEIN S2
4v4h.1.T	24.32	hetero-oligomer	HHblits	X-ray	3.46Å	0.30	0.10	30S RIBOSOMAL PROTEIN S2
4v6c.2.A	24.32	hetero-oligomer	HHblits	X-ray	3.19Å	0.30	0.10	30S ribosomal protein S2
4v9o.1.7	24.32	hetero-oligomer	HHblits	X-ray	2.90Å	0.30	0.10	30S ribosomal protein S2
4v9c.1.B	24.32	hetero-oligomer	HHblits	X-ray	3.30Å	0.30	0.10	30S ribosomal protein S2
4v9c.2.B	24.32	hetero-oligomer	HHblits	X-ray	3.30Å	0.30	0.10	30S ribosomal protein S2
4v9p.3.7	24.32	hetero-oligomer	HHblits	X-ray	2.90Å	0.30	0.10	30S ribosomal protein S2
4v9p.2.6	24.32	hetero-oligomer	HHblits	X-ray	2.90Å	0.30	0.10	30S ribosomal protein S2
4v9o.2.7	24.32	hetero-oligomer	HHblits	X-ray	2.90Å	0.30	0.10	30S ribosomal protein S2
4v9o.4.6	24.32	hetero-oligomer	HHblits	X-ray	2.90Å	0.30	0.10	30S ribosomal protein S2
4v9o.3.7	24.32	hetero-oligomer	HHblits	X-ray	2.90Å	0.30	0.10	30S ribosomal protein S2
4v9p.4.6	24.32	hetero-oligomer	HHblits	X-ray	2.90Å	0.30	0.10	30S ribosomal protein S2
4v66.1.F	24.32	hetero-oligomer	HHblits	EM	NA	0.30	0.10	30S ribosomal protein S2
4v6k.1.c	24.32	hetero-oligomer	HHblits	EM	NA	0.30	0.10	30S ribosomal protein S2
4v6l.1.F	24.32	hetero-oligomer	HHblits	EM	NA	0.30	0.10	30S ribosomal protein S2
4v7i.1.a	24.32	hetero-oligomer	HHblits	EM	NA	0.30	0.10	30S ribosomal protein S2
5kcs.1.9	24.32	hetero-oligomer	HHblits	EM	NA	0.30	0.10	30S ribosomal protein S2
5kcr.1.7	24.32	hetero-oligomer	HHblits	EM	NA	0.30	0.10	30S ribosomal protein S2
5iqr.1.5	24.32	hetero-oligomer	HHblits	EM	3.00Å	0.30	0.10	30S ribosomal protein S2
3jcn.1.8	24.32	hetero-oligomer	HHblits	EM	NA	0.30	0.10	30S ribosomal protein S2
5mdz.1.a	24.32	hetero-oligomer	HHblits	EM	3.10Å	0.30	0.10	30S ribosomal protein S2
3jbv.1.B	24.32	hetero-oligomer	HHblits	EM	NA	0.30	0.10	30S ribosomal protein S2
3jbu.1.A	24.32	hetero-oligomer	HHblits	EM	3.64Å	0.30	0.10	30S ribosomal protein S2
5u4i.1.6	24.32	hetero-oligomer	HHblits	EM	3.50Å	0.30	0.10	30S ribosomal protein S2
3jce.1.U	24.32	hetero-oligomer	HHblits	EM	3.20Å	0.30	0.10	30S ribosomal protein S2
3jcd.1.A	24.32	hetero-oligomer	HHblits	EM	NA	0.30	0.10	30S ribosomal protein S2
5u9g.1.e	24.32	hetero-oligomer	HHblits	EM	NA	0.30	0.10	30S ribosomal protein S2
5u9f.1.e	24.32	hetero-oligomer	HHblits	EM	NA	0.30	0.10	30S ribosomal protein S2
5uz4.1.T	24.32	hetero-oligomer	HHblits	EM	NA	0.30	0.10	30S ribosomal protein S2
5kps.1.6	24.32	hetero-oligomer	HHblits	EM	NA	0.30	0.10	30S ribosomal protein S2
5kpv.1.5	24.32	hetero-oligomer	HHblits	EM	NA	0.30	0.10	30S ribosomal protein S2
5kpw.1.5	24.32	hetero-oligomer	HHblits	EM	NA	0.30	0.10	30S ribosomal protein S2
5kpx.1.5	24.32	hetero-oligomer	HHblits	EM	NA	0.30	0.10	30S ribosomal protein S2
4woi.1.B	24.32	hetero-oligomer	HHblits	X-ray	3.00Å	0.30	0.10	30S ribosomal protein S2
4woi.2.6	24.32	hetero-oligomer	HHblits	X-ray	3.00Å	0.30	0.10	30S ribosomal protein S2
3j9y.1.B	24.32	hetero-oligomer	HHblits	EM	NA	0.30	0.10	30S ribosomal protein S2
5ju8.1.B	24.32	hetero-oligomer	HHblits	EM	NA	0.30	0.10	30S ribosomal protein S2
1wcv.1.A	21.62	homo-dimer	HHblits	X-ray	1.60Å	0.30	0.10	SEGREGATION PROTEIN
2bej.1.A	21.62	homo-dimer	HHblits	X-ray	2.10Å	0.30	0.10	SEGREGATION PROTEIN
3rh0.1.A	21.62	monomer	HHblits	X-ray	1.72Å	0.30	0.10	ARSENATE REDUCTASE
3rh0.2.A	21.62	monomer	HHblits	X-ray	1.72Å	0.30	0.10	ARSENATE REDUCTASE
4v61.1.B	18.92	hetero-oligomer	HHblits	EM	NA	0.30	0.10	Ribosomal Protein S2
5mmj.1.D	18.92	hetero-oligomer	HHblits	EM	3.65Å	0.30	0.10	30S ribosomal protein S2, chloroplastic
5x8r.1.A	18.92	hetero-oligomer	HHblits	EM	NA	0.30	0.10	30S ribosomal protein S2, chloroplastic
1dts.1.A	25.00	homo-dimer	HHblits	X-ray	1.65Å	0.32	0.10	DETHIOBIOTIN SYNTHETASE
2ph1.1.A	27.78	homo-dimer	HHblits	X-ray	2.70Å	0.32	0.10	Nucleotide-binding protein
1n0w.1.A	18.42	hetero-oligomer	HHblits	X-ray	1.70Å	0.28	0.11	DNA repair protein RAD51 homolog 1
1f48.1.A	28.57	monomer	HHblits	X-ray	2.30Å	0.34	0.10	ARSENITE-TRANSLOCATING ATPASE
4v4b.1.C	18.92	hetero-oligomer	HHblits	EM	NA	0.30	0.10	40S ribosomal protein S0-A
5m1j.2.A	18.92	monomer	HHblits	EM	3.30Å	0.30	0.10	40S ribosomal protein S0-A
5lyb.1.A	18.92	monomer	HHblits	X-ray	3.25Å	0.30	0.10	40S ribosomal protein S0-A
5tga.76.A	18.92	monomer	HHblits	X-ray	3.30Å	0.30	0.10	40S ribosomal protein S0-A
4v92.1.C	18.92	hetero-oligomer	HHblits	EM	3.70Å	0.30	0.10	US2
4v88.1.A	18.92	monomer	HHblits	X-ray	3.00Å	0.30	0.10	40S ribosomal protein S0-A
3j77.46.A	18.92	monomer	HHblits	EM	NA	0.30	0.10	40S ribosomal protein S0
4v7r.1.A	18.92	monomer	HHblits	X-ray	4.00Å	0.30	0.10	40S ribosomal protein S0-A
4v6i.2.A	18.92	monomer	HHblits	EM	NA	0.30	0.10	40S ribosomal protein rpS0 (S2p)
3j78.46.A	18.92	monomer	HHblits	EM	NA	0.30	0.10	40S ribosomal protein S0
3j6y.43.A	18.92	monomer	HHblits	EM	NA	0.30	0.10	40S ribosomal protein S0
3j6x.43.A	18.92	monomer	HHblits	EM	NA	0.30	0.10	40S ribosomal protein S0
4v88.76.A	18.92	monomer	HHblits	X-ray	3.00Å	0.30	0.10	40S ribosomal protein S0-A
5mc6.16.A	18.92	monomer	HHblits	EM	NA	0.30	0.10	40S ribosomal protein S0-A
5ll6.1.B	18.92	hetero-oligomer	HHblits	EM	NA	0.30	0.10	40S ribosomal protein S0-A
5jut.46.A	18.92	monomer	HHblits	EM	NA	0.30	0.10	uS2 (yeast S0)
5juo.46.A	18.92	monomer	HHblits	EM	NA	0.30	0.10	uS2 (yeast S0)
5juu.46.A	18.92	monomer	HHblits	EM	NA	0.30	0.10	uS2 (yeast S0)
5jup.46.A	18.92	monomer	HHblits	EM	NA	0.30	0.10	uS2 (yeast S0)
5jus.46.A	18.92	monomer	HHblits	EM	NA	0.30	0.10	uS2 (yeast S0)
4u6f.1.A	18.92	monomer	HHblits	X-ray	3.10Å	0.30	0.10	40S ribosomal protein S0-A
4u3n.76.A	18.92	monomer	HHblits	X-ray	3.20Å	0.30	0.10	40S ribosomal protein S0-A
1xyv.1.A	18.42	monomer	HHblits	X-ray	1.79Å	0.28	0.11	FLAVODOXIN
5az3.1.A	13.16	monomer	HHblits	X-ray	1.42Å	0.28	0.11	ABC-type transporter, periplasmic component
3q1k.1.A	10.81	homo-dimer	HHblits	X-ray	2.20Å	0.30	0.10	D-alanine--D-alanine ligase A
3q1k.1.B	10.81	homo-dimer	HHblits	X-ray	2.20Å	0.30	0.10	D-alanine--D-alanine ligase A
3kb1.1.A	27.78	homo-dimer	HHblits	X-ray	2.90Å	0.32	0.10	Nucleotide-binding protein
3mcu.1.A	15.79	homo-hexamer	HHblits	X-ray	2.30Å	0.28	0.11	Dipicolinate synthase, B chain
3mcu.1.E	15.79	homo-hexamer	HHblits	X-ray	2.30Å	0.28	0.11	Dipicolinate synthase, B chain
3jbo.18.A	24.32	monomer	HHblits	EM	NA	0.30	0.10	40S ribosomal protein uS2
3jbp.31.A	24.32	monomer	HHblits	EM	NA	0.30	0.10	40S ribosomal protein uS2
3jbn.31.A	24.32	monomer	HHblits	EM	NA	0.30	0.10	40S ribosomal protein uS2
3jag.45.A	21.62	monomer	HHblits	EM	NA	0.30	0.10	uS2
5k0y.1.1	21.62	hetero-oligomer	HHblits	EM	NA	0.30	0.10	ribosomal protein uS2
3bch.1.A	21.62	monomer	HHblits	X-ray	2.15Å	0.30	0.10	40S ribosomal protein SA
4ujc.45.A	21.62	monomer	HHblits	EM	9.50Å	0.30	0.10	40S RIBOSOMAL PROTEIN US2
3j7p.46.A	21.62	monomer	HHblits	EM	NA	0.30	0.10	Ribosomal protein uS2
4ug0.44.A	21.62	monomer	HHblits	EM	NA	0.30	0.10	40S RIBOSOMAL PROTEIN SA
5aj0.46.A	21.62	monomer	HHblits	EM	3.50Å	0.30	0.10	40S ribosomal protein SA
5t2c.66.A	21.62	monomer	HHblits	EM	NA	0.30	0.10	40S ribosomal protein SA
4ujd.45.A	21.62	monomer	HHblits	EM	8.90Å	0.30	0.10	40S RIBOSOMAL PROTEIN US2
4v6x.16.A	21.62	monomer	HHblits	EM	NA	0.30	0.10	40S ribosomal protein SA
5a2q.1.C	21.62	hetero-oligomer	HHblits	EM	3.90Å	0.30	0.10	RIBOSOMAL PROTEIN US2
5lks.44.A	21.62	monomer	HHblits	EM	NA	0.30	0.10	40S ribosomal protein SA
3cio.1.A	18.92	homo-dimer	HHblits	X-ray	2.50Å	0.30	0.10	Tyrosine-protein kinase etk
3cio.1.B	18.92	homo-dimer	HHblits	X-ray	2.50Å	0.30	0.10	Tyrosine-protein kinase etk
5it7.45.A	16.22	monomer	HHblits	EM	NA	0.30	0.10	40S ribosomal protein S0
1p9n.1.A	25.00	homo-dimer	HHblits	X-ray	2.80Å	0.32	0.10	Molybdopterin-guanine dinucleotide biosynthesis protein B
1p9n.1.B	25.00	homo-dimer	HHblits	X-ray	2.80Å	0.32	0.10	Molybdopterin-guanine dinucleotide biosynthesis protein B
1rz3.1.A	15.79	monomer	HHblits	X-ray	1.90Å	0.27	0.11	hypothetical protein RBSTP0775
1fx1.1.A	18.42	monomer	HHblits	X-ray	2.00Å	0.27	0.11	FLAVODOXIN
5t2a.50.A	18.92	monomer	HHblits	EM	NA	0.29	0.10	uS2
2xit.1.A	18.92	homo-dimer	HHblits	X-ray	1.80Å	0.29	0.10	MIPZ
2xj4.1.A	18.92	monomer	HHblits	X-ray	1.60Å	0.29	0.10	MIPZ
2xj9.1.A	18.92	homo-dimer	HHblits	X-ray	2.80Å	0.29	0.10	MIPZ
2xj9.1.B	18.92	homo-dimer	HHblits	X-ray	2.80Å	0.29	0.10	MIPZ
5o5j.1.U	18.92	hetero-oligomer	HHblits	EM	3.45Å	0.29	0.10	30S ribosomal protein S2
3of5.1.A	25.00	homo-dimer	HHblits	X-ray	1.52Å	0.31	0.10	Dethiobiotin synthetase
3ug7.1.A	19.44	homo-tetramer	HHblits	X-ray	2.90Å	0.31	0.10	arsenical pump-driving ATPase
3ug6.1.A	19.44	homo-tetramer	HHblits	X-ray	3.30Å	0.31	0.10	arsenical pump-driving ATPase
1nks.1.C	23.68	homo-trimer	HHblits	X-ray	2.57Å	0.27	0.11	ADENYLATE KINASE
1nks.1.B	23.68	homo-trimer	HHblits	X-ray	2.57Å	0.27	0.11	ADENYLATE KINASE
1nks.1.A	23.68	homo-trimer	HHblits	X-ray	2.57Å	0.27	0.11	ADENYLATE KINASE
5l3r.1.A	24.32	hetero-oligomer	HHblits	X-ray	2.50Å	0.29	0.10	Signal recognition particle 54 kDa protein, chloroplastic
5m29.1.A	24.32	monomer	HHblits	X-ray	1.50Å	0.29	0.10	Vitamin B12-binding protein
1n2z.3.A	24.32	homo-dimer	HHblits	X-ray	2.00Å	0.29	0.10	Vitamin B12 transport protein btuF
2qi9.1.E	24.32	hetero-oligomer	HHblits	X-ray	2.60Å	0.29	0.10	Vitamin B12-binding protein btuF
1n2z.3.B	24.32	homo-dimer	HHblits	X-ray	2.00Å	0.29	0.10	Vitamin B12 transport protein btuF
5lv9.1.A	19.44	monomer	HHblits	X-ray	2.33Å	0.31	0.10	thermophilic tryptophan halogenase
3la6.1.F	18.92	homo-octamer	HHblits	X-ray	3.20Å	0.29	0.10	Tyrosine-protein kinase wzc
3la6.1.B	18.92	homo-octamer	HHblits	X-ray	3.20Å	0.29	0.10	Tyrosine-protein kinase wzc
3la6.1.C	18.92	homo-octamer	HHblits	X-ray	3.20Å	0.29	0.10	Tyrosine-protein kinase wzc
3la6.1.D	18.92	homo-octamer	HHblits	X-ray	3.20Å	0.29	0.10	Tyrosine-protein kinase wzc
3la6.1.E	18.92	homo-octamer	HHblits	X-ray	3.20Å	0.29	0.10	Tyrosine-protein kinase wzc
3la6.1.A	18.92	homo-octamer	HHblits	X-ray	3.20Å	0.29	0.10	Tyrosine-protein kinase wzc
3la6.1.G	18.92	homo-octamer	HHblits	X-ray	3.20Å	0.29	0.10	Tyrosine-protein kinase wzc
3la6.1.H	18.92	homo-octamer	HHblits	X-ray	3.20Å	0.29	0.10	Tyrosine-protein kinase wzc
3la6.2.C	18.92	homo-octamer	HHblits	X-ray	3.20Å	0.29	0.10	Tyrosine-protein kinase wzc
5its.1.A	16.22	homo-dimer	HHblits	X-ray	2.30Å	0.29	0.10	Cytokinin riboside 5'-monophosphate phosphoribohydrolase
5its.2.B	16.22	homo-dimer	HHblits	X-ray	2.30Å	0.29	0.10	Cytokinin riboside 5'-monophosphate phosphoribohydrolase
4v8m.11.A	18.92	monomer	HHblits	EM	5.57Å	0.29	0.10	40S RIBOSOMAL PROTEIN SA, PUTATIVE
2woo.1.A	27.78	homo-dimer	HHblits	X-ray	3.01Å	0.31	0.10	ATPASE GET3
3kaq.1.A	16.22	monomer	HHblits	X-ray	2.25Å	0.29	0.10	Flavodoxin
1ydh.1.A	18.92	homo-dimer	HHblits	X-ray	2.15Å	0.29	0.10	At5g11950
2q4d.1.B	18.92	homo-dimer	HHblits	X-ray	2.15Å	0.29	0.10	Lysine decarboxylase-like protein At5g11950
1dah.1.A	22.22	homo-dimer	HHblits	X-ray	1.64Å	0.31	0.10	DETHIOBIOTIN SYNTHETASE
1byi.1.A	22.22	homo-dimer	HHblits	X-ray	0.97Å	0.31	0.10	DETHIOBIOTIN SYNTHASE
5xyi.1.B	21.62	hetero-oligomer	HHblits	EM	NA	0.29	0.10	40S ribosomal protein SA
5l3q.1.B	18.92	hetero-oligomer	HHblits	X-ray	3.20Å	0.28	0.10	Signal recognition particle receptor subunit alpha
5l3w.1.A	16.22	monomer	HHblits	X-ray	2.40Å	0.28	0.10	Signal recognition particle receptor FtsY
5l3s.1.B	16.22	hetero-oligomer	HHblits	X-ray	1.90Å	0.28	0.10	Signal recognition particle receptor FtsY
5l3s.2.B	16.22	hetero-oligomer	HHblits	X-ray	1.90Å	0.28	0.10	Signal recognition particle receptor FtsY
5l3s.3.B	16.22	hetero-oligomer	HHblits	X-ray	1.90Å	0.28	0.10	Signal recognition particle receptor FtsY
5l3s.4.B	16.22	hetero-oligomer	HHblits	X-ray	1.90Å	0.28	0.10	Signal recognition particle receptor FtsY
3i12.1.A	11.11	homo-dimer	HHblits	X-ray	2.20Å	0.31	0.10	D-alanine-D-alanine ligase A
3i12.1.B	11.11	homo-dimer	HHblits	X-ray	2.20Å	0.31	0.10	D-alanine-D-alanine ligase A
3i12.2.A	11.11	homo-dimer	HHblits	X-ray	2.20Å	0.31	0.10	D-alanine-D-alanine ligase A
5aun.1.B	25.00	hetero-oligomer	HHblits	X-ray	1.63Å	0.31	0.10	ATPase involved in chromosome partitioning, ParA/MinD family, Mrp homolog
3vx3.1.A	25.00	homo-dimer	HHblits	X-ray	2.10Å	0.31	0.10	ATPase involved in chromosome partitioning, ParA/MinD family, Mrp homolog
5auq.3.A	25.00	homo-dimer	HHblits	X-ray	2.53Å	0.31	0.10	ATPase involved in chromosome partitioning, ParA/MinD family, Mrp homolog
3vx3.1.B	25.00	homo-dimer	HHblits	X-ray	2.10Å	0.31	0.10	ATPase involved in chromosome partitioning, ParA/MinD family, Mrp homolog
3a4l.1.A	22.22	homo-dimer	HHblits	X-ray	1.80Å	0.31	0.10	L-seryl-tRNA(Sec) kinase
3a4l.1.B	22.22	homo-dimer	HHblits	X-ray	1.80Å	0.31	0.10	L-seryl-tRNA(Sec) kinase
3am1.1.C	22.22	homo-dimer	HHblits	X-ray	2.40Å	0.31	0.10	L-seryl-tRNA(Sec) kinase
2qs7.1.A	21.62	homo-trimer	HHblits	X-ray	2.09Å	0.28	0.10	Uncharacterized protein
2bek.1.A	22.22	homo-dimer	HHblits	X-ray	1.80Å	0.30	0.10	SEGREGATION PROTEIN
3fwy.1.A	25.00	homo-dimer	HHblits	X-ray	1.63Å	0.30	0.10	Light-independent protochlorophyllide reductase iron-sulfur ATP-binding protein
3fwy.1.B	25.00	homo-dimer	HHblits	X-ray	1.63Å	0.30	0.10	Light-independent protochlorophyllide reductase iron-sulfur ATP-binding protein
1rxi.1.A	16.22	monomer	HHblits	X-ray	1.50Å	0.28	0.10	Arsenate reductase
1jf8.1.A	16.22	monomer	HHblits	X-ray	1.12Å	0.28	0.10	arsenate reductase
1jfv.1.A	16.22	monomer	HHblits	X-ray	2.00Å	0.28	0.10	arsenate reductase
3ec7.1.A	13.51	homo-tetramer	HHblits	X-ray	2.15Å	0.28	0.10	Putative Dehydrogenase
5jb3.1.G	16.22	hetero-oligomer	HHblits	EM	NA	0.28	0.10	30S ribosomal protein S2
4v4n.12.A	16.22	monomer	HHblits	EM	NA	0.28	0.10	30S ribosomal protein S2P
5f51.1.A	16.22	homo-tetramer	HHblits	X-ray	2.53Å	0.28	0.10	NAD(P)H dehydrogenase (quinone)
4toi.1.A	25.00	homo-dimer	HHblits	X-ray	2.30Å	0.30	0.10	30S ribosomal protein S2,Ribosomal protein S1
3iqx.1.A	22.22	homo-dimer	HHblits	X-ray	3.50Å	0.30	0.10	Tail-anchored protein targeting factor Get3
3fx2.1.A	13.16	monomer	HHblits	X-ray	1.90Å	0.26	0.11	FLAVODOXIN
1j9g.1.A	13.16	monomer	HHblits	X-ray	2.40Å	0.26	0.11	Flavodoxin
1i1o.1.A	13.16	monomer	HHblits	X-ray	2.00Å	0.26	0.11	FLAVODOXIN
1xt6.1.A	13.16	monomer	HHblits	X-ray	1.80Å	0.26	0.11	Flavodoxin
5xxu.1.B	19.44	hetero-oligomer	HHblits	EM	3.35Å	0.30	0.10	Ribosomal protein uS2
3jaq.1.D	16.67	hetero-oligomer	HHblits	EM	NA	0.30	0.10	uS2
3j80.1.B	16.67	hetero-oligomer	HHblits	EM	NA	0.30	0.10	uS2
3j81.1.B	16.67	hetero-oligomer	HHblits	EM	NA	0.30	0.10	uS2
1u80.1.A	17.14	homo-dimer	HHblits	X-ray	2.85Å	0.32	0.10	Coenzyme A biosynthesis bifunctional protein coaBC
1u7u.1.A	17.14	homo-dimer	HHblits	X-ray	2.40Å	0.32	0.10	Coenzyme A biosynthesis bifunctional protein coaBC
4wop.1.A	28.57	homo-dimer	HHblits	X-ray	2.39Å	0.32	0.10	ATP-dependent dethiobiotin synthetase BioD
1akw.1.A	13.16	monomer	HHblits	X-ray	1.75Å	0.25	0.11	FLAVODOXIN
1akr.1.A	13.16	monomer	HHblits	X-ray	1.58Å	0.25	0.11	FLAVODOXIN
1azl.1.A	13.16	monomer	HHblits	X-ray	1.80Å	0.25	0.11	FLAVODOXIN
1f4p.1.A	13.16	monomer	HHblits	X-ray	1.30Å	0.25	0.11	FLAVODOXIN
1akt.1.A	13.16	monomer	HHblits	X-ray	1.80Å	0.25	0.11	FLAVODOXIN
1c7f.1.A	13.16	monomer	HHblits	X-ray	2.00Å	0.25	0.11	FLAVODOXIN
1t35.1.A	22.22	homo-octamer	HHblits	X-ray	2.72Å	0.30	0.10	HYPOTHETICAL PROTEIN YVDD, Putative Lysine Decarboxylase
1t35.1.B	22.22	homo-octamer	HHblits	X-ray	2.72Å	0.30	0.10	HYPOTHETICAL PROTEIN YVDD, Putative Lysine Decarboxylase
1t35.1.C	22.22	homo-octamer	HHblits	X-ray	2.72Å	0.30	0.10	HYPOTHETICAL PROTEIN YVDD, Putative Lysine Decarboxylase
1t35.1.D	22.22	homo-octamer	HHblits	X-ray	2.72Å	0.30	0.10	HYPOTHETICAL PROTEIN YVDD, Putative Lysine Decarboxylase
1t35.1.G	22.22	homo-octamer	HHblits	X-ray	2.72Å	0.30	0.10	HYPOTHETICAL PROTEIN YVDD, Putative Lysine Decarboxylase
5k5z.1.A	18.92	homo-dimer	HHblits	X-ray	2.37Å	0.27	0.10	ParA
5k5z.2.A	18.92	homo-dimer	HHblits	X-ray	2.37Å	0.27	0.10	ParA
5k5z.2.B	18.92	homo-dimer	HHblits	X-ray	2.37Å	0.27	0.10	ParA
1ki9.1.A	13.89	homo-trimer	HHblits	X-ray	2.76Å	0.29	0.10	adenylate kinase
1ki9.1.B	13.89	homo-trimer	HHblits	X-ray	2.76Å	0.29	0.10	adenylate kinase
1ki9.1.C	13.89	homo-trimer	HHblits	X-ray	2.76Å	0.29	0.10	adenylate kinase
2a33.1.A	19.44	homo-dimer	HHblits	X-ray	1.95Å	0.29	0.10	hypothetical protein
2q4o.1.B	19.44	homo-dimer	HHblits	X-ray	1.95Å	0.29	0.10	Uncharacterized protein At2g37210/T2N18.3
4fu0.1.A	20.00	homo-dimer	HHblits	X-ray	2.35Å	0.32	0.10	D-alanine--D-alanine ligase 7
4fu0.1.B	20.00	homo-dimer	HHblits	X-ray	2.35Å	0.32	0.10	D-alanine--D-alanine ligase 7
3sbx.1.A	16.22	homo-dimer	HHblits	X-ray	2.50Å	0.27	0.10	Putative uncharacterized protein
3sbx.2.A	16.22	homo-dimer	HHblits	X-ray	2.50Å	0.27	0.10	Putative uncharacterized protein
3lqk.1.A	10.53	homo-hexamer	HHblits	X-ray	2.10Å	0.25	0.11	Dipicolinate synthase subunit B
1n4a.2.A	25.00	monomer	HHblits	X-ray	2.00Å	0.29	0.10	Vitamin B12 transport protein btuF
1n4d.1.A	25.00	monomer	HHblits	X-ray	3.00Å	0.29	0.10	Vitamin B12 transport protein btuF
1n4d.2.A	25.00	monomer	HHblits	X-ray	3.00Å	0.29	0.10	Vitamin B12 transport protein btuF
4dbl.1.E	25.00	hetero-oligomer	HHblits	X-ray	3.49Å	0.29	0.10	Vitamin B12-binding protein
4fi3.1.E	25.00	hetero-oligomer	HHblits	X-ray	3.47Å	0.29	0.10	Vitamin B12-binding protein
5wqo.1.A	17.65	homo-dimer	HHblits	X-ray	1.78Å	0.34	0.10	Probable dehydrogenase
5wqp.1.B	17.65	homo-dimer	HHblits	X-ray	1.70Å	0.34	0.10	Probable dehydrogenase
1enz.1.A	20.00	homo-dimer	HHblits	X-ray	2.70Å	0.31	0.10	ENOYL-ACYL CARRIER PROTEIN (ACP) REDUCTASE
1j8y.1.A	16.67	monomer	HHblits	X-ray	2.00Å	0.29	0.10	SIGNAL RECOGNITION 54 KDA PROTEIN
2xx3.1.A	16.67	homo-dimer	HHblits	X-ray	2.00Å	0.29	0.10	THYMIDYLATE KINASE
1kht.1.A	13.89	homo-trimer	HHblits	X-ray	2.50Å	0.29	0.10	adenylate kinase
1kht.1.B	13.89	homo-trimer	HHblits	X-ray	2.50Å	0.29	0.10	adenylate kinase
1kht.1.C	13.89	homo-trimer	HHblits	X-ray	2.50Å	0.29	0.10	adenylate kinase
1hdo.1.A	26.47	monomer	HHblits	X-ray	1.15Å	0.33	0.10	BILIVERDIN IX BETA REDUCTASE
1np6.1.A	22.86	homo-dimer	HHblits	X-ray	1.90Å	0.31	0.10	Molybdopterin-guanine dinucleotide biosynthesis protein B
1np6.1.B	22.86	homo-dimer	HHblits	X-ray	1.90Å	0.31	0.10	Molybdopterin-guanine dinucleotide biosynthesis protein B
3adb.1.A	22.86	homo-dimer	HHblits	X-ray	2.80Å	0.31	0.10	L-seryl-tRNA(Sec) kinase
3adc.1.B	22.86	homo-dimer	HHblits	X-ray	2.90Å	0.31	0.10	L-seryl-tRNA(Sec) kinase
3adc.1.A	22.86	homo-dimer	HHblits	X-ray	2.90Å	0.31	0.10	L-seryl-tRNA(Sec) kinase
3adb.1.B	22.86	homo-dimer	HHblits	X-ray	2.80Å	0.31	0.10	L-seryl-tRNA(Sec) kinase
3add.1.B	22.86	homo-dimer	HHblits	X-ray	2.40Å	0.31	0.10	L-seryl-tRNA(Sec) kinase
5kmp.1.A	19.44	homo-dimer	HHblits	X-ray	3.20Å	0.29	0.10	FAD-dependent pyridine nucleotide-disulfide oxidoreductase
5b58.1.E	13.89	hetero-oligomer	HHblits	X-ray	3.21Å	0.29	0.10	Putative hemin transport system, substrate-binding protein
5giz.2.A	13.89	monomer	HHblits	X-ray	1.50Å	0.29	0.10	Putative hemin transport system, substrate-binding protein
5y89.2.A	13.89	monomer	HHblits	X-ray	2.40Å	0.29	0.10	Putative hemin transport system, substrate-binding protein
5y8a.2.A	13.89	monomer	HHblits	X-ray	2.00Å	0.29	0.10	Putative hemin transport system, substrate-binding protein
5y8a.1.A	13.89	monomer	HHblits	X-ray	2.00Å	0.29	0.10	Putative hemin transport system, substrate-binding protein
5gmo.1.A	23.53	monomer	HHblits	X-ray	2.30Å	0.33	0.10	Protein induced by osmotic stress
3j7a.1.C	25.71	hetero-oligomer	HHblits	EM	NA	0.31	0.10	40S ribosomal protein uS2
3jaj.45.A	19.44	monomer	HHblits	EM	NA	0.28	0.10	SRP54
3jan.45.A	19.44	monomer	HHblits	EM	NA	0.28	0.10	SRP54
5mp4.1.A	16.22	homo-tetramer	HHblits	X-ray	2.79Å	0.26	0.10	Protoplast secreted protein 2
4mie.1.A	16.22	homo-tetramer	HHblits	X-ray	2.00Å	0.26	0.10	Inositol 2-dehydrogenase/D-chiro-inositol 3-dehydrogenase
4mie.1.D	16.22	homo-tetramer	HHblits	X-ray	2.00Å	0.26	0.10	Inositol 2-dehydrogenase/D-chiro-inositol 3-dehydrogenase
4lk3.1.A	27.27	homo-hexamer	HHblits	X-ray	2.64Å	0.35	0.09	UDP-glucuronic acid decarboxylase 1
1bu5.1.A	16.67	homo-dimer	HHblits	X-ray	1.83Å	0.28	0.10	PROTEIN (FLAVODOXIN)
5b3k.1.A	16.22	monomer	HHblits	X-ray	1.70Å	0.26	0.10	Uncharacterized protein PA3435
5b3l.1.A	16.22	monomer	HHblits	X-ray	1.80Å	0.26	0.10	Uncharacterized protein PA3435
4m86.1.A	20.00	homo-tetramer	HHblits	X-ray	2.15Å	0.30	0.10	Enoyl-[acyl-carrier-protein] reductase [NADH]
3hbf.1.A	17.14	monomer	HHblits	X-ray	2.10Å	0.30	0.10	Flavonoid 3-O-glucosyltransferase
3hbj.1.A	17.14	monomer	HHblits	X-ray	2.10Å	0.30	0.10	Flavonoid 3-O-glucosyltransferase
5l3s.1.A	16.67	hetero-oligomer	HHblits	X-ray	1.90Å	0.28	0.10	Signal recognition particle 54 kDa protein
5l3s.4.A	16.67	hetero-oligomer	HHblits	X-ray	1.90Å	0.28	0.10	Signal recognition particle 54 kDa protein
5l3v.1.A	16.67	monomer	HHblits	X-ray	2.30Å	0.28	0.10	Signal recognition particle 54 kDa protein
5l3v.2.A	16.67	monomer	HHblits	X-ray	2.30Å	0.28	0.10	Signal recognition particle 54 kDa protein
4ina.1.A	14.29	homo-dimer	HHblits	X-ray	2.49Å	0.30	0.10	saccharopine dehydrogenase
1xjc.1.A	13.89	monomer	HHblits	X-ray	2.10Å	0.28	0.10	MobB protein homolog
1akq.1.A	13.51	monomer	HHblits	X-ray	1.90Å	0.26	0.10	FLAVODOXIN
3ibg.1.A	25.71	homo-dimer	HHblits	X-ray	3.20Å	0.30	0.10	ATPase, subunit of the Get complex
5u1j.1.A	19.44	homo-dimer	HHblits	X-ray	2.95Å	0.28	0.10	Uncharacterized protein
5u1j.1.B	19.44	homo-dimer	HHblits	X-ray	2.95Å	0.28	0.10	Uncharacterized protein
5u1j.2.A	19.44	homo-dimer	HHblits	X-ray	2.95Å	0.28	0.10	Uncharacterized protein
5u1j.2.B	19.44	homo-dimer	HHblits	X-ray	2.95Å	0.28	0.10	Uncharacterized protein
3h8l.1.A	20.00	homo-dimer	HHblits	X-ray	2.57Å	0.30	0.10	NADH oxidase
1ydw.1.A	19.44	homo-dimer	HHblits	X-ray	2.49Å	0.27	0.10	AX110P-like protein
2q4e.1.B	19.44	homo-dimer	HHblits	X-ray	2.49Å	0.27	0.10	Probable oxidoreductase At4g09670
3pnx.1.A	13.51	homo-trimer	HHblits	X-ray	1.92Å	0.25	0.10	Putative sulfurtransferase dsrE
1dfg.1.A	14.29	homo-tetramer	HHblits	X-ray	2.50Å	0.30	0.10	ENOYL ACYL CARRIER PROTEIN REDUCTASE
1dfi.1.A	14.29	homo-tetramer	HHblits	X-ray	2.09Å	0.30	0.10	ENOYL ACYL CARRIER PROTEIN REDUCTASE
1d8a.1.A	14.29	homo-tetramer	HHblits	X-ray	2.20Å	0.30	0.10	ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE
1mfp.1.A	14.29	homo-tetramer	HHblits	X-ray	2.33Å	0.30	0.10	enoyl-[acyl-carrier-protein] reductase [Nadh]
2fhs.1.A	14.29	hetero-oligomer	HHblits	X-ray	2.70Å	0.30	0.10	enoyl-[acyl-carrier-protein] reductase, NADH-dependent
5cfz.1.A	14.29	homo-tetramer	HHblits	X-ray	1.97Å	0.30	0.10	Enoyl-[acyl-carrier-protein] reductase [NADH] FabI
3pjf.1.A	14.29	homo-dimer	HHblits	X-ray	1.90Å	0.30	0.10	Enoyl-[acyl-carrier-protein] reductase [NADH]
3pjf.1.B	14.29	homo-dimer	HHblits	X-ray	1.90Å	0.30	0.10	Enoyl-[acyl-carrier-protein] reductase [NADH]
1qsg.1.A	14.29	homo-tetramer	HHblits	X-ray	1.75Å	0.30	0.10	ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE
2b69.1.A	31.25	homo-dimer	HHblits	X-ray	1.21Å	0.36	0.09	UDP-glucuronate decarboxylase 1
2hnb.1.A	19.44	monomer	HHblits	NMR	NA	0.27	0.10	Protein mioC
2hna.1.A	19.44	monomer	HHblits	NMR	NA	0.27	0.10	Protein mioC
3dm5.1.A	16.67	homo-tetramer	HHblits	X-ray	2.51Å	0.27	0.10	Signal recognition 54 kDa protein
2v3c.1.B	16.67	hetero-oligomer	HHblits	X-ray	2.50Å	0.27	0.10	SIGNAL RECOGNITION 54 KDA PROTEIN
2v3c.2.B	16.67	hetero-oligomer	HHblits	X-ray	2.50Å	0.27	0.10	SIGNAL RECOGNITION 54 KDA PROTEIN
5lji.1.A	7.89	monomer	HHblits	X-ray	2.07Å	0.23	0.11	Flavodoxin
5khl.1.A	13.51	monomer	HHblits	X-ray	2.40Å	0.25	0.10	Hemin ABC transporter, periplasmic hemin-binding protein HutB
1u7t.1.A	24.24	homo-tetramer	HHblits	X-ray	2.00Å	0.34	0.09	3-hydroxyacyl-CoA dehydrogenase type II
4dqu.1.A	20.59	homo-tetramer	HHblits	X-ray	2.45Å	0.32	0.10	Enoyl-[acyl-carrier-protein] reductase [NADH]
2aqi.1.A	20.59	homo-tetramer	HHblits	X-ray	2.20Å	0.32	0.10	Enoyl-[acyl-carrier-protein] reductase [NADH]
4dti.1.A	20.59	homo-tetramer	HHblits	X-ray	1.90Å	0.32	0.10	Enoyl-[acyl-carrier-protein] reductase [NADH]
4bge.1.D	20.59	homo-tetramer	HHblits	X-ray	2.25Å	0.32	0.10	ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
3oey.1.A	20.59	homo-tetramer	HHblits	X-ray	2.00Å	0.32	0.10	Enoyl-[acyl-carrier-protein] reductase [NADH]
2ie0.1.A	23.53	homo-tetramer	HHblits	X-ray	2.20Å	0.32	0.10	Enoyl-[acyl-carrier-protein] reductase [NADH]
2w58.1.A	11.11	homo-dimer	HHblits	X-ray	2.50Å	0.27	0.10	PRIMOSOME COMPONENT (HELICASE LOADER)
2w58.1.B	11.11	homo-dimer	HHblits	X-ray	2.50Å	0.27	0.10	PRIMOSOME COMPONENT (HELICASE LOADER)
5ljl.1.A	8.11	monomer	HHblits	X-ray	1.60Å	0.25	0.10	Flavodoxin
1e6w.1.A	27.27	homo-tetramer	HHblits	X-ray	1.70Å	0.34	0.09	SHORT CHAIN 3-HYDROXYACYL-COA DEHYDROGENASE
3of2.1.A	20.59	homo-tetramer	HHblits	X-ray	2.00Å	0.31	0.10	Enoyl-[acyl-carrier-protein] reductase [NADH]
5cpf.1.C	20.59	homo-tetramer	HHblits	X-ray	3.41Å	0.31	0.10	Enoyl-[acyl-carrier-protein] reductase [NADH]
5cpf.1.D	20.59	homo-tetramer	HHblits	X-ray	3.41Å	0.31	0.10	Enoyl-[acyl-carrier-protein] reductase [NADH]
2ieb.1.A	20.59	homo-tetramer	HHblits	X-ray	2.20Å	0.31	0.10	Enoyl-[acyl-carrier-protein] reductase [NADH]
2ied.1.A	20.59	homo-tetramer	HHblits	X-ray	2.14Å	0.31	0.10	Enoyl-[acyl-carrier-protein] reductase [NADH]
2ied.1.B	20.59	homo-tetramer	HHblits	X-ray	2.14Å	0.31	0.10	Enoyl-[acyl-carrier-protein] reductase [NADH]
2ied.1.C	20.59	homo-tetramer	HHblits	X-ray	2.14Å	0.31	0.10	Enoyl-[acyl-carrier-protein] reductase [NADH]
2ied.1.D	20.59	homo-tetramer	HHblits	X-ray	2.14Å	0.31	0.10	Enoyl-[acyl-carrier-protein] reductase [NADH]
2pr2.1.A	20.59	homo-tetramer	HHblits	X-ray	2.50Å	0.31	0.10	enoyl-ACP Reductase
3fnh.1.A	20.59	homo-tetramer	HHblits	X-ray	2.80Å	0.31	0.10	Enoyl-[acyl-carrier-protein] reductase [NADH]
3fne.1.C	20.59	homo-tetramer	HHblits	X-ray	1.98Å	0.31	0.10	Enoyl-[acyl-carrier-protein] reductase [NADH]
2x23.1.A	20.59	homo-tetramer	HHblits	X-ray	1.81Å	0.31	0.10	ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
2x22.1.A	20.59	homo-tetramer	HHblits	X-ray	2.10Å	0.31	0.10	ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
2nsd.1.A	20.59	monomer	HHblits	X-ray	1.90Å	0.31	0.10	Enoyl-[acyl-carrier-protein] reductase
1p45.1.A	20.59	homo-tetramer	HHblits	X-ray	2.60Å	0.31	0.10	Enoyl-[acyl-carrier-protein] reductase [NADH]
1p45.1.B	20.59	homo-tetramer	HHblits	X-ray	2.60Å	0.31	0.10	Enoyl-[acyl-carrier-protein] reductase [NADH]
1p44.1.A	20.59	homo-tetramer	HHblits	X-ray	2.70Å	0.31	0.10	Enoyl-[acyl-carrier-protein] reductase [NADH]
1p44.2.B	20.59	homo-tetramer	HHblits	X-ray	2.70Å	0.31	0.10	Enoyl-[acyl-carrier-protein] reductase [NADH]
1p44.2.C	20.59	homo-tetramer	HHblits	X-ray	2.70Å	0.31	0.10	Enoyl-[acyl-carrier-protein] reductase [NADH]
2b37.2.B	20.59	homo-tetramer	HHblits	X-ray	2.60Å	0.31	0.10	Enoyl-[acyl-carrier-protein] reductase [NADH]
4cod.1.C	20.59	homo-tetramer	HHblits	X-ray	2.40Å	0.31	0.10	ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
4qxm.1.B	20.59	homo-tetramer	HHblits	X-ray	2.20Å	0.31	0.10	Enoyl-[acyl-carrier-protein] reductase [NADH]
3orf.1.A	17.65	homo-dimer	HHblits	X-ray	2.16Å	0.31	0.10	Dihydropteridine reductase
3orf.2.A	17.65	homo-dimer	HHblits	X-ray	2.16Å	0.31	0.10	Dihydropteridine reductase
1zwk.1.A	7.89	homo-tetramer	HHblits	X-ray	2.60Å	0.23	0.11	Trp repressor binding protein WrbA
5gj3.1.A	11.11	monomer	HHblits	X-ray	2.00Å	0.27	0.10	Periplasmic binding protein
5y8b.1.A	11.11	monomer	HHblits	X-ray	2.40Å	0.27	0.10	Periplasmic binding protein
4cv2.1.A	14.29	homo-tetramer	HHblits	X-ray	1.80Å	0.29	0.10	ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
3pjd.1.A	14.29	homo-dimer	HHblits	X-ray	2.50Å	0.29	0.10	Enoyl-[acyl-carrier-protein] reductase [NADH]
1bvr.1.A	20.59	homo-tetramer	HHblits	X-ray	2.80Å	0.31	0.10	PROTEIN (ENOYL-ACYL CARRIER PROTEIN (ACP) REDUCTASE)
1bvr.1.C	20.59	homo-tetramer	HHblits	X-ray	2.80Å	0.31	0.10	PROTEIN (ENOYL-ACYL CARRIER PROTEIN (ACP) REDUCTASE)
2idz.1.A	20.59	homo-tetramer	HHblits	X-ray	2.00Å	0.31	0.10	Enoyl-[acyl-carrier-protein] reductase [NADH]
2jjy.1.B	17.14	homo-tetramer	HHblits	X-ray	2.90Å	0.29	0.10	ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE
2jjy.1.A	17.14	homo-tetramer	HHblits	X-ray	2.90Å	0.29	0.10	ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE
4eit.1.A	17.14	homo-tetramer	HHblits	X-ray	2.40Å	0.29	0.10	Enoyl-[acyl-carrier-protein] reductase [NADH]
3uic.4.A	17.14	homo-tetramer	HHblits	X-ray	2.50Å	0.29	0.10	Enoyl-[acyl-carrier-protein] reductase [NADH]
3aeu.1.B	21.21	hetero-oligomer	HHblits	X-ray	2.90Å	0.33	0.09	Light-independent protochlorophyllide reductase subunit B
3aet.1.B	21.21	hetero-oligomer	HHblits	X-ray	2.91Å	0.33	0.09	Light-independent protochlorophyllide reductase subunit B
4gll.1.A	24.24	homo-dimer	HHblits	X-ray	2.50Å	0.33	0.09	UDP-glucuronic acid decarboxylase 1
4gll.1.B	24.24	homo-dimer	HHblits	X-ray	2.50Å	0.33	0.09	UDP-glucuronic acid decarboxylase 1
2o23.1.A	24.24	homo-tetramer	HHblits	X-ray	1.20Å	0.33	0.09	HADH2 protein
2aqh.1.A	23.53	homo-tetramer	HHblits	X-ray	2.01Å	0.31	0.10	Enoyl-[acyl-carrier-protein] reductase [NADH]
5tf4.1.A	17.14	homo-tetramer	HHblits	X-ray	1.95Å	0.29	0.10	Enoyl-[acyl-carrier-protein] reductase [NADH]
5tf4.2.B	17.14	homo-tetramer	HHblits	X-ray	1.95Å	0.29	0.10	Enoyl-[acyl-carrier-protein] reductase [NADH]
4rlh.1.A	14.29	homo-tetramer	HHblits	X-ray	2.26Å	0.29	0.10	Enoyl-[acyl-carrier-protein] reductase [NADH]
5i9m.2.D	14.29	homo-tetramer	HHblits	X-ray	2.25Å	0.29	0.10	Enoyl-[acyl-carrier-protein] reductase [NADH]
4bku.1.C	14.29	homo-tetramer	HHblits	X-ray	1.84Å	0.29	0.10	ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
5i8w.1.C	14.29	homo-tetramer	HHblits	X-ray	1.63Å	0.29	0.10	Enoyl-[acyl-carrier-protein] reductase [NADH]
4bmn.1.A	18.18	homo-tetramer	HHblits	X-ray	1.50Å	0.33	0.09	ALCLOHOL DEHYDROGENASE/SHORT-CHAIN DEHYDROGENASE
1ps9.1.A	21.21	monomer	HHblits	X-ray	2.20Å	0.33	0.09	2,4-dienoyl-CoA reductase
4m55.1.A	24.24	homo-hexamer	HHblits	X-ray	2.86Å	0.33	0.09	UDP-glucuronic acid decarboxylase 1
4m55.1.D	24.24	homo-hexamer	HHblits	X-ray	2.86Å	0.33	0.09	UDP-glucuronic acid decarboxylase 1
1zid.1.A	20.59	homo-tetramer	HHblits	X-ray	2.70Å	0.31	0.10	ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE
2ntj.1.B	20.59	homo-tetramer	HHblits	X-ray	2.50Å	0.31	0.10	Enoyl-[acyl-carrier-protein] reductase [NADH
4d0r.1.A	17.65	homo-tetramer	HHblits	X-ray	2.75Å	0.31	0.10	ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
1mrn.1.A	16.67	homo-dimer	HHblits	X-ray	2.45Å	0.26	0.10	Thymidylate Kinase
1w2h.1.A	16.67	homo-dimer	HHblits	X-ray	2.00Å	0.26	0.10	THYMIDYLATE KINASE TMK
2p91.1.A	8.57	homo-tetramer	HHblits	X-ray	2.00Å	0.28	0.10	Enoyl-[acyl-carrier-protein] reductase [NADH]
2p91.1.D	8.57	homo-tetramer	HHblits	X-ray	2.00Å	0.28	0.10	Enoyl-[acyl-carrier-protein] reductase [NADH]
2pd3.1.A	11.43	homo-tetramer	HHblits	X-ray	2.50Å	0.28	0.10	Enoyl-[acyl-carrier-protein] reductase [NADH]
3fni.1.A	7.89	monomer	HHblits	X-ray	2.30Å	0.22	0.11	Putative diflavin flavoprotein A 3
5wqn.1.A	18.18	homo-dimer	HHblits	X-ray	2.00Å	0.33	0.09	Probable dehydrogenase
5wqn.1.B	18.18	homo-dimer	HHblits	X-ray	2.00Å	0.33	0.09	Probable dehydrogenase
5wqn.2.B	18.18	homo-dimer	HHblits	X-ray	2.00Å	0.33	0.09	Probable dehydrogenase
4pn3.1.A	18.18	homo-tetramer	HHblits	X-ray	2.15Å	0.33	0.09	3-hydroxyacyl-CoA dehydrogenase
4o5o.1.A	18.18	homo-tetramer	HHblits	X-ray	1.40Å	0.33	0.09	3-hydroxyacyl-CoA dehydrogenase
4o5o.1.B	18.18	homo-tetramer	HHblits	X-ray	1.40Å	0.33	0.09	3-hydroxyacyl-CoA dehydrogenase
4h6p.1.A	11.11	homo-tetramer	HHblits	X-ray	2.56Å	0.26	0.10	Chromate reductase
4h6p.4.C	11.11	homo-tetramer	HHblits	X-ray	2.56Å	0.26	0.10	Chromate reductase
2pq6.1.A	20.00	monomer	HHblits	X-ray	2.10Å	0.28	0.10	UDP-glucuronosyl/UDP-glucosyltransferase
4m4w.1.J	11.43	hetero-oligomer	HHblits	X-ray	6.10Å	0.28	0.10	Primosomal protein DnaI
4m4w.1.K	11.43	hetero-oligomer	HHblits	X-ray	6.10Å	0.28	0.10	Primosomal protein DnaI
4m4w.1.L	11.43	hetero-oligomer	HHblits	X-ray	6.10Å	0.28	0.10	Primosomal protein DnaI
4m4w.1.M	11.43	hetero-oligomer	HHblits	X-ray	6.10Å	0.28	0.10	Primosomal protein DnaI
4m4w.1.N	11.43	hetero-oligomer	HHblits	X-ray	6.10Å	0.28	0.10	Primosomal protein DnaI
4m4w.1.O	11.43	hetero-oligomer	HHblits	X-ray	6.10Å	0.28	0.10	Primosomal protein DnaI
4rl6.1.A	8.57	homo-dimer	HHblits	X-ray	2.79Å	0.28	0.10	Saccharopine dehydrogenase
4rl6.1.B	8.57	homo-dimer	HHblits	X-ray	2.79Å	0.28	0.10	Saccharopine dehydrogenase
4gmd.1.B	13.89	homo-dimer	HHblits	X-ray	1.98Å	0.26	0.10	Thymidylate kinase
4gmd.1.A	13.89	homo-dimer	HHblits	X-ray	1.98Å	0.26	0.10	Thymidylate kinase
4edh.1.A	13.89	homo-dimer	HHblits	X-ray	1.32Å	0.26	0.10	Thymidylate kinase
4e5u.1.A	13.89	homo-dimer	HHblits	X-ray	1.81Å	0.26	0.10	Thymidylate kinase
4e5u.1.B	13.89	homo-dimer	HHblits	X-ray	1.81Å	0.26	0.10	Thymidylate kinase
3md9.1.A	13.89	monomer	HHblits	X-ray	1.50Å	0.26	0.10	Hemin-binding periplasmic protein hmuT
3md9.2.A	13.89	monomer	HHblits	X-ray	1.50Å	0.26	0.10	Hemin-binding periplasmic protein hmuT
3h86.2.A	17.65	homo-trimer	HHblits	X-ray	2.50Å	0.30	0.10	Adenylate kinase
3h86.1.B	17.65	homo-trimer	HHblits	X-ray	2.50Å	0.30	0.10	Adenylate kinase
3h86.1.C	17.65	homo-trimer	HHblits	X-ray	2.50Å	0.30	0.10	Adenylate kinase
3h86.1.A	17.65	homo-trimer	HHblits	X-ray	2.50Å	0.30	0.10	Adenylate kinase
2c20.1.A	15.15	homo-dimer	HHblits	X-ray	2.70Å	0.33	0.09	UDP-GLUCOSE 4-EPIMERASE
3k2e.1.A	14.29	homo-tetramer	HHblits	X-ray	1.90Å	0.28	0.10	Enoyl-(Acyl-carrier-protein) reductase
5veg.1.A	8.11	monomer	HHblits	X-ray	1.99Å	0.23	0.10	Flavodoxin
5veg.2.A	8.11	monomer	HHblits	X-ray	1.99Å	0.23	0.10	Flavodoxin
4i5d.1.A	18.18	homo-tetramer	HHblits	X-ray	2.40Å	0.32	0.09	Alclohol dehydrogenase/short-chain dehydrogenase
1hxh.1.A	21.21	homo-tetramer	HHblits	X-ray	1.22Å	0.32	0.09	3BETA/17BETA-HYDROXYSTEROID DEHYDROGENASE
4nqz.1.A	8.57	homo-tetramer	HHblits	X-ray	2.60Å	0.28	0.10	Enoyl-[acyl-carrier-protein] reductase [NADH] FabI
4nr0.1.A	8.57	homo-tetramer	HHblits	X-ray	1.80Å	0.28	0.10	Enoyl-[acyl-carrier-protein] reductase [NADH] FabI
2r3e.1.A	14.29	homo-tetramer	HHblits	X-ray	1.95Å	0.28	0.10	YjeF-related protein
3nu1.1.A	13.89	monomer	HHblits	X-ray	2.50Å	0.25	0.10	Hemin-binding periplasmic protein
4jqc.1.B	14.71	homo-dimer	HHblits	X-ray	2.80Å	0.30	0.10	Enoyl-[acyl-carrier-protein] reductase [NADH] FabI
4jqc.1.A	14.71	homo-dimer	HHblits	X-ray	2.80Å	0.30	0.10	Enoyl-[acyl-carrier-protein] reductase [NADH] FabI
2ntv.1.A	17.65	homo-tetramer	HHblits	X-ray	2.10Å	0.30	0.10	Enoyl-[ACP] reductase
2ntv.1.B	17.65	homo-tetramer	HHblits	X-ray	2.10Å	0.30	0.10	Enoyl-[ACP] reductase
2wwv.1.D	5.41	hetero-oligomer	HHblits	NMR	NA	0.23	0.10	N\,N'-DIACETYLCHITOBIOSE-SPECIFIC PHOSPHOTRANSFERASE ENZYME IIB COMPONENT
1iib.1.A	5.41	monomer	HHblits	X-ray	1.80Å	0.23	0.10	ENZYME IIB OF THE CELLOBIOSE-SPECIFIC PHOSPHOTRANSFERASE SYSTEM
1e2b.1.A	5.41	monomer	HHblits	NMR	NA	0.23	0.10	ENZYME IIB-CELLOBIOSE
5je8.1.B	28.13	homo-dimer	HHblits	X-ray	2.10Å	0.34	0.09	3-hydroxyisobutyrate dehydrogenase
5je8.1.A	28.13	homo-dimer	HHblits	X-ray	2.10Å	0.34	0.09	3-hydroxyisobutyrate dehydrogenase
3pje.1.A	14.71	homo-dimer	HHblits	X-ray	2.50Å	0.30	0.10	Enoyl-[acyl-carrier-protein] reductase [NADH]
4r9r.1.A	21.21	homo-tetramer	HHblits	X-ray	2.90Å	0.32	0.09	Enoyl-[acyl-carrier-protein] reductase [NADH]
3oif.1.A	8.57	homo-tetramer	HHblits	X-ray	2.60Å	0.27	0.10	Enoyl-[acyl-carrier-protein] reductase [NADH]
3oig.1.A	8.57	homo-tetramer	HHblits	X-ray	1.25Å	0.27	0.10	Enoyl-[acyl-carrier-protein] reductase [NADH]
5koi.1.B	11.43	homo-dimer	HHblits	X-ray	1.70Å	0.27	0.10	Enoyl-[acyl-carrier-protein] reductase [NADH]
5koi.1.A	11.43	homo-dimer	HHblits	X-ray	1.70Å	0.27	0.10	Enoyl-[acyl-carrier-protein] reductase [NADH]
5koi.4.A	11.43	homo-dimer	HHblits	X-ray	1.70Å	0.27	0.10	Enoyl-[acyl-carrier-protein] reductase [NADH]
3nbm.1.A	5.56	monomer	HHblits	X-ray	1.30Å	0.25	0.10	PTS system, lactose-specific IIBC components
2a5l.1.A	13.89	homo-dimer	HHblits	X-ray	1.70Å	0.25	0.10	Trp repressor binding protein WrbA
1mio.1.B	34.38	hetero-oligomer	HHblits	X-ray	3.00Å	0.34	0.09	NITROGENASE MOLYBDENUM IRON PROTEIN (BETA CHAIN)
1mio.1.D	34.38	hetero-oligomer	HHblits	X-ray	3.00Å	0.34	0.09	NITROGENASE MOLYBDENUM IRON PROTEIN (BETA CHAIN)
4wn9.1.B	34.38	hetero-oligomer	HHblits	X-ray	1.90Å	0.34	0.09	Nitrogenase molybdenum-iron protein beta chain
1e3w.1.A	28.13	hetero-oligomer	HHblits	X-ray	2.00Å	0.34	0.09	SHORT CHAIN 3-HYDROXYACYL-COA DEHYDROGENASE
2acv.1.A	20.59	homo-dimer	HHblits	X-ray	2.00Å	0.29	0.10	triterpene UDP-glucosyl transferase UGT71G1
2acv.1.B	20.59	homo-dimer	HHblits	X-ray	2.00Å	0.29	0.10	triterpene UDP-glucosyl transferase UGT71G1
2acw.1.A	20.59	homo-dimer	HHblits	X-ray	2.60Å	0.29	0.10	triterpene UDP-glucosyl transferase UGT71G1
2acw.1.B	20.59	homo-dimer	HHblits	X-ray	2.60Å	0.29	0.10	triterpene UDP-glucosyl transferase UGT71G1
5coq.1.A	21.21	homo-tetramer	HHblits	X-ray	2.30Å	0.32	0.09	Enoyl-[acyl-carrier-protein] reductase [NADH]
4bgi.1.A	21.21	homo-tetramer	HHblits	X-ray	2.09Å	0.32	0.09	ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
2zki.1.A	17.14	homo-tetramer	HHblits	X-ray	2.90Å	0.27	0.10	199aa long hypothetical Trp repressor binding protein
2zki.3.A	17.14	homo-tetramer	HHblits	X-ray	2.90Å	0.27	0.10	199aa long hypothetical Trp repressor binding protein
2rg7.1.B	8.33	homo-dimer	HHblits	X-ray	2.05Å	0.25	0.10	Periplasmic HEME binding protein
2rg7.1.A	8.33	homo-dimer	HHblits	X-ray	2.05Å	0.25	0.10	Periplasmic HEME binding protein
2r7a.2.B	8.33	homo-dimer	HHblits	X-ray	2.05Å	0.25	0.10	Bacterial heme binding protein
4rie.1.A	23.53	homo-dimer	HHblits	X-ray	2.16Å	0.29	0.10	Glycosyl transferase homolog
4rie.1.B	23.53	homo-dimer	HHblits	X-ray	2.16Å	0.29	0.10	Glycosyl transferase homolog
4rif.1.A	23.53	homo-dimer	HHblits	X-ray	1.85Å	0.29	0.10	Glycosyl transferase homolog
4rif.1.B	23.53	homo-dimer	HHblits	X-ray	1.85Å	0.29	0.10	Glycosyl transferase homolog
4o6v.1.A	18.18	homo-tetramer	HHblits	X-ray	1.85Å	0.32	0.09	Oxidoreductase, short-chain dehydrogenase/reductase family
3gnt.1.A	8.57	homo-tetramer	HHblits	X-ray	2.75Å	0.27	0.10	Enoyl-[acyl-carrier-protein] reductase [NADH]
3gnt.1.B	8.57	homo-tetramer	HHblits	X-ray	2.75Å	0.27	0.10	Enoyl-[acyl-carrier-protein] reductase [NADH]
4alj.1.A	8.57	homo-tetramer	HHblits	X-ray	2.20Å	0.27	0.10	ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADPH]
4alm.1.B	8.57	homo-tetramer	HHblits	X-ray	2.45Å	0.27	0.10	ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADPH]
4alm.1.C	8.57	homo-tetramer	HHblits	X-ray	2.45Å	0.27	0.10	ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADPH]
4alm.1.D	8.57	homo-tetramer	HHblits	X-ray	2.45Å	0.27	0.10	ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADPH]
4alm.1.A	8.57	homo-tetramer	HHblits	X-ray	2.45Å	0.27	0.10	ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADPH]
4aln.1.A	8.57	homo-tetramer	HHblits	X-ray	3.05Å	0.27	0.10	ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADPH]
4aln.1.C	8.57	homo-tetramer	HHblits	X-ray	3.05Å	0.27	0.10	ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADPH]
4cv1.1.D	8.57	homo-tetramer	HHblits	X-ray	1.95Å	0.27	0.10	ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
4nz9.1.A	8.57	homo-dimer	HHblits	X-ray	2.30Å	0.27	0.10	Enoyl-[acyl-carrier-protein] reductase [NADPH]
3gns.1.A	8.57	homo-tetramer	HHblits	X-ray	2.71Å	0.27	0.10	Enoyl-[acyl-carrier-protein] reductase [NADH]
3gr6.1.A	8.57	homo-tetramer	HHblits	X-ray	2.28Å	0.27	0.10	Enoyl-[acyl-carrier-protein] reductase [NADH]
4fs3.1.A	8.57	homo-tetramer	HHblits	X-ray	1.80Å	0.27	0.10	Enoyl-[acyl-carrier-protein] reductase [NADPH] FabI
2c1x.1.A	17.65	monomer	HHblits	X-ray	1.90Å	0.29	0.10	UDP-GLUCOSE FLAVONOID 3-O GLYCOSYLTRANSFERASE
3gaf.1.A	18.18	homo-tetramer	HHblits	X-ray	2.20Å	0.31	0.09	7-ALPHA-HYDROXYSTEROID DEHYDROGENASE
2qio.1.A	5.71	homo-tetramer	HHblits	X-ray	2.44Å	0.27	0.10	Enoyl-(Acyl-carrier-protein) reductase
2qio.1.C	5.71	homo-tetramer	HHblits	X-ray	2.44Å	0.27	0.10	Enoyl-(Acyl-carrier-protein) reductase
3oje.1.A	5.71	homo-dimer	HHblits	X-ray	3.02Å	0.27	0.10	Enoyl-[acyl-carrier-protein] reductase (FabL) (NADPH)
3ojf.1.A	5.71	homo-tetramer	HHblits	X-ray	2.20Å	0.27	0.10	Enoyl-[acyl-carrier-protein] reductase (FabL) (NADPH)
3ojf.1.B	5.71	homo-tetramer	HHblits	X-ray	2.20Å	0.27	0.10	Enoyl-[acyl-carrier-protein] reductase (FabL) (NADPH)
3ojf.1.C	5.71	homo-tetramer	HHblits	X-ray	2.20Å	0.27	0.10	Enoyl-[acyl-carrier-protein] reductase (FabL) (NADPH)
3ojf.1.D	5.71	homo-tetramer	HHblits	X-ray	2.20Å	0.27	0.10	Enoyl-[acyl-carrier-protein] reductase (FabL) (NADPH)
4unq.1.A	17.14	monomer	HHblits	X-ray	2.30Å	0.27	0.10	THYMIDYLATE KINASE
4unq.2.A	17.14	monomer	HHblits	X-ray	2.30Å	0.27	0.10	THYMIDYLATE KINASE
4unp.1.A	17.14	monomer	HHblits	X-ray	2.30Å	0.27	0.10	THYMIDYLATE KINASE
2ph3.1.A	14.71	homo-tetramer	HHblits	X-ray	1.91Å	0.29	0.10	3-oxoacyl-[acyl carrier protein] reductase
2ph3.1.B	14.71	homo-tetramer	HHblits	X-ray	1.91Å	0.29	0.10	3-oxoacyl-[acyl carrier protein] reductase
4ohu.1.C	21.21	homo-tetramer	HHblits	X-ray	1.60Å	0.31	0.09	Enoyl-[acyl-carrier-protein] reductase [NADH]
4oim.1.A	21.21	homo-tetramer	HHblits	X-ray	1.85Å	0.31	0.09	Enoyl-[acyl-carrier-protein] reductase [NADH]
5mtr.1.B	21.21	homo-tetramer	HHblits	X-ray	2.00Å	0.31	0.09	Enoyl-[acyl-carrier-protein] reductase [NADH]
4oxn.1.B	21.21	homo-tetramer	HHblits	X-ray	2.29Å	0.31	0.09	Enoyl-[acyl-carrier-protein] reductase [NADH]
5ugs.1.A	21.21	homo-tetramer	HHblits	X-ray	2.80Å	0.31	0.09	Enoyl-[acyl-carrier-protein] reductase [NADH]
2pbr.1.B	23.53	homo-dimer	HHblits	X-ray	1.96Å	0.29	0.10	Thymidylate kinase
2pbr.1.A	23.53	homo-dimer	HHblits	X-ray	1.96Å	0.29	0.10	Thymidylate kinase
4s35.1.B	23.53	homo-dimer	HHblits	X-ray	1.55Å	0.29	0.10	Thymidylate kinase
5xb2.1.B	23.53	homo-dimer	HHblits	X-ray	2.16Å	0.29	0.10	Thymidylate kinase
5xbh.1.A	23.53	homo-dimer	HHblits	X-ray	2.23Å	0.29	0.10	Thymidylate kinase
5xb5.1.A	23.53	homo-dimer	HHblits	X-ray	2.23Å	0.29	0.10	Thymidylate kinase
2ywl.1.A	24.24	homo-dimer	HHblits	X-ray	1.60Å	0.31	0.09	Thioredoxin reductase related protein
2ywl.1.B	24.24	homo-dimer	HHblits	X-ray	1.60Å	0.31	0.09	Thioredoxin reductase related protein
3ew7.1.A	29.03	monomer	HHblits	X-ray	2.73Å	0.36	0.09	Lmo0794 protein
5jc8.1.A	11.76	homo-tetramer	HHblits	X-ray	1.45Å	0.28	0.10	Putative short-chain dehydrogenase/reductase
4zcc.1.B	28.13	homo-dimer	HHblits	X-ray	2.00Å	0.33	0.09	Renalase
4zcc.1.A	28.13	homo-dimer	HHblits	X-ray	2.00Å	0.33	0.09	Renalase
4zcd.3.A	28.13	monomer	HHblits	X-ray	1.66Å	0.33	0.09	Renalase
4zcd.2.A	28.13	monomer	HHblits	X-ray	1.66Å	0.33	0.09	Renalase
3nt6.1.A	27.27	homo-dimer	HHblits	X-ray	2.00Å	0.31	0.09	FAD-dependent pyridine nucleotide-disulphide oxidoreductase
5guy.1.A	17.65	monomer	HHblits	X-ray	2.40Å	0.28	0.10	Uncharacterized protein chuY
4bms.1.A	18.75	homo-tetramer	HHblits	X-ray	2.89Å	0.33	0.09	ALCLOHOL DEHYDROGENASE/SHORT-CHAIN DEHYDROGENASE
4j7c.1.A	25.00	hetero-oligomer	HHblits	X-ray	3.50Å	0.33	0.09	Ktr system potassium uptake protein A
3g5q.1.A	21.21	monomer	HHblits	X-ray	2.10Å	0.31	0.09	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase trmFO
3g5s.1.A	21.21	monomer	HHblits	X-ray	1.05Å	0.31	0.09	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase trmFO
3g5r.1.A	21.21	monomer	HHblits	X-ray	1.60Å	0.31	0.09	Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase trmFO
1uzl.1.A	15.15	homo-tetramer	HHblits	X-ray	2.00Å	0.31	0.09	3-OXOACYL-[ACYL-CARRIER PROTEIN] REDUCTASE
2yof.1.A	17.65	monomer	HHblits	X-ray	1.82Å	0.28	0.10	THYMIDYLATE KINASE
2yof.3.A	17.65	monomer	HHblits	X-ray	1.82Å	0.28	0.10	THYMIDYLATE KINASE
2yog.1.A	17.65	monomer	HHblits	X-ray	1.50Å	0.28	0.10	THYMIDYLATE KINASE
2yog.2.A	17.65	monomer	HHblits	X-ray	1.50Å	0.28	0.10	THYMIDYLATE KINASE
3uxm.1.A	14.29	monomer	HHblits	X-ray	1.95Å	0.26	0.10	Thymidylate kinase
3uxm.2.A	14.29	monomer	HHblits	X-ray	1.95Å	0.26	0.10	Thymidylate kinase
1bdb.1.A	15.63	homo-tetramer	HHblits	X-ray	2.00Å	0.33	0.09	CIS-BIPHENYL-2,3-DIHYDRODIOL-2,3-DEHYDROGENASE
4zju.1.A	8.82	homo-tetramer	HHblits	X-ray	1.20Å	0.28	0.10	Enoyl-[acyl-carrier-protein] reductase [NADH]
4ni5.1.A	12.12	homo-tetramer	HHblits	X-ray	1.70Å	0.30	0.09	Oxidoreductase, short-chain dehydrogenase/reductase family protein
4i5g.1.A	18.75	homo-tetramer	HHblits	X-ray	2.30Å	0.33	0.09	Alclohol dehydrogenase/short-chain dehydrogenase
4i5f.1.A	18.75	homo-tetramer	HHblits	X-ray	2.10Å	0.33	0.09	Alclohol dehydrogenase/short-chain dehydrogenase
1so8.1.A	21.88	homo-tetramer	HHblits	X-ray	2.30Å	0.33	0.09	3-hydroxyacyl-CoA dehydrogenase type II
1wnt.1.A	12.50	homo-tetramer	HHblits	X-ray	2.30Å	0.32	0.09	L-xylulose reductase
3asv.1.A	18.75	homo-tetramer	HHblits	X-ray	2.70Å	0.32	0.09	Short-chain dehydrogenase/reductase SDR
4fgs.1.A	18.75	homo-tetramer	HHblits	X-ray	1.76Å	0.32	0.09	Probable dehydrogenase protein
3pdu.1.A	21.88	homo-tetramer	HHblits	X-ray	1.89Å	0.32	0.09	3-hydroxyisobutyrate dehydrogenase family protein
3vc7.1.A	25.00	homo-dimer	HHblits	X-ray	2.23Å	0.32	0.09	Putative oxidoreductase
4eso.1.A	25.00	homo-tetramer	HHblits	X-ray	1.91Å	0.32	0.09	Putative oxidoreductase
4eso.1.C	25.00	homo-tetramer	HHblits	X-ray	1.91Å	0.32	0.09	Putative oxidoreductase
3e8x.1.A	18.75	homo-dimer	HHblits	X-ray	2.10Å	0.32	0.09	Putative NAD-dependent epimerase/dehydratase
1x1e.1.A	18.75	homo-tetramer	HHblits	X-ray	1.76Å	0.32	0.09	2-deoxy-D-gluconate 3-dehydrogenase
3grk.1.A	11.76	homo-tetramer	HHblits	X-ray	2.35Å	0.27	0.10	Enoyl-(acyl-carrier-protein) reductase (NADH)
4mo2.1.A	25.00	homo-dimer	HHblits	X-ray	2.00Å	0.32	0.09	UDP-galactopyranose mutase
1zk4.1.A	18.75	homo-tetramer	HHblits	X-ray	1.00Å	0.32	0.09	R-specific alcohol dehydrogenase
1uls.1.A	9.09	homo-tetramer	HHblits	X-ray	2.40Å	0.29	0.09	putative 3-oxoacyl-acyl carrier protein reductase
3grp.1.A	25.00	homo-tetramer	HHblits	X-ray	2.09Å	0.32	0.09	3-oxoacyl-(Acyl carrierprotein) reductase
3grp.1.B	25.00	homo-tetramer	HHblits	X-ray	2.09Å	0.32	0.09	3-oxoacyl-(Acyl carrierprotein) reductase
3q2o.1.A	21.88	homo-dimer	HHblits	X-ray	1.96Å	0.32	0.09	Phosphoribosylaminoimidazole carboxylase, ATPase subunit
3q2o.1.B	21.88	homo-dimer	HHblits	X-ray	1.96Å	0.32	0.09	Phosphoribosylaminoimidazole carboxylase, ATPase subunit
2q0k.1.A	31.25	homo-dimer	HHblits	X-ray	1.70Å	0.32	0.09	Thioredoxin reductase
2q0k.1.B	31.25	homo-dimer	HHblits	X-ray	1.70Å	0.32	0.09	Thioredoxin reductase
3ish.1.B	31.25	homo-dimer	HHblits	X-ray	2.43Å	0.32	0.09	Thioredoxin reductase
5er6.1.A	18.75	homo-tetramer	HHblits	X-ray	1.55Å	0.32	0.09	Oxidoreductase, short chain dehydrogenase/reductase family
4om8.1.A	21.88	homo-dimer	HHblits	X-ray	1.55Å	0.32	0.09	3-hydroxybutyryl-coA dehydrogenase
3l6e.1.A	21.88	homo-dimer	HHblits	X-ray	2.30Å	0.32	0.09	Oxidoreductase, short-chain dehydrogenase/reductase family
3l6e.1.B	21.88	homo-dimer	HHblits	X-ray	2.30Å	0.32	0.09	Oxidoreductase, short-chain dehydrogenase/reductase family
1zmo.1.A	11.76	homo-tetramer	HHblits	X-ray	2.00Å	0.27	0.10	halohydrin dehalogenase
4oyh.1.A	14.71	homo-dimer	HHblits	X-ray	2.41Å	0.27	0.10	Molybdopterin-guanine dinucleotide biosynthesis protein B
4oyh.2.A	14.71	homo-dimer	HHblits	X-ray	2.41Å	0.27	0.10	Molybdopterin-guanine dinucleotide biosynthesis protein B
4oyh.2.B	14.71	homo-dimer	HHblits	X-ray	2.41Å	0.27	0.10	Molybdopterin-guanine dinucleotide biosynthesis protein B
4oyh.3.A	14.71	homo-dimer	HHblits	X-ray	2.41Å	0.27	0.10	Molybdopterin-guanine dinucleotide biosynthesis protein B
4oyh.3.B	14.71	homo-dimer	HHblits	X-ray	2.41Å	0.27	0.10	Molybdopterin-guanine dinucleotide biosynthesis protein B
4nkr.1.A	14.71	homo-dimer	HHblits	X-ray	2.41Å	0.27	0.10	Molybdopterin-guanine dinucleotide biosynthesis protein B
4nkr.2.A	14.71	homo-dimer	HHblits	X-ray	2.41Å	0.27	0.10	Molybdopterin-guanine dinucleotide biosynthesis protein B
4nkr.2.B	14.71	homo-dimer	HHblits	X-ray	2.41Å	0.27	0.10	Molybdopterin-guanine dinucleotide biosynthesis protein B
4nkr.3.A	14.71	homo-dimer	HHblits	X-ray	2.41Å	0.27	0.10	Molybdopterin-guanine dinucleotide biosynthesis protein B
4nkr.3.B	14.71	homo-dimer	HHblits	X-ray	2.41Å	0.27	0.10	Molybdopterin-guanine dinucleotide biosynthesis protein B
3eth.1.A	18.18	homo-dimer	HHblits	X-ray	1.60Å	0.29	0.09	Phosphoribosylaminoimidazole carboxylase ATPase subunit
1b6r.1.A	18.18	homo-dimer	HHblits	X-ray	2.10Å	0.29	0.09	PROTEIN (N5-CARBOXYAMINOIMIDAZOLE RIBONUCLEOTIDE SYNTHETASE)
3etj.1.A	18.18	homo-dimer	HHblits	X-ray	1.60Å	0.29	0.09	Phosphoribosylaminoimidazole carboxylase ATPase subunit
1b6s.1.A	18.18	homo-dimer	HHblits	X-ray	2.50Å	0.29	0.09	PROTEIN (N5-CARBOXYAMINOIMIDAZOLE RIBONUCLEOTIDE SYNTHETASE)
5in4.1.A	27.27	homo-tetramer	HHblits	X-ray	1.60Å	0.29	0.09	GDP-mannose 4,6 dehydratase
4xgn.1.A	15.15	homo-tetramer	HHblits	X-ray	1.65Å	0.29	0.09	3-hydroxyacyl-CoA dehydrogenase
2yqu.1.A	18.18	homo-dimer	HHblits	X-ray	1.70Å	0.29	0.09	2-oxoglutarate dehydrogenase E3 component
2eq7.1.A	18.18	hetero-oligomer	HHblits	X-ray	1.80Å	0.29	0.09	2-oxoglutarate dehydrogenase E3 component
4dqx.1.A	15.15	homo-tetramer	HHblits	X-ray	2.00Å	0.29	0.09	Probable oxidoreductase protein
4j90.1.A	25.00	homo-octamer	HHblits	X-ray	3.24Å	0.32	0.09	Ktr system potassium uptake protein A
4j91.1.A	25.00	homo-octamer	HHblits	X-ray	2.93Å	0.32	0.09	Ktr system potassium uptake protein A
4j91.1.B	25.00	homo-octamer	HHblits	X-ray	2.93Å	0.32	0.09	Ktr system potassium uptake protein A
4j91.1.C	25.00	homo-octamer	HHblits	X-ray	2.93Å	0.32	0.09	Ktr system potassium uptake protein A
4a9w.1.A	21.88	homo-dimer	HHblits	X-ray	2.72Å	0.32	0.09	MONOOXYGENASE
1xgk.1.A	28.13	monomer	HHblits	X-ray	1.40Å	0.32	0.09	NITROGEN METABOLITE REPRESSION REGULATOR NMRA
4all.1.A	8.82	homo-tetramer	HHblits	X-ray	2.80Å	0.27	0.10	ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADPH]
4unn.1.A	17.65	monomer	HHblits	X-ray	2.50Å	0.27	0.10	THYMIDYLATE KINASE
4oqz.1.A	22.58	homo-dimer	HHblits	X-ray	1.96Å	0.34	0.09	Putative oxidoreductase YfjR
4yyz.1.A	15.63	homo-dimer	HHblits	X-ray	3.20Å	0.31	0.09	Corticosteroid 11-beta-dehydrogenase isozyme 1
4yyz.1.B	15.63	homo-dimer	HHblits	X-ray	3.20Å	0.31	0.09	Corticosteroid 11-beta-dehydrogenase isozyme 1
1uzm.1.A	15.63	homo-tetramer	HHblits	X-ray	1.49Å	0.31	0.09	3-OXOACYL-[ACYL-CARRIER PROTEIN] REDUCTASE
1uzn.1.A	15.63	homo-tetramer	HHblits	X-ray	1.91Å	0.31	0.09	3-OXOACYL-[ACYL-CARRIER PROTEIN] REDUCTASE
3r3s.1.A	18.75	homo-tetramer	HHblits	X-ray	1.25Å	0.31	0.09	oxidoreductase
5t2u.1.A	18.75	homo-tetramer	HHblits	X-ray	2.20Å	0.31	0.09	Oxidoreductase, short chain dehydrogenase/reductase family protein
5t2v.1.A	18.75	homo-tetramer	HHblits	X-ray	1.90Å	0.31	0.09	Oxidoreductase, short chain dehydrogenase/reductase family protein
2y99.1.B	15.63	homo-tetramer	HHblits	X-ray	2.50Å	0.31	0.09	CIS-2,3-DIHYDROBIPHENYL-2,3-DIOL DEHYDROGENASE
2y99.1.A	15.63	homo-tetramer	HHblits	X-ray	2.50Å	0.31	0.09	CIS-2,3-DIHYDROBIPHENYL-2,3-DIOL DEHYDROGENASE
3zv6.1.A	15.63	homo-tetramer	HHblits	X-ray	2.14Å	0.31	0.09	CIS-2,3-DIHYDROBIPHENYL-2,3-DIOL DEHYDROGENASE
4npc.1.A	12.50	homo-dimer	HHblits	X-ray	1.75Å	0.31	0.09	Sorbitol dehydrogenase
2pv7.1.A	21.88	homo-dimer	HHblits	X-ray	2.00Å	0.31	0.09	T-protein [Includes: Chorismate mutase (EC 5.4.99.5) (CM) and Prephenate dehydrogenase (EC 1.3.1.12) (PDH)]
3gdg.1.B	8.82	homo-tetramer	HHblits	X-ray	2.30Å	0.27	0.10	Probable NADP-dependent mannitol dehydrogenase
3gdg.1.A	8.82	homo-tetramer	HHblits	X-ray	2.30Å	0.27	0.10	Probable NADP-dependent mannitol dehydrogenase
3gdg.1.D	8.82	homo-tetramer	HHblits	X-ray	2.30Å	0.27	0.10	Probable NADP-dependent mannitol dehydrogenase
3gdf.1.C	8.82	homo-tetramer	HHblits	X-ray	2.50Å	0.27	0.10	Probable NADP-dependent mannitol dehydrogenase
5vj7.1.A	25.81	hetero-oligomer	HHblits	X-ray	2.55Å	0.34	0.09	Oxidoreductase
4a6n.4.A	25.81	monomer	HHblits	X-ray	2.30Å	0.34	0.09	TETX2 PROTEIN
2xdo.1.A	25.81	monomer	HHblits	X-ray	2.09Å	0.34	0.09	TETX2 PROTEIN
5jca.1.A	25.81	hetero-oligomer	HHblits	X-ray	1.50Å	0.34	0.09	NADH-dependent Ferredoxin:NADP Oxidoreductase (NfnI) subunit alpha
2ntn.1.A	15.63	homo-tetramer	HHblits	X-ray	2.30Å	0.31	0.09	3-oxoacyl-[acyl-carrier-protein] reductase
3geg.1.A	21.88	homo-tetramer	HHblits	X-ray	2.10Å	0.31	0.09	Short-chain dehydrogenase/reductase SDR
1cyd.1.A	12.50	homo-tetramer	HHblits	X-ray	1.80Å	0.31	0.09	CARBONYL REDUCTASE
3f1k.1.A	18.75	homo-dimer	HHblits	X-ray	2.60Å	0.31	0.09	Uncharacterized oxidoreductase yciK
3f1l.1.B	18.75	homo-dimer	HHblits	X-ray	0.95Å	0.31	0.09	Uncharacterized oxidoreductase yciK
3f1l.1.A	18.75	homo-dimer	HHblits	X-ray	0.95Å	0.31	0.09	Uncharacterized oxidoreductase yciK
4dyv.1.A	21.88	homo-tetramer	HHblits	X-ray	1.80Å	0.31	0.09	Short-chain dehydrogenase/reductase SDR
3kzv.1.A	11.76	homo-tetramer	HHblits	X-ray	2.00Å	0.26	0.10	Uncharacterized oxidoreductase YIR035C
2yw9.1.A	11.76	homo-tetramer	HHblits	X-ray	2.50Å	0.26	0.10	Enoyl-[acyl carrier protein] reductase
2wyv.1.D	11.76	homo-tetramer	HHblits	X-ray	1.86Å	0.26	0.10	ENOYL-[ACYL CARRIER PROTEIN] REDUCTASE
2wyw.1.D	11.76	homo-tetramer	HHblits	X-ray	1.90Å	0.26	0.10	ENOYL-[ACYL CARRIER PROTEIN] REDUCTASE
4ywo.1.A	29.03	homo-dimer	HHblits	X-ray	1.62Å	0.34	0.09	Mercuric reductase
1vpd.1.A	25.81	monomer	HHblits	X-ray	1.65Å	0.34	0.09	TARTRONATE SEMIALDEHYDE REDUCTASE
3ezl.1.A	18.75	homo-tetramer	HHblits	X-ray	2.25Å	0.31	0.09	Acetoacetyl-CoA reductase
5itv.1.A	15.63	homo-dimer	HHblits	X-ray	2.26Å	0.31	0.09	Dihydroanticapsin 7-dehydrogenase
3v2h.1.A	18.75	homo-tetramer	HHblits	X-ray	3.00Å	0.31	0.09	D-beta-hydroxybutyrate dehydrogenase
4nk4.1.A	8.82	homo-dimer	HHblits	X-ray	1.70Å	0.26	0.10	Enoyl-[acyl-carrier-protein] reductase [NADH]
4nk5.1.A	8.82	homo-dimer	HHblits	X-ray	2.70Å	0.26	0.10	Enoyl-[acyl-carrier-protein] reductase [NADH]
3s2y.1.A	11.76	homo-tetramer	HHblits	X-ray	2.24Å	0.26	0.10	Chromate reductase
3lyu.1.A	14.71	homo-hexamer	HHblits	X-ray	2.30Å	0.26	0.10	Putative hydrogenase
3lrx.1.A	14.71	homo-hexamer	HHblits	X-ray	2.60Å	0.26	0.10	Putative hydrogenase
4qec.1.A	15.15	homo-dimer	HHblits	X-ray	1.90Å	0.28	0.09	ElxO
3l77.1.A	15.15	homo-tetramer	HHblits	X-ray	1.55Å	0.28	0.09	Short-chain alcohol dehydrogenase
1fk8.1.A	15.15	homo-dimer	HHblits	X-ray	1.95Å	0.28	0.09	3ALPHA-HYDROXYSTEROID DEHYDROGENASE/CARBONYL REDUCTASE
1fk8.1.B	15.15	homo-dimer	HHblits	X-ray	1.95Å	0.28	0.09	3ALPHA-HYDROXYSTEROID DEHYDROGENASE/CARBONYL REDUCTASE
5twb.1.A	21.21	homo-dimer	HHblits	X-ray	1.82Å	0.28	0.09	Ferredoxin--NADP reductase
5twc.1.A	21.21	homo-dimer	HHblits	X-ray	2.31Å	0.28	0.09	Ferredoxin--NADP reductase
4zrm.1.A	19.35	homo-dimer	HHblits	X-ray	1.90Å	0.33	0.09	UDP-glucose 4-epimerase
4zrn.1.A	19.35	homo-dimer	HHblits	X-ray	2.00Å	0.33	0.09	UDP-glucose 4-epimerase
5xtf.1.A	22.58	homo-tetramer	HHblits	X-ray	2.10Å	0.33	0.09	2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase
1e3s.1.A	25.81	homo-tetramer	HHblits	X-ray	2.00Å	0.33	0.09	SHORT CHAIN 3-HYDROXYACYL-COA DEHYDROGENASE
3vzp.1.A	15.63	homo-tetramer	HHblits	X-ray	1.79Å	0.31	0.09	Acetoacetyl-CoA reductase
3vzr.1.A	15.63	homo-tetramer	HHblits	X-ray	2.90Å	0.31	0.09	Acetoacetyl-CoA reductase
3vzq.1.A	15.63	homo-tetramer	HHblits	X-ray	2.00Å	0.31	0.09	Acetoacetyl-CoA reductase
3sj7.1.A	18.75	homo-tetramer	HHblits	X-ray	2.50Å	0.31	0.09	3-oxoacyl-(Acyl-carrier-protein) reductase
3sj7.1.B	18.75	homo-tetramer	HHblits	X-ray	2.50Å	0.31	0.09	3-oxoacyl-(Acyl-carrier-protein) reductase
1fcd.1.A	25.00	hetero-oligomer	HHblits	X-ray	2.53Å	0.31	0.09	FLAVOCYTOCHROME C SULFIDE DEHYDROGENASE (FLAVIN-BINDING SUBUNIT)
1fcd.2.A	25.00	hetero-oligomer	HHblits	X-ray	2.53Å	0.31	0.09	FLAVOCYTOCHROME C SULFIDE DEHYDROGENASE (FLAVIN-BINDING SUBUNIT)
3ru7.1.A	15.15	homo-dimer	HHblits	X-ray	2.60Å	0.28	0.09	WbgU
3ruh.1.A	15.15	homo-dimer	HHblits	X-ray	2.88Å	0.28	0.09	WbgU
5kmq.1.A	15.15	homo-dimer	HHblits	X-ray	2.70Å	0.28	0.09	FAD-dependent pyridine nucleotide-disulfide oxidoreductase
5if9.1.A	18.18	monomer	HHblits	X-ray	1.80Å	0.28	0.09	Cobyrinic Acid a,c-diamide synthase
4j2h.1.A	15.63	homo-tetramer	HHblits	X-ray	2.10Å	0.31	0.09	Short chain alcohol dehydrogenase-related dehydrogenase
1zk3.1.A	15.63	homo-tetramer	HHblits	X-ray	2.20Å	0.31	0.09	R-specific alcohol dehydrogenase
2a4k.1.A	12.50	homo-dimer	HHblits	X-ray	2.30Å	0.31	0.09	3-oxoacyl-[acyl carrier protein] reductase
2a4k.1.B	12.50	homo-dimer	HHblits	X-ray	2.30Å	0.31	0.09	3-oxoacyl-[acyl carrier protein] reductase
4cqm.1.B	18.75	hetero-oligomer	HHblits	X-ray	2.34Å	0.31	0.09	CARBONYL REDUCTASE FAMILY MEMBER 4
4cql.1.C	18.75	hetero-oligomer	HHblits	X-ray	2.85Å	0.31	0.09	CARBONYL REDUCTASE FAMILY MEMBER 4
4cql.2.B	18.75	hetero-oligomer	HHblits	X-ray	2.85Å	0.31	0.09	CARBONYL REDUCTASE FAMILY MEMBER 4
4cql.2.C	18.75	hetero-oligomer	HHblits	X-ray	2.85Å	0.31	0.09	CARBONYL REDUCTASE FAMILY MEMBER 4
4cql.3.B	18.75	hetero-oligomer	HHblits	X-ray	2.85Å	0.31	0.09	CARBONYL REDUCTASE FAMILY MEMBER 4
4cql.3.C	18.75	hetero-oligomer	HHblits	X-ray	2.85Å	0.31	0.09	CARBONYL REDUCTASE FAMILY MEMBER 4
4cql.4.B	18.75	hetero-oligomer	HHblits	X-ray	2.85Å	0.31	0.09	CARBONYL REDUCTASE FAMILY MEMBER 4
4cql.4.C	18.75	hetero-oligomer	HHblits	X-ray	2.85Å	0.31	0.09	CARBONYL REDUCTASE FAMILY MEMBER 4
4cql.1.B	18.75	hetero-oligomer	HHblits	X-ray	2.85Å	0.31	0.09	CARBONYL REDUCTASE FAMILY MEMBER 4
4cqm.2.C	18.75	hetero-oligomer	HHblits	X-ray	2.34Å	0.31	0.09	CARBONYL REDUCTASE FAMILY MEMBER 4
4cqm.3.C	18.75	hetero-oligomer	HHblits	X-ray	2.34Å	0.31	0.09	CARBONYL REDUCTASE FAMILY MEMBER 4
4cqm.4.C	18.75	hetero-oligomer	HHblits	X-ray	2.34Å	0.31	0.09	CARBONYL REDUCTASE FAMILY MEMBER 4
3uwo.1.A	14.71	monomer	HHblits	X-ray	1.70Å	0.26	0.10	Thymidylate kinase
3uwk.1.A	14.71	monomer	HHblits	X-ray	1.91Å	0.26	0.10	Thymidylate kinase
3hjn.1.A	17.65	homo-dimer	HHblits	X-ray	2.10Å	0.26	0.10	Thymidylate kinase
3hjn.1.B	17.65	homo-dimer	HHblits	X-ray	2.10Å	0.26	0.10	Thymidylate kinase
3hly.1.A	2.78	monomer	HHblits	X-ray	2.40Å	0.21	0.10	Flavodoxin-like domain
3hly.2.A	2.78	monomer	HHblits	X-ray	2.40Å	0.21	0.10	Flavodoxin-like domain
3hly.3.A	2.78	monomer	HHblits	X-ray	2.40Å	0.21	0.10	Flavodoxin-like domain
5jo9.1.A	22.58	homo-tetramer	HHblits	X-ray	2.89Å	0.33	0.09	Ribitol 2-dehydrogenase
5vj7.1.B	14.71	hetero-oligomer	HHblits	X-ray	2.55Å	0.26	0.10	Ferredoxin-NADP(+) reductase subunit alpha
1k2w.1.A	12.50	homo-dimer	HHblits	X-ray	2.40Å	0.30	0.09	SORBITOL DEHYDROGENASE
3emk.1.A	21.88	homo-tetramer	HHblits	X-ray	2.50Å	0.30	0.09	GLUCOSE/RIBITOL DEHYDROGENASE
3emk.1.C	21.88	homo-tetramer	HHblits	X-ray	2.50Å	0.30	0.09	GLUCOSE/RIBITOL DEHYDROGENASE
3enn.1.A	21.88	homo-tetramer	HHblits	X-ray	2.10Å	0.30	0.09	GLUCOSE/RIBITOL DEHYDROGENASE
2cfc.1.A	18.75	homo-tetramer	HHblits	X-ray	1.80Å	0.30	0.09	2-(R)-HYDROXYPROPYL-COM DEHYDROGENASE
5jyd.1.A	18.75	homo-tetramer	HHblits	X-ray	1.65Å	0.30	0.09	Short chain dehydrogenase
4gcm.1.A	21.88	homo-dimer	HHblits	X-ray	1.80Å	0.30	0.09	Thioredoxin reductase
1sb9.1.A	15.15	homo-dimer	HHblits	X-ray	2.50Å	0.28	0.09	wbpP
2bgl.1.A	12.12	homo-tetramer	HHblits	X-ray	2.80Å	0.28	0.09	RHIZOME SECOISOLARICIRESINOL DEHYDROGENASE
2bgm.1.A	12.12	homo-tetramer	HHblits	X-ray	2.00Å	0.28	0.09	RHIZOME SECOISOLARICIRESINOL DEHYDROGENASE
2bgk.1.A	12.12	homo-tetramer	HHblits	X-ray	1.60Å	0.28	0.09	RHIZOME SECOISOLARICIRESINOL DEHYDROGENASE
2bgk.1.B	12.12	homo-tetramer	HHblits	X-ray	1.60Å	0.28	0.09	RHIZOME SECOISOLARICIRESINOL DEHYDROGENASE
3gem.1.A	21.88	homo-tetramer	HHblits	X-ray	1.83Å	0.30	0.09	Short chain dehydrogenase
3gem.1.D	21.88	homo-tetramer	HHblits	X-ray	1.83Å	0.30	0.09	Short chain dehydrogenase
3tzc.1.A	12.50	homo-tetramer	HHblits	X-ray	2.45Å	0.30	0.09	3-oxoacyl-[acyl-carrier protein] reductase
3tzc.1.B	12.50	homo-tetramer	HHblits	X-ray	2.45Å	0.30	0.09	3-oxoacyl-[acyl-carrier protein] reductase
3ek2.1.A	15.63	homo-tetramer	HHblits	X-ray	1.90Å	0.30	0.09	Enoyl-(Acyl-carrier-protein) reductase (NADH)
3guy.1.A	22.58	homo-tetramer	HHblits	X-ray	1.90Å	0.33	0.09	Short-chain dehydrogenase/reductase SDR
3kkj.1.A	25.81	homo-dimer	HHblits	X-ray	2.50Å	0.33	0.09	Amine oxidase, flavin-containing
2hsd.1.A	15.63	homo-tetramer	HHblits	X-ray	2.64Å	0.30	0.09	3-ALPHA, 20 BETA-HYDROXYSTEROID DEHYDROGENASE
1uay.1.A	15.63	homo-tetramer	HHblits	X-ray	1.40Å	0.30	0.09	Type II 3-hydroxyacyl-CoA dehydrogenase
5ffq.1.A	21.88	homo-dimer	HHblits	X-ray	2.00Å	0.30	0.09	ShuY-like protein
3ius.1.A	15.15	monomer	HHblits	X-ray	1.66Å	0.28	0.09	uncharacterized conserved protein
3ius.2.A	15.15	monomer	HHblits	X-ray	1.66Å	0.28	0.09	uncharacterized conserved protein
3oid.1.A	15.15	homo-tetramer	HHblits	X-ray	1.80Å	0.28	0.09	Enoyl-[acyl-carrier-protein] reductase [NADPH]
3oic.1.B	15.15	homo-tetramer	HHblits	X-ray	2.20Å	0.28	0.09	Enoyl-[acyl-carrier-protein] reductase [NADPH]
3oic.1.A	15.15	homo-tetramer	HHblits	X-ray	2.20Å	0.28	0.09	Enoyl-[acyl-carrier-protein] reductase [NADPH]
3o38.1.A	12.12	homo-tetramer	HHblits	X-ray	1.95Å	0.28	0.09	Short chain dehydrogenase
3vvc.1.A	18.75	homo-hexamer	HHblits	X-ray	2.20Å	0.30	0.09	Capsular polysaccharide synthesis enzyme Cap8E
5o30.1.A	21.88	homo-tetramer	HHblits	X-ray	2.30Å	0.30	0.09	Putative oxidoreductase
5ff9.1.A	15.63	homo-tetramer	HHblits	X-ray	1.81Å	0.30	0.09	Noroxomaritidine/Norcraugsodine Reductase
5ff9.1.D	15.63	homo-tetramer	HHblits	X-ray	1.81Å	0.30	0.09	Noroxomaritidine/Norcraugsodine Reductase
5fff.1.B	15.63	homo-tetramer	HHblits	X-ray	1.50Å	0.30	0.09	Noroxomaritidine/Norcraugsodine Reductase
1ipf.1.A	15.63	homo-dimer	HHblits	X-ray	2.50Å	0.30	0.09	TROPINONE REDUCTASE-II
1hdc.1.A	15.63	homo-tetramer	HHblits	X-ray	2.20Å	0.30	0.09	3-ALPHA, 20 BETA-HYDROXYSTEROID DEHYDROGENASE
2vdc.1.G	22.58	hetero-oligomer	HHblits	EM	9.50Å	0.32	0.09	GLUTAMATE SYNTHASE [NADPH] SMALL CHAIN
2uvd.1.A	12.12	homo-tetramer	HHblits	X-ray	2.40Å	0.27	0.09	3-OXOACYL-(ACYL-CARRIER-PROTEIN) REDUCTASE
1i01.1.D	12.50	homo-tetramer	HHblits	X-ray	2.60Å	0.30	0.09	BETA-KETOACYL [ACP] REDUCTASE
1q7b.1.A	12.50	homo-tetramer	HHblits	X-ray	2.05Å	0.30	0.09	3-oxoacyl-[acyl-carrier protein] reductase
1i01.1.A	12.50	homo-tetramer	HHblits	X-ray	2.60Å	0.30	0.09	BETA-KETOACYL [ACP] REDUCTASE
3cty.1.A	19.35	homo-dimer	HHblits	X-ray	2.35Å	0.32	0.09	Thioredoxin reductase
1yqz.1.A	15.15	homo-dimer	HHblits	X-ray	1.54Å	0.27	0.09	coenzyme A disulfide reductase
2pd6.1.A	9.09	homo-tetramer	HHblits	X-ray	2.00Å	0.27	0.09	Estradiol 17-beta-dehydrogenase 8
2wy2.1.D	5.71	hetero-oligomer	HHblits	NMR	NA	0.23	0.10	N\,N'-DIACETYLCHITOBIOSE-SPECIFIC PHOSPHOTRANSFERASE ENZYME IIB COMPONENT
1h9c.1.A	5.71	monomer	HHblits	NMR	NA	0.23	0.10	PTS SYSTEM, CHITOBIOSE-SPECIFIC IIB COMPONENT
3fbs.1.A	21.88	homo-dimer	HHblits	X-ray	2.15Å	0.30	0.09	Oxidoreductase
3gvc.1.A	18.75	homo-tetramer	HHblits	X-ray	2.45Å	0.30	0.09	Probable short-chain type dehydrogenase/reductase
4j2o.1.A	18.75	homo-hexamer	HHblits	X-ray	2.65Å	0.30	0.09	UDP-N-acetylglucosamine 4,6-dehydratase/5-epimerase
4j2o.1.D	18.75	homo-hexamer	HHblits	X-ray	2.65Å	0.30	0.09	UDP-N-acetylglucosamine 4,6-dehydratase/5-epimerase
2qae.1.A	18.75	homo-dimer	HHblits	X-ray	1.90Å	0.30	0.09	Dihydrolipoyl dehydrogenase
4ylf.1.A	12.50	hetero-oligomer	HHblits	X-ray	2.30Å	0.29	0.09	Dihydroorotate dehydrogenase B (NAD(+)), electron transfer subunit homolog
4ylf.2.A	12.50	hetero-oligomer	HHblits	X-ray	2.30Å	0.29	0.09	Dihydroorotate dehydrogenase B (NAD(+)), electron transfer subunit homolog
4yry.1.A	12.50	hetero-oligomer	HHblits	X-ray	2.40Å	0.29	0.09	Dihydroorotate dehydrogenase B (NAD(+)), electron transfer subunit homolog
4yry.2.A	12.50	hetero-oligomer	HHblits	X-ray	2.40Å	0.29	0.09	Dihydroorotate dehydrogenase B (NAD(+)), electron transfer subunit homolog
4dim.1.A	18.75	monomer	HHblits	X-ray	2.61Å	0.29	0.09	Phosphoribosylglycinamide synthetase
5l51.1.A	12.50	monomer	HHblits	X-ray	2.66Å	0.29	0.09	(-)-menthone:(+)-neomenthol reductase
5j60.1.A	12.50	homo-dimer	HHblits	X-ray	1.90Å	0.29	0.09	Thioredoxin reductase
1ahi.1.D	15.63	homo-tetramer	HHblits	X-ray	2.30Å	0.29	0.09	7 ALPHA-HYDROXYSTEROID DEHYDROGENASE
1ahh.1.A	15.63	homo-tetramer	HHblits	X-ray	2.30Å	0.29	0.09	7 ALPHA-HYDROXYSTEROID DEHYDROGENASE
5b6k.1.A	15.63	monomer	HHblits	X-ray	1.70Å	0.29	0.09	Uncharacterized protein CgKR1
3k30.1.A	19.35	homo-dimer	HHblits	X-ray	2.70Å	0.32	0.09	Histamine dehydrogenase
2g1u.1.A	22.58	homo-dimer	HHblits	X-ray	1.50Å	0.32	0.09	hypothetical protein tm1088a
4fbg.1.A	9.09	monomer	HHblits	X-ray	3.02Å	0.27	0.09	Putative reductase TDE_0597
4ggp.1.A	9.09	monomer	HHblits	X-ray	2.05Å	0.27	0.09	Trans-2-enoyl-CoA reductase
2cd7.1.A	15.15	monomer	HHblits	X-ray	1.50Å	0.27	0.09	PROTEIN ARSC
3ab1.1.A	21.88	homo-dimer	HHblits	X-ray	2.39Å	0.29	0.09	Ferredoxin--NADP reductase
3ab1.1.B	21.88	homo-dimer	HHblits	X-ray	2.39Å	0.29	0.09	Ferredoxin--NADP reductase
2nm0.1.A	15.63	homo-tetramer	HHblits	X-ray	1.99Å	0.29	0.09	Probable 3-oxacyl-(Acyl-carrier-protein) reductase
4qed.1.A	15.63	homo-dimer	HHblits	X-ray	1.85Å	0.29	0.09	ElxO
3n74.1.A	12.50	homo-tetramer	HHblits	X-ray	2.20Å	0.29	0.09	3-ketoacyl-(acyl-carrier-protein) reductase
4z0t.1.A	12.50	monomer	HHblits	X-ray	1.50Å	0.29	0.09	Oxidoreductase, short-chain dehydrogenase/reductase family
4ntc.1.A	18.75	homo-dimer	HHblits	X-ray	1.90Å	0.29	0.09	GliT
3ak4.1.A	15.63	homo-tetramer	HHblits	X-ray	2.00Å	0.29	0.09	NADH-dependent quinuclidinone reductase
3wds.1.C	15.63	homo-tetramer	HHblits	X-ray	1.72Å	0.29	0.09	NADH-dependent quinuclidinone reductase
2vns.1.A	16.13	homo-dimer	HHblits	X-ray	2.00Å	0.31	0.09	METALLOREDUCTASE STEAP3
2vq3.1.A	16.13	homo-dimer	HHblits	X-ray	2.00Å	0.31	0.09	METALLOREDUCTASE STEAP3
2vq3.1.B	16.13	homo-dimer	HHblits	X-ray	2.00Å	0.31	0.09	METALLOREDUCTASE STEAP3
1yjq.1.A	25.81	monomer	HHblits	X-ray	2.09Å	0.31	0.09	2-dehydropantoate 2-reductase
2nq8.1.A	12.12	hetero-oligomer	HHblits	X-ray	2.50Å	0.26	0.09	Enoyl-acyl carrier reductase
4q9n.1.A	11.76	homo-tetramer	HHblits	X-ray	1.80Å	0.24	0.10	Enoyl-[acyl-carrier-protein] reductase [NADH]
3rd5.1.A	12.50	monomer	HHblits	X-ray	1.50Å	0.29	0.09	MYPAA.01249.C
4pvc.1.A	9.38	homo-dimer	HHblits	X-ray	2.00Å	0.29	0.09	NADPH-dependent methylglyoxal reductase GRE2
4pvd.1.A	9.38	monomer	HHblits	X-ray	2.40Å	0.29	0.09	NADPH-dependent methylglyoxal reductase GRE2
4pvd.3.A	9.38	monomer	HHblits	X-ray	2.40Å	0.29	0.09	NADPH-dependent methylglyoxal reductase GRE2
3op4.1.A	9.38	homo-tetramer	HHblits	X-ray	1.60Å	0.29	0.09	3-oxoacyl-[acyl-carrier protein] reductase
3tzh.1.A	9.38	homo-tetramer	HHblits	X-ray	2.10Å	0.29	0.09	3-oxoacyl-[acyl-carrier protein] reductase
2zk7.1.A	9.38	homo-tetramer	HHblits	X-ray	2.71Å	0.29	0.09	Glucose 1-dehydrogenase related protein
2zk7.1.B	9.38	homo-tetramer	HHblits	X-ray	2.71Å	0.29	0.09	Glucose 1-dehydrogenase related protein
1lvl.1.A	22.58	homo-dimer	HHblits	X-ray	2.45Å	0.31	0.09	DIHYDROLIPOAMIDE DEHYDROGENASE
3ijp.1.A	19.35	homo-tetramer	HHblits	X-ray	2.30Å	0.31	0.09	Dihydrodipicolinate reductase
3ijp.1.B	19.35	homo-tetramer	HHblits	X-ray	2.30Å	0.31	0.09	Dihydrodipicolinate reductase
4z9f.1.A	12.12	homo-tetramer	HHblits	X-ray	1.75Å	0.26	0.09	Halohydrin epoxidase A
4mge.1.A	12.12	monomer	HHblits	X-ray	1.85Å	0.26	0.09	PTS system, cellobiose-specific IIB component
4mge.2.A	12.12	monomer	HHblits	X-ray	1.85Å	0.26	0.09	PTS system, cellobiose-specific IIB component
1enp.1.A	12.12	homo-tetramer	HHblits	X-ray	2.60Å	0.26	0.09	ENOYL ACYL CARRIER PROTEIN REDUCTASE
3mle.1.A	9.09	homo-dimer	HHblits	X-ray	2.80Å	0.26	0.09	Dethiobiotin synthetase
2l2q.1.A	15.15	monomer	HHblits	NMR	NA	0.26	0.09	PTS system, cellobiose-specific IIB component (CelA)
3tpc.1.A	12.50	homo-tetramer	HHblits	X-ray	2.34Å	0.29	0.09	Short chain alcohol dehydrogenase-related dehydrogenase
3a28.1.A	12.50	homo-tetramer	HHblits	X-ray	2.00Å	0.29	0.09	L-2.3-butanediol dehydrogenase
3u09.1.A	9.38	homo-tetramer	HHblits	X-ray	1.75Å	0.29	0.09	3-oxoacyl-[acyl-carrier-protein] reductase FabG
4yqz.1.A	15.63	homo-tetramer	HHblits	X-ray	1.81Å	0.29	0.09	Putative oxidoreductase
4yqz.1.D	15.63	homo-tetramer	HHblits	X-ray	1.81Å	0.29	0.09	Putative oxidoreductase
3rnm.1.A	19.35	hetero-oligomer	HHblits	X-ray	2.40Å	0.31	0.09	Dihydrolipoyl dehydrogenase, mitochondrial
2o2y.1.B	5.88	homo-tetramer	HHblits	X-ray	2.20Å	0.24	0.10	Enoyl-acyl carrier reductase
2o2y.1.A	5.88	homo-tetramer	HHblits	X-ray	2.20Å	0.24	0.10	Enoyl-acyl carrier reductase
3am3.1.A	5.88	homo-tetramer	HHblits	X-ray	2.50Å	0.24	0.10	Enoyl-ACP reductase
3am5.1.A	5.88	homo-tetramer	HHblits	X-ray	2.05Å	0.24	0.10	Enoyl-ACP reductase
5cej.1.A	9.38	homo-tetramer	HHblits	X-ray	2.50Å	0.28	0.09	3-oxoacyl-[acyl-carrier protein] reductase
5cdy.1.C	9.38	homo-tetramer	HHblits	X-ray	2.85Å	0.28	0.09	3-oxoacyl-[acyl-carrier protein] reductase
5cdy.1.A	9.38	homo-tetramer	HHblits	X-ray	2.85Å	0.28	0.09	3-oxoacyl-[acyl-carrier protein] reductase
3tzq.1.A	15.63	homo-tetramer	HHblits	X-ray	2.50Å	0.28	0.09	Short-chain type dehydrogenase/reductase
1geg.1.A	12.50	homo-tetramer	HHblits	X-ray	1.70Å	0.28	0.09	ACETOIN REDUCTASE
3wye.1.A	12.50	homo-tetramer	HHblits	X-ray	1.58Å	0.28	0.09	Diacetyl reductase [(S)-acetoin forming],L-2,3-butanediol dehydrogenase,Diacetyl reductase [(S)-acetoin forming],L-2,3-butanediol dehydrogenase,Diacetyl reductase [(S)-acetoin forming],L-2,3-butanediol dehydrogenase,Diacetyl reductase [(S)-acetoin forming]
4pfs.1.A	18.75	monomer	HHblits	X-ray	2.30Å	0.28	0.09	Cobyrinic Acid a,c-diamide synthase
4pfs.2.A	18.75	monomer	HHblits	X-ray	2.30Å	0.28	0.09	Cobyrinic Acid a,c-diamide synthase
3b1f.1.A	18.75	homo-dimer	HHblits	X-ray	2.10Å	0.28	0.09	Putative prephenate dehydrogenase
1djn.1.A	16.13	homo-dimer	HHblits	X-ray	2.20Å	0.31	0.09	TRIMETHYLAMINE DEHYDROGENASE
1djq.1.A	16.13	homo-dimer	HHblits	X-ray	2.20Å	0.31	0.09	TRIMETHYLAMINE DEHYDROGENASE
2wdz.1.A	19.35	homo-tetramer	HHblits	X-ray	1.95Å	0.31	0.09	SHORT-CHAIN DEHYDROGENASE/REDUCTASE
3lqf.1.D	19.35	homo-tetramer	HHblits	X-ray	1.80Å	0.31	0.09	Galactitol dehydrogenase
2qq5.1.A	12.50	homo-dimer	HHblits	X-ray	1.80Å	0.28	0.09	Dehydrogenase/reductase SDR family member 1
5uth.1.A	15.63	homo-dimer	HHblits	X-ray	1.95Å	0.28	0.09	Thioredoxin reductase
2a87.1.A	15.63	homo-dimer	HHblits	X-ray	3.00Å	0.28	0.09	Thioredoxin reductase
2a87.1.B	15.63	homo-dimer	HHblits	X-ray	3.00Å	0.28	0.09	Thioredoxin reductase
4i08.1.A	12.90	homo-tetramer	HHblits	X-ray	2.06Å	0.31	0.09	3-oxoacyl-[acyl-carrier-protein] reductase FabG
3p19.1.A	12.90	homo-tetramer	HHblits	X-ray	2.05Å	0.31	0.09	Putative blue fluorescent protein
3h7a.1.A	9.38	homo-tetramer	HHblits	X-ray	1.87Å	0.28	0.09	short chain dehydrogenase
2nwq.1.A	12.50	homo-tetramer	HHblits	X-ray	2.30Å	0.28	0.09	Probable short-chain dehydrogenase
1wvg.1.A	15.15	homo-tetramer	HHblits	X-ray	1.80Å	0.25	0.09	CDP-glucose 4,6-dehydratase
1wvg.1.B	15.15	homo-tetramer	HHblits	X-ray	1.80Å	0.25	0.09	CDP-glucose 4,6-dehydratase
2l19.1.A	12.12	monomer	HHblits	NMR	NA	0.25	0.09	Arsenate reductase
2myt.1.A	12.12	monomer	HHblits	NMR	NA	0.25	0.09	Glutaredoxin arsenate reductase
4bmv.1.A	9.68	homo-dimer	HHblits	X-ray	2.50Å	0.30	0.09	SHORT-CHAIN DEHYDROGENASE
2ag5.1.A	9.38	homo-tetramer	HHblits	X-ray	1.84Å	0.28	0.09	dehydrogenase/reductase (SDR family) member 6
3rwb.1.A	9.38	homo-tetramer	HHblits	X-ray	1.70Å	0.28	0.09	Pyridoxal 4-dehydrogenase
4fn4.1.A	9.38	homo-tetramer	HHblits	X-ray	1.75Å	0.28	0.09	Short chain dehydrogenase
3aw8.1.A	19.35	homo-dimer	HHblits	X-ray	2.60Å	0.30	0.09	Phosphoribosylaminoimidazole carboxylase, ATPase subunit
3osu.1.A	16.13	homo-tetramer	HHblits	X-ray	1.90Å	0.30	0.09	3-oxoacyl-[acyl-carrier-protein] reductase
3gf4.1.A	19.35	homo-dimer	HHblits	X-ray	2.45Å	0.30	0.09	UDP-galactopyranose mutase
3gf4.1.B	19.35	homo-dimer	HHblits	X-ray	2.45Å	0.30	0.09	UDP-galactopyranose mutase
3int.1.B	19.35	homo-dimer	HHblits	X-ray	2.51Å	0.30	0.09	Probable UDP-galactopyranose mutase
1ryi.1.A	16.13	homo-tetramer	HHblits	X-ray	1.80Å	0.30	0.09	GLYCINE OXIDASE
3if9.1.A	16.13	homo-tetramer	HHblits	X-ray	2.60Å	0.30	0.09	Glycine oxidase
5x1y.1.A	19.35	homo-dimer	HHblits	X-ray	3.48Å	0.30	0.09	Mercuric reductase
1nfr.1.A	12.90	homo-tetramer	HHblits	X-ray	2.10Å	0.30	0.09	Putative oxidoreductase Rv2002
1ks9.1.A	26.67	monomer	HHblits	X-ray	1.70Å	0.32	0.08	2-DEHYDROPANTOATE 2-REDUCTASE
2q7v.1.A	15.63	homo-dimer	HHblits	X-ray	1.90Å	0.27	0.09	Thioredoxin reductase
2q7v.1.B	15.63	homo-dimer	HHblits	X-ray	1.90Å	0.27	0.09	Thioredoxin reductase
4k6f.1.A	15.63	homo-tetramer	HHblits	X-ray	1.50Å	0.27	0.09	Putative Acetoacetyl-CoA reductase
3m1a.1.A	12.50	homo-10-mer	HHblits	X-ray	2.00Å	0.27	0.09	Putative dehydrogenase
1rkx.1.A	18.75	homo-tetramer	HHblits	X-ray	1.80Å	0.27	0.09	CDP-glucose-4,6-dehydratase
1q7c.1.A	12.90	homo-tetramer	HHblits	X-ray	2.50Å	0.30	0.09	3-oxoacyl-[acyl-carrier protein] reductase
4g9k.1.A	16.13	homo-dimer	HHblits	X-ray	2.70Å	0.30	0.09	Rotenone-insensitive NADH-ubiquinone oxidoreductase
3lzw.1.A	25.81	homo-dimer	HHblits	X-ray	1.80Å	0.30	0.09	Ferredoxin--NADP reductase 2
3lzx.1.A	25.81	homo-dimer	HHblits	X-ray	1.90Å	0.30	0.09	Ferredoxin--NADP reductase 2
2foi.1.A	12.50	hetero-oligomer	HHblits	X-ray	2.50Å	0.27	0.09	enoyl-acyl carrier reductase
4nbv.1.A	9.38	homo-tetramer	HHblits	X-ray	1.64Å	0.27	0.09	3-oxoacyl-[acyl-carrier-protein] reductase putative short-chain dehydrogenases/reductases (SDR) family protein
3g0o.1.A	15.63	homo-dimer	HHblits	X-ray	1.80Å	0.27	0.09	3-hydroxyisobutyrate dehydrogenase
2zat.1.A	9.38	homo-tetramer	HHblits	X-ray	1.50Å	0.27	0.09	Dehydrogenase/reductase SDR family member 4
2c75.1.A	16.67	homo-dimer	HHblits	X-ray	1.70Å	0.32	0.08	AMINE OXIDASE (FLAVIN-CONTAINING) B
4j34.1.A	23.33	monomer	HHblits	X-ray	2.03Å	0.32	0.08	Kynurenine 3-monooxygenase
4j34.2.A	23.33	monomer	HHblits	X-ray	2.03Å	0.32	0.08	Kynurenine 3-monooxygenase
1v35.1.A	9.09	homo-tetramer	HHblits	X-ray	2.50Å	0.24	0.09	enoyl-ACP reductase
2ptg.1.A	9.09	homo-dimer	HHblits	X-ray	2.60Å	0.24	0.09	Enoyl-acyl carrier reductase
2z1n.1.A	16.13	monomer	HHblits	X-ray	1.80Å	0.29	0.09	dehydrogenase
2z1n.2.A	16.13	monomer	HHblits	X-ray	1.80Å	0.29	0.09	dehydrogenase
3tfo.1.A	19.35	homo-tetramer	HHblits	X-ray	2.08Å	0.29	0.09	putative 3-oxoacyl-(acyl-carrier-protein) reductase
5fyd.1.A	12.50	homo-dimer	HHblits	X-ray	1.60Å	0.27	0.09	OXIDOREDUCTASE, SHORT CHAIN DEHYDROGENASE/REDUCTASE FAMILY PROTEIN
5fyd.1.B	12.50	homo-dimer	HHblits	X-ray	1.60Å	0.27	0.09	OXIDOREDUCTASE, SHORT CHAIN DEHYDROGENASE/REDUCTASE FAMILY PROTEIN
5gt9.1.A	12.50	homo-dimer	HHblits	X-ray	1.70Å	0.27	0.09	Oxidoreductase, short chain dehydrogenase/reductase family protein
5gt9.1.B	12.50	homo-dimer	HHblits	X-ray	1.70Å	0.27	0.09	Oxidoreductase, short chain dehydrogenase/reductase family protein
1zw1.1.A	6.06	homo-tetramer	HHblits	X-ray	2.90Å	0.24	0.09	enoyl-acyl carrier reductase
1zsn.1.B	6.06	homo-tetramer	HHblits	X-ray	2.99Å	0.24	0.09	enoyl-acyl carrier reductase
4ntd.1.A	16.13	homo-dimer	HHblits	X-ray	1.60Å	0.29	0.09	Thioredoxin reductase
5mh4.1.A	12.90	homo-dimer	HHblits	X-ray	2.14Å	0.29	0.09	Thioredoxin reductase
5mjk.1.A	12.90	homo-dimer	HHblits	X-ray	2.00Å	0.29	0.09	Thioredoxin reductase
3c85.1.A	19.35	homo-dimer	HHblits	X-ray	1.90Å	0.29	0.09	Putative glutathione-regulated potassium-efflux system protein KefB
3c85.1.B	19.35	homo-dimer	HHblits	X-ray	1.90Å	0.29	0.09	Putative glutathione-regulated potassium-efflux system protein KefB
3c85.2.A	19.35	homo-dimer	HHblits	X-ray	1.90Å	0.29	0.09	Putative glutathione-regulated potassium-efflux system protein KefB
3c85.2.B	19.35	homo-dimer	HHblits	X-ray	1.90Å	0.29	0.09	Putative glutathione-regulated potassium-efflux system protein KefB
4wjz.1.A	9.68	homo-tetramer	HHblits	X-ray	2.40Å	0.29	0.09	3-oxoacyl-[acyl-carrier-protein] reductase FabG
4wjz.1.B	9.68	homo-tetramer	HHblits	X-ray	2.40Å	0.29	0.09	3-oxoacyl-[acyl-carrier-protein] reductase FabG
4wk6.1.A	9.68	homo-tetramer	HHblits	X-ray	2.21Å	0.29	0.09	3-oxoacyl-[acyl-carrier protein] reductase
4wk6.1.B	9.68	homo-tetramer	HHblits	X-ray	2.21Å	0.29	0.09	3-oxoacyl-[acyl-carrier protein] reductase
2ehd.1.A	12.90	homo-dimer	HHblits	X-ray	2.40Å	0.29	0.09	Oxidoreductase, short-chain dehydrogenase/reductase family
2ehd.1.B	12.90	homo-dimer	HHblits	X-ray	2.40Å	0.29	0.09	Oxidoreductase, short-chain dehydrogenase/reductase family
3llv.1.A	12.90	monomer	HHblits	X-ray	1.70Å	0.29	0.09	Exopolyphosphatase-related protein
4iuy.1.A	12.90	homo-tetramer	HHblits	X-ray	2.38Å	0.29	0.09	Short chain dehydrogenase/reductase
5gqs.1.A	16.13	monomer	HHblits	NMR	NA	0.29	0.09	PTS galactitol transporter subunit IIB
1cl0.1.A	20.00	homo-dimer	HHblits	X-ray	2.50Å	0.32	0.08	THIOREDOXIN REDUCTASE
5epo.1.A	9.38	homo-tetramer	HHblits	X-ray	2.00Å	0.26	0.09	7-alpha-hydroxysteroid deydrogenase
3qj4.1.A	12.50	monomer	HHblits	X-ray	2.50Å	0.26	0.09	Renalase
3qj4.2.A	12.50	monomer	HHblits	X-ray	2.50Å	0.26	0.09	Renalase
2o2s.1.A	9.09	homo-tetramer	HHblits	X-ray	2.60Å	0.24	0.09	Enoyl-acyl carrier reductase
4e6p.1.A	9.68	homo-tetramer	HHblits	X-ray	2.10Å	0.29	0.09	Probable sorbitol dehydrogenase (L-iditol 2-dehydrogenase)
3urh.1.A	16.13	homo-dimer	HHblits	X-ray	1.90Å	0.29	0.09	Dihydrolipoyl dehydrogenase
3ego.1.A	23.33	homo-dimer	HHblits	X-ray	1.90Å	0.31	0.08	Probable 2-dehydropantoate 2-reductase
3ego.1.B	23.33	homo-dimer	HHblits	X-ray	1.90Å	0.31	0.08	Probable 2-dehydropantoate 2-reductase
1f6m.1.A	20.00	hetero-oligomer	HHblits	X-ray	2.95Å	0.31	0.08	THIOREDOXIN REDUCTASE
1tdf.1.A	20.00	homo-dimer	HHblits	X-ray	2.30Å	0.31	0.08	THIOREDOXIN REDUCTASE
2myu.1.A	12.50	monomer	HHblits	NMR	NA	0.26	0.09	Glutaredoxin arsenate reductase
4nwz.1.A	16.13	homo-dimer	HHblits	X-ray	2.50Å	0.29	0.09	FAD-dependent pyridine nucleotide-disulfide oxidoreductase
2eix.1.A	16.13	homo-dimer	HHblits	X-ray	1.56Å	0.29	0.09	NADH-cytochrome b5 reductase
3tzk.1.A	9.68	homo-tetramer	HHblits	X-ray	1.80Å	0.28	0.09	3-oxoacyl-[acyl-carrier protein] reductase
5end.1.A	9.68	homo-tetramer	HHblits	X-ray	2.55Å	0.28	0.09	3-oxoacyl-[acyl-carrier-protein] reductase FabG
3ppi.1.A	12.90	homo-tetramer	HHblits	X-ray	2.00Å	0.28	0.09	3-hydroxyacyl-CoA dehydrogenase type-2
2ew2.1.A	26.67	homo-dimer	HHblits	X-ray	2.00Å	0.31	0.08	2-dehydropantoate 2-reductase, putative
5usx.1.A	20.00	homo-dimer	HHblits	X-ray	2.60Å	0.31	0.08	Thioredoxin reductase
5usx.1.B	20.00	homo-dimer	HHblits	X-ray	2.60Å	0.31	0.08	Thioredoxin reductase
5utx.1.A	20.00	homo-dimer	HHblits	X-ray	2.46Å	0.31	0.08	Thioredoxin reductase
5utx.1.B	20.00	homo-dimer	HHblits	X-ray	2.46Å	0.31	0.08	Thioredoxin reductase
1trb.1.A	20.00	homo-dimer	HHblits	X-ray	2.00Å	0.31	0.08	THIOREDOXIN REDUCTASE
4jna.1.A	19.35	monomer	HHblits	X-ray	2.00Å	0.28	0.09	DepH
4jn9.1.A	19.35	homo-dimer	HHblits	X-ray	1.90Å	0.28	0.09	DepH
4jn9.1.B	19.35	homo-dimer	HHblits	X-ray	1.90Å	0.28	0.09	DepH
5t5q.1.A	13.33	homo-tetramer	HHblits	X-ray	1.95Å	0.31	0.08	Short-chain dehydrogenase/reductase SDR:Glucose/ribitol dehydrogenase
5u63.1.A	16.67	homo-dimer	HHblits	X-ray	1.99Å	0.31	0.08	Thioredoxin reductase
1i8t.1.A	19.35	homo-dimer	HHblits	X-ray	2.40Å	0.28	0.09	UDP-GALACTOPYRANOSE MUTASE
1i8t.1.B	19.35	homo-dimer	HHblits	X-ray	2.40Å	0.28	0.09	UDP-GALACTOPYRANOSE MUTASE
3ihm.1.A	23.33	homo-dimer	HHblits	X-ray	2.30Å	0.30	0.08	Styrene monooxygenase A
3f8p.1.A	16.13	homo-dimer	HHblits	X-ray	1.80Å	0.28	0.09	Thioredoxin reductase (TrxB-3)
3f8r.1.B	16.13	homo-dimer	HHblits	X-ray	1.95Å	0.28	0.09	Thioredoxin reductase (TrxB-3)
3f8d.1.A	16.13	homo-dimer	HHblits	X-ray	1.40Å	0.28	0.09	Thioredoxin reductase (TrxB-3)
2l18.1.A	12.50	monomer	HHblits	NMR	NA	0.25	0.09	Arsenate reductase
2l17.1.A	12.50	monomer	HHblits	NMR	NA	0.25	0.09	Arsenate reductase
2myn.1.A	12.50	monomer	HHblits	NMR	NA	0.25	0.09	Glutaredoxin arsenate reductase
2myp.1.A	12.50	monomer	HHblits	NMR	NA	0.25	0.09	Glutaredoxin arsenate reductase
2zbw.1.A	20.00	homo-dimer	HHblits	X-ray	2.10Å	0.30	0.08	Thioredoxin reductase
2zbw.1.B	20.00	homo-dimer	HHblits	X-ray	2.10Å	0.30	0.08	Thioredoxin reductase
3f4b.1.A	6.25	homo-tetramer	HHblits	X-ray	2.49Å	0.25	0.09	Enoyl-acyl carrier protein reductase
4ige.1.A	16.13	homo-dimer	HHblits	X-ray	2.15Å	0.27	0.09	Enoyl-acyl carrier reductase
4g81.1.A	9.68	homo-tetramer	HHblits	X-ray	1.90Å	0.27	0.09	Putative hexonate dehydrogenase
3f9i.1.A	13.33	homo-tetramer	HHblits	X-ray	2.25Å	0.29	0.08	3-oxoacyl-[acyl-carrier-protein] reductase
1zo8.1.A	9.38	homo-tetramer	HHblits	X-ray	1.90Å	0.24	0.09	halohydrin dehalogenase
4ixt.1.A	9.38	homo-tetramer	HHblits	X-ray	2.49Å	0.24	0.09	Halohydrin dehalogenase
3zn2.1.A	9.38	homo-tetramer	HHblits	X-ray	1.80Å	0.24	0.09	HALOHYDRIN DEHALOGENASE
3i83.1.A	16.67	homo-dimer	HHblits	X-ray	1.90Å	0.29	0.08	2-dehydropantoate 2-reductase
3i83.1.B	16.67	homo-dimer	HHblits	X-ray	1.90Å	0.29	0.08	2-dehydropantoate 2-reductase
5xn8.1.A	13.33	homo-octamer	HHblits	X-ray	2.33Å	0.29	0.08	Glycerol Dehydrogenase
4mca.1.A	20.00	homo-16-mer	HHblits	X-ray	1.90Å	0.29	0.08	Glycerol dehydrogenase
3fwz.1.A	23.33	homo-dimer	HHblits	X-ray	1.79Å	0.29	0.08	Inner membrane protein ybaL
4zd6.1.A	10.34	homo-tetramer	HHblits	X-ray	1.60Å	0.31	0.08	Halohydrin epoxidase B
4zd6.1.B	10.34	homo-tetramer	HHblits	X-ray	1.60Å	0.31	0.08	Halohydrin epoxidase B
3lk7.1.A	12.90	monomer	HHblits	X-ray	1.50Å	0.26	0.09	UDP-N-acetylmuramoylalanine--D-glutamate ligase
3l8k.1.A	16.67	homo-tetramer	HHblits	X-ray	2.50Å	0.28	0.08	Dihydrolipoyl dehydrogenase
1d7o.1.A	16.67	homo-tetramer	HHblits	X-ray	1.90Å	0.28	0.08	ENOYL-[ACYL-CARRIER PROTEIN] REDUCTASE (NADH) PRECURSOR
1cwu.1.A	16.67	homo-tetramer	HHblits	X-ray	2.50Å	0.28	0.08	ENOYL ACP REDUCTASE
1jqa.1.A	20.00	homo-octamer	HHblits	X-ray	2.05Å	0.28	0.08	Glycerol Dehydrogenase
1jq5.1.A	20.00	homo-octamer	HHblits	X-ray	1.70Å	0.28	0.08	Glycerol dehydrogenase
4kwh.1.A	9.68	homo-tetramer	HHblits	X-ray	1.70Å	0.25	0.09	Reductase homolog
2o6l.1.A	20.00	homo-dimer	HHblits	X-ray	1.80Å	0.28	0.08	UDP-glucuronosyltransferase 2B7
2o6l.1.B	20.00	homo-dimer	HHblits	X-ray	1.80Å	0.28	0.08	UDP-glucuronosyltransferase 2B7
2an1.1.A	9.68	homo-dimer	HHblits	X-ray	2.00Å	0.25	0.09	putative kinase
2an1.1.B	9.68	homo-dimer	HHblits	X-ray	2.00Å	0.25	0.09	putative kinase
2an1.2.A	9.68	homo-dimer	HHblits	X-ray	2.00Å	0.25	0.09	putative kinase
2an1.2.B	9.68	homo-dimer	HHblits	X-ray	2.00Å	0.25	0.09	putative kinase
3wc4.1.A	17.24	monomer	HHblits	X-ray	1.85Å	0.29	0.08	UDP-glucose:anthocyanidin 3-O-glucosyltransferase
1w93.1.A	21.43	monomer	HHblits	X-ray	2.50Å	0.32	0.08	ACETYL-COENZYME A CARBOXYLASE
5kvc.1.A	9.68	homo-tetramer	HHblits	X-ray	1.50Å	0.23	0.09	Halohydrin dehalogenase
4fk1.1.A	13.33	homo-dimer	HHblits	X-ray	2.40Å	0.26	0.08	Putative thioredoxin reductase
3wad.1.A	20.69	homo-dimer	HHblits	X-ray	2.00Å	0.28	0.08	Glycosyltransferase
1e6c.1.A	29.63	monomer	HHblits	X-ray	1.80Å	0.33	0.08	SHIKIMATE KINASE
4amb.1.A	18.52	homo-dimer	HHblits	X-ray	2.62Å	0.32	0.08	SNOGD
4amg.1.A	18.52	homo-dimer	HHblits	X-ray	2.59Å	0.32	0.08	SNOGD
4amg.1.B	18.52	homo-dimer	HHblits	X-ray	2.59Å	0.32	0.08	SNOGD
4an4.1.A	18.52	homo-dimer	HHblits	X-ray	2.70Å	0.32	0.08	GLYCOSYL TRANSFERASE
4an4.1.B	18.52	homo-dimer	HHblits	X-ray	2.70Å	0.32	0.08	GLYCOSYL TRANSFERASE
4an4.2.A	18.52	homo-dimer	HHblits	X-ray	2.70Å	0.32	0.08	GLYCOSYL TRANSFERASE
1w96.1.A	22.22	monomer	HHblits	X-ray	1.80Å	0.32	0.08	ACETYL-COENZYME A CARBOXYLASE
1rrv.1.A	14.29	monomer	HHblits	X-ray	2.00Å	0.28	0.08	GLYCOSYLTRANSFERASE GTFD
1iir.1.A	14.29	monomer	HHblits	X-ray	1.80Å	0.28	0.08	glycosyltransferase GtfB
1pnv.1.A	10.71	homo-dimer	HHblits	X-ray	2.80Å	0.27	0.08	GLYCOSYLTRANSFERASE GTFA
1pnv.1.B	10.71	homo-dimer	HHblits	X-ray	2.80Å	0.27	0.08	GLYCOSYLTRANSFERASE GTFA
5du2.1.A	26.92	monomer	HHblits	X-ray	2.70Å	0.32	0.07	EspG2 glycosyltransferase
5du2.2.A	26.92	monomer	HHblits	X-ray	2.70Å	0.32	0.07	EspG2 glycosyltransferase
2iya.1.A	19.23	monomer	HHblits	X-ray	1.70Å	0.30	0.07	OLEANDOMYCIN GLYCOSYLTRANSFERASE
3o8o.1.A	26.92	hetero-oligomer	HHblits	X-ray	2.90Å	0.27	0.07	6-phosphofructokinase subunit alpha
1kzh.1.A	24.00	homo-dimer	HHblits	X-ray	2.55Å	0.28	0.07	phosphofructokinase
1kzh.1.B	24.00	homo-dimer	HHblits	X-ray	2.55Å	0.28	0.07	phosphofructokinase
2f48.1.B	24.00	homo-dimer	HHblits	X-ray	2.11Å	0.28	0.07	diphosphate--fructose-6-phosphate 1-phosphotransferase
3k2q.1.A	20.00	homo-dimer	HHblits	X-ray	2.50Å	0.27	0.07	Pyrophosphate-dependent phosphofructokinase
3mrs.1.A	20.00	monomer	HHblits	X-ray	2.40Å	0.26	0.07	Shikimate kinase
3hno.1.A	25.00	homo-dimer	HHblits	X-ray	2.00Å	0.29	0.07	Pyrophosphate-dependent phosphofructokinase
3llq.1.A	30.00	homo-tetramer	HHblits	X-ray	2.01Å	0.33	0.06	Aquaporin Z 2
1fx8.1.A	9.52	homo-tetramer	HHblits	X-ray	2.20Å	0.27	0.06	GLYCEROL UPTAKE FACILITATOR PROTEIN
5dye.1.B	20.00	homo-tetramer	HHblits	X-ray	3.50Å	0.30	0.06	Aquaporin-5
5dye.1.A	20.00	homo-tetramer	HHblits	X-ray	3.50Å	0.30	0.06	Aquaporin-5
5c5x.1.A	20.00	homo-tetramer	HHblits	X-ray	2.60Å	0.30	0.06	Aquaporin-5
3d9s.1.B	20.00	homo-tetramer	HHblits	X-ray	2.00Å	0.30	0.06	Aquaporin-5
3d9s.1.A	20.00	homo-tetramer	HHblits	X-ray	2.00Å	0.30	0.06	Aquaporin-5
3d9s.1.D	20.00	homo-tetramer	HHblits	X-ray	2.00Å	0.30	0.06	Aquaporin-5
2zz9.1.A	15.00	homo-tetramer	HHblits	2DX	2.80Å	0.30	0.06	Aquaporin-4
2d57.1.A	15.00	homo-tetramer	HHblits	2DX	3.20Å	0.30	0.06	Aquaporin-4
3gd8.1.A	15.00	homo-tetramer	HHblits	X-ray	1.80Å	0.30	0.06	Aquaporin-4
3ne2.1.A	10.00	homo-tetramer	HHblits	X-ray	3.00Å	0.29	0.06	Probable aquaporin AqpM
3c02.1.A	10.00	homo-tetramer	HHblits	X-ray	2.05Å	0.29	0.06	Aquaglyceroporin
1ldf.1.A	10.00	homo-tetramer	HHblits	X-ray	2.10Å	0.28	0.06	Glycerol uptake facilitator protein
3cn5.1.A	15.00	homo-tetramer	HHblits	X-ray	2.05Å	0.28	0.06	Aquaporin
3cll.1.A	15.00	homo-tetramer	HHblits	X-ray	2.30Å	0.28	0.06	Aquaporin
3cn6.1.A	15.00	homo-tetramer	HHblits	X-ray	2.95Å	0.28	0.06	Aquaporin
3nk5.1.A	20.00	homo-tetramer	HHblits	X-ray	2.40Å	0.28	0.06	Aquaporin Z
2o9e.1.A	20.00	homo-tetramer	HHblits	X-ray	2.20Å	0.28	0.06	Aquaporin Z
1rc2.2.A	20.00	monomer	HHblits	X-ray	2.50Å	0.28	0.06	Aquaporin Z
1rc2.1.A	20.00	homo-tetramer	HHblits	X-ray	2.50Å	0.28	0.06	Aquaporin Z
3nkc.1.A	20.00	homo-tetramer	HHblits	X-ray	3.10Å	0.28	0.06	Aquaporin Z
3nka.1.A	20.00	homo-tetramer	HHblits	X-ray	2.50Å	0.28	0.06	Aquaporin Z
2o9d.1.A	20.00	homo-tetramer	HHblits	X-ray	2.30Å	0.28	0.06	Aquaporin Z
2o9g.1.A	20.00	homo-tetramer	HHblits	X-ray	1.90Å	0.28	0.06	Aquaporin Z
3m9i.1.A	20.00	homo-octamer	HHblits	2DX	2.50Å	0.28	0.06	Lens fiber major intrinsic protein
1sor.1.A	20.00	homo-octamer	HHblits	2DX	3.00Å	0.28	0.06	Aquaporin-0
2b6o.1.A	20.00	homo-octamer	HHblits	2DX	1.90Å	0.28	0.06	Lens fiber major intrinsic protein
1ymg.1.A	20.00	homo-tetramer	HHblits	X-ray	2.24Å	0.28	0.06	Lens fiber major intrinsic protein
3j41.1.C	20.00	hetero-oligomer	HHblits	EM	NA	0.28	0.06	Lens fiber major intrinsic protein
3j41.1.B	20.00	hetero-oligomer	HHblits	EM	NA	0.28	0.06	Lens fiber major intrinsic protein
2f2b.1.A	10.00	homo-tetramer	HHblits	X-ray	1.68Å	0.27	0.06	Aquaporin aqpM
5i32.1.A	15.00	homo-tetramer	HHblits	X-ray	1.18Å	0.27	0.06	Aquaporin TIP2-1
4oj2.1.A	10.00	homo-tetramer	HHblits	X-ray	3.05Å	0.26	0.06	Aquaporin-2
4nef.1.A	10.00	homo-tetramer	HHblits	X-ray	2.75Å	0.26	0.06	Aquaporin-2
4nef.1.B	10.00	homo-tetramer	HHblits	X-ray	2.75Å	0.26	0.06	Aquaporin-2
4nef.1.C	10.00	homo-tetramer	HHblits	X-ray	2.75Å	0.26	0.06	Aquaporin-2
4nef.1.D	10.00	homo-tetramer	HHblits	X-ray	2.75Å	0.26	0.06	Aquaporin-2
1fqy.1.A	15.00	homo-tetramer	HHblits	2DX	3.80Å	0.26	0.06	AQUAPORIN-1
1ih5.1.A	15.00	homo-tetramer	HHblits	2DX	3.70Å	0.26	0.06	AQUAPORIN-1
1h6i.1.A	15.00	monomer	HHblits	2DX	3.54Å	0.26	0.06	AQUAPORIN-1
1j4n.1.A	15.00	homo-tetramer	HHblits	X-ray	2.20Å	0.26	0.06	AQUAPORIN 1
4csk.1.A	15.00	homo-tetramer	HHblits	X-ray	3.28Å	0.26	0.06	AQUAPORIN-1
2w2e.1.A	10.00	homo-tetramer	HHblits	X-ray	1.15Å	0.24	0.06	AQUAPORIN PIP2-7 7
1mej.1.A	22.22	monomer	HHblits	X-ray	2.00Å	0.29	0.05	Phosphoribosylglycinamide formyltransferase
1men.3.A	22.22	monomer	HHblits	X-ray	2.23Å	0.29	0.05	Phosphoribosylglycinamide formyltransferase