SWISS-MODEL | Workspace | Model Results

SWISS-MODEL Homology Modelling Report

Model Building Report

This document lists the results for the homology modelling project "A0A076GWR7" submitted to SWISS-MODEL workspace on Oct. 18, 2017, 4:51 p.m..The submitted primary amino acid sequence is given in Table T1.

If you use any results in your research, please cite the relevant publications:

Marco Biasini; Stefan Bienert; Andrew Waterhouse; Konstantin Arnold; Gabriel Studer; Tobias Schmidt; Florian Kiefer; Tiziano Gallo Cassarino; Martino Bertoni; Lorenza Bordoli; Torsten Schwede. (2014). SWISS-MODEL: modelling protein tertiary and quaternary structure using evolutionary information. Nucleic Acids Research (1 July 2014) 42 (W1): W252-W258; doi: 10.1093/nar/gku340.
Arnold, K., Bordoli, L., Kopp, J. and Schwede, T. (2006) The SWISS-MODEL workspace: a web-based environment for protein structure homology modelling. Bioinformatics, 22, 195-201.
Benkert, P., Biasini, M. and Schwede, T. (2011) Toward the estimation of the absolute quality of individual protein structure models. Bioinformatics, 27, 343-350

Results

The SWISS-MODEL template library (SMTL version 2017-10-11, PDB release 2017-10-06) was searched with Blast (Altschul et al., 1997) and HHBlits (Remmert, et al., 2011) for evolutionary related structures matching the target sequence in Table T1. For details on the template search, see Materials and Methods. Overall 1056 templates were found (Table T2).

Models

The following model was built (see Materials and Methods "Model Building"):

Model #01	File	Built with	Oligo-State	Ligands	GMQE	QMEAN
	PDB	ProMod3 Version 1.1.0.	homo-dimer (matching prediction)	2 x TLA: L(+)-TARTARIC ACID;	0.99	0.84

QMEAN	0.84
Cβ	2.59
All Atom	2.34
Solvation	1.39
Torsion	0.06

Template	Seq Identity	Oligo-state	Found by	Method	Resolution	Seq Similarity	Range	Coverage	Description
2jfw.1.A	97.83	homo-dimer	BLAST	X-ray	2.00Å	0.59	5 - 274	1.00	GLUTAMATE RACEMASE

Ligand	Added to Model	Description
TLA	✓	L(+)-TARTARIC ACID
TLA	✓	L(+)-TARTARIC ACID

Target    MKKRMIRLTDNRPIGFIDSGVGGLTVVKEALKQLPNENILFVGDTARCPYGPRPAEQVIQYTWEMTDYLVEQGIKMLVIA
2jfw.1.A  IEGRMIRLTDNRPIGFIDSGVGGLTVVKEALKQLPNENILFVGDTARCPYGPRPAEQVIQYTWEMTDYLVEQGIKMLVIA

Target    CNTATAVALEEIKAALSIPVIGVILPGTRAAVKKTQNKQVGIIGTIGTVKSQAYEKALKEKVPELTVTSLACPKFVSVVE
2jfw.1.A  CNTATAVALEEIKAALSIPVIGVILPGTRAAVKKTQNKQVGIIGTIGTVKSQAYEKALKEKVPELTVTSLACPKFVSVVE

Target    SNEYHSSVAKKIVAETLAPLTTKKIDTLILGCTHYPLLRPIIQNVVGENVQLIDSGAETVGEVSMLLDYFNLSNSPQNGR
2jfw.1.A  SNEYHSSVAKKIVAETLAPLTTKKIDTLILGCTHYPLLRPIIQNVMGENVQLIDSGAETVGEVSMLLDYFNLSNSPQNGR

Target    TLCQFYTTGSAKLFQEIAEDWLGIGHLNVDHIELGGK
2jfw.1.A  TLCQFYTTGSAKLFEEIAEDWLGIGHLNVEHIELGGK

Materials and Methods

Template Search

Template search with Blast and HHBlits has been performed against the SWISS-MODEL template library (SMTL, last update: 2017-10-11, last included PDB release: 2017-10-06).

The target sequence was searched with BLAST (Altschul et al., 1997) against the primary amino acid sequence contained in the SMTL. A total of 40 templates were found.

An initial HHblits profile has been built using the procedure outlined in (Remmert, et al., 2011), followed by 1 iteration of HHblits against NR20. The obtained profile has then be searched against all profiles of the SMTL. A total of 1033 templates were found.

Template Selection

For each identified template, the template's quality has been predicted from features of the target-template alignment. The templates with the highest quality have then been selected for model building.

Model Building

Models are built based on the target-template alignment using ProMod3. Coordinates which are conserved between the target and the template are copied from the template to the model. Insertions and deletions are remodelled using a fragment library. Side chains are then rebuilt. Finally, the geometry of the resulting model is regularized by using a force field. In case loop modelling with ProMod3 fails, an alternative model is built with PROMOD-II (Guex, et al., 1997).

Model Quality Estimation

The global and per-residue model quality has been assessed using the QMEAN scoring function (Benkert, et al., 2011) . For improved performance, weights of the individual QMEAN terms have been trained specifically for SWISS-MODEL.

Ligand Modelling

Ligands present in the template structure are transferred by homology to the model when the following criteria are met (Gallo -Casserino, to be published): (a) The ligands are annotated as biologically relevant in the template library, (b) the ligand is in contact with the model, (c) the ligand is not clashing with the protein, (d) the residues in contact with the ligand are conserved between the target and the template. If any of these four criteria is not satisfied, a certain ligand will not be included in the model. The model summary includes information on why and which ligand has not been included.

Oligomeric State Conservation

Homo-oligomeric structure of the target protein is predicted based on the analysis of pairwise interfaces of the identified template structures. For each relevant interface between polypeptide chains (interfaces with more than 10 residue-residue interactions), the QscoreOligomer (Mariani et al., 2011) is predicted from features such as similarity to target and frequency of observing this interface in the identified templates (Kiefer, Bertoni, Biasini, to be published). The prediction is performed with a random forest regressor using these features as input parameters to predict the probability of conservation for each interface. The QscoreOligomer of the whole complex is then calculated as the weight-averaged QscoreOligomer of the interfaces. The oligomeric state of the target is predicted to be the same as in the template when QscoreOligomer is predicted to be higher or equal to 0.5.

References

Altschul, S.F., Madden, T.L., Schaffer, A.A., Zhang, J., Zhang, Z., Miller, W. and Lipman, D.J. (1997) Gapped BLAST and PSI-BLAST: a new generation of protein database search programs. Nucleic Acids Res, 25, 3389-3402.
Remmert, M., Biegert, A., Hauser, A. and Soding, J. (2012) HHblits: lightning-fast iterative protein sequence searching by HMM-HMM alignment. Nat Methods, 9, 173-175.
Guex, N. and Peitsch, M.C. (1997) SWISS-MODEL and the Swiss-PdbViewer: an environment for comparative protein modeling. Electrophoresis, 18, 2714-2723.
Sali, A. and Blundell, T.L. (1993) Comparative protein modelling by satisfaction of spatial restraints. J Mol Biol, 234, 779-815.
Benkert, P., Biasini, M. and Schwede, T. (2011) Toward the estimation of the absolute quality of individual protein structure models. Bioinformatics, 27, 343-350.
Mariani, V., Kiefer, F., Schmidt, T., Haas, J. and Schwede, T. (2011) Assessment of template based protein structure predictions in CASP9. Proteins, 79 Suppl 10, 37-58.

Table T1:

Primary amino acid sequence for which templates were searched and models were built.

MKKRMIRLTDNRPIGFIDSGVGGLTVVKEALKQLPNENILFVGDTARCPYGPRPAEQVIQYTWEMTDYLVEQGIKMLVIACNTATAVALEEIKAALSIPV
IGVILPGTRAAVKKTQNKQVGIIGTIGTVKSQAYEKALKEKVPELTVTSLACPKFVSVVESNEYHSSVAKKIVAETLAPLTTKKIDTLILGCTHYPLLRP
IIQNVVGENVQLIDSGAETVGEVSMLLDYFNLSNSPQNGRTLCQFYTTGSAKLFQEIAEDWLGIGHLNVDHIELGGK

Table T2:

Template	Seq Identity	Oligo-state	Found by	Method	Resolution	Seq Similarity	Coverage	Description
2jfw.1.A	97.83	homo-dimer	BLAST	X-ray	2.00Å	0.59	1.00	GLUTAMATE RACEMASE
2jfw.1.A	98.91	homo-dimer	HHblits	X-ray	2.00Å	0.60	0.99	GLUTAMATE RACEMASE
2vvt.1.A	69.60	homo-dimer	BLAST	X-ray	1.65Å	0.51	0.99	GLUTAMATE RACEMASE
2vvt.1.B	69.60	homo-dimer	BLAST	X-ray	1.65Å	0.51	0.99	GLUTAMATE RACEMASE
2jfp.1.A	69.60	homo-dimer	BLAST	X-ray	1.98Å	0.51	0.99	GLUTAMATE RACEMASE
2jfo.1.B	69.60	homo-dimer	BLAST	X-ray	2.50Å	0.51	0.99	GLUTAMATE RACEMASE
2vvt.1.A	69.49	homo-dimer	HHblits	X-ray	1.65Å	0.51	0.98	GLUTAMATE RACEMASE
2vvt.1.B	69.49	homo-dimer	HHblits	X-ray	1.65Å	0.51	0.98	GLUTAMATE RACEMASE
2jfp.1.A	69.74	homo-dimer	HHblits	X-ray	1.98Å	0.51	0.98	GLUTAMATE RACEMASE
2jfo.1.B	69.74	homo-dimer	HHblits	X-ray	2.50Å	0.51	0.98	GLUTAMATE RACEMASE
3hfr.1.A	61.60	homo-dimer	BLAST	X-ray	2.30Å	0.48	0.95	Glutamate racemase
3hfr.1.B	61.60	homo-dimer	BLAST	X-ray	2.30Å	0.48	0.95	Glutamate racemase
2oho.1.A	59.09	homo-dimer	BLAST	X-ray	2.25Å	0.47	0.95	Glutamate Racemase
2oho.1.B	59.09	homo-dimer	BLAST	X-ray	2.25Å	0.47	0.95	Glutamate Racemase
3hfr.1.A	61.45	homo-dimer	HHblits	X-ray	2.30Å	0.48	0.95	Glutamate racemase
3hfr.1.B	61.45	homo-dimer	HHblits	X-ray	2.30Å	0.48	0.95	Glutamate racemase
2ohv.1.A	59.32	homo-dimer	BLAST	X-ray	2.50Å	0.47	0.95	Glutamate Racemase
2ohg.1.A	59.32	homo-dimer	BLAST	X-ray	2.50Å	0.47	0.95	Glutamate racemase
2oho.1.A	59.39	homo-dimer	HHblits	X-ray	2.25Å	0.47	0.94	Glutamate Racemase
2oho.1.B	59.39	homo-dimer	HHblits	X-ray	2.25Å	0.47	0.94	Glutamate Racemase
2ohv.1.A	59.46	homo-dimer	HHblits	X-ray	2.50Å	0.47	0.94	Glutamate Racemase
2ohg.1.A	59.46	homo-dimer	HHblits	X-ray	2.50Å	0.47	0.94	Glutamate racemase
2gzm.1.A	58.56	homo-dimer	BLAST	X-ray	1.99Å	0.46	0.95	Glutamate racemase
2gzm.1.B	58.56	homo-dimer	BLAST	X-ray	1.99Å	0.46	0.95	Glutamate racemase
2gzm.2.B	58.56	homo-dimer	BLAST	X-ray	1.99Å	0.46	0.95	Glutamate racemase
2gzm.1.A	58.56	homo-dimer	HHblits	X-ray	1.99Å	0.46	0.95	Glutamate racemase
2gzm.1.B	58.56	homo-dimer	HHblits	X-ray	1.99Å	0.46	0.95	Glutamate racemase
2gzm.2.B	58.56	homo-dimer	HHblits	X-ray	1.99Å	0.46	0.95	Glutamate racemase
1zuw.1.A	55.73	homo-dimer	HHblits	X-ray	1.75Å	0.46	0.95	glutamate racemase 1
1zuw.1.B	55.73	homo-dimer	HHblits	X-ray	1.75Å	0.46	0.95	glutamate racemase 1
1zuw.1.A	58.17	homo-dimer	BLAST	X-ray	1.75Å	0.47	0.91	glutamate racemase 1
1zuw.1.B	58.17	homo-dimer	BLAST	X-ray	1.75Å	0.47	0.91	glutamate racemase 1
2dwu.1.A	47.39	homo-dimer	HHblits	X-ray	1.60Å	0.42	0.97	Glutamate racemase
2dwu.2.A	47.39	homo-dimer	HHblits	X-ray	1.60Å	0.42	0.97	Glutamate racemase
2jfq.1.A	48.85	homo-dimer	BLAST	X-ray	2.15Å	0.42	0.95	GLUTAMATE RACEMASE
2jfq.1.B	48.85	homo-dimer	BLAST	X-ray	2.15Å	0.42	0.95	GLUTAMATE RACEMASE
2jfq.1.A	49.43	homo-dimer	HHblits	X-ray	2.15Å	0.42	0.94	GLUTAMATE RACEMASE
2jfq.1.B	49.43	homo-dimer	HHblits	X-ray	2.15Å	0.42	0.94	GLUTAMATE RACEMASE
2dwu.1.A	48.84	homo-dimer	BLAST	X-ray	1.60Å	0.43	0.93	Glutamate racemase
2dwu.2.A	48.84	homo-dimer	BLAST	X-ray	1.60Å	0.43	0.93	Glutamate racemase
5ijw.1.A	39.31	homo-dimer	HHblits	X-ray	1.76Å	0.39	0.95	Glutamate racemase
5ijw.1.B	39.31	homo-dimer	HHblits	X-ray	1.76Å	0.39	0.95	Glutamate racemase
5hj7.1.A	39.77	homo-dimer	HHblits	X-ray	2.30Å	0.39	0.94	Glutamate racemase
3out.1.A	36.58	homo-hexamer	BLAST	X-ray	1.65Å	0.39	0.93	Glutamate racemase
5ijw.1.A	40.40	homo-dimer	BLAST	X-ray	1.76Å	0.40	0.90	Glutamate racemase
5ijw.1.B	40.40	homo-dimer	BLAST	X-ray	1.76Å	0.40	0.90	Glutamate racemase
5hj7.1.A	41.70	homo-dimer	BLAST	X-ray	2.30Å	0.40	0.89	Glutamate racemase
3out.1.A	34.90	homo-hexamer	HHblits	X-ray	1.65Å	0.38	0.92	Glutamate racemase
1b73.1.A	38.33	homo-dimer	HHblits	X-ray	2.30Å	0.39	0.87	GLUTAMATE RACEMASE
5w1q.1.A	35.80	homo-dimer	BLAST	X-ray	1.95Å	0.38	0.88	Glutamate racemase
2jfy.1.B	34.98	homo-dimer	BLAST	X-ray	1.90Å	0.38	0.88	GLUTAMATE RACEMASE
2jfz.1.A	34.98	homo-dimer	BLAST	X-ray	1.86Å	0.38	0.88	GLUTAMATE RACEMASE
2jfx.1.A	34.98	homo-dimer	BLAST	X-ray	2.30Å	0.38	0.88	GLUTAMATE RACEMASE
2jfx.1.B	34.98	homo-dimer	BLAST	X-ray	2.30Å	0.38	0.88	GLUTAMATE RACEMASE
2jfy.1.A	34.98	homo-dimer	BLAST	X-ray	1.90Å	0.38	0.88	GLUTAMATE RACEMASE
4b1f.1.B	34.98	homo-dimer	BLAST	X-ray	2.05Å	0.38	0.88	GLUTAMATE RACEMASE
2w4i.1.A	34.98	homo-tetramer	BLAST	X-ray	1.87Å	0.38	0.88	GLUTAMATE RACEMASE
3uho.1.A	35.39	monomer	BLAST	X-ray	2.20Å	0.38	0.88	Glutamate racemase
3uhf.2.A	35.39	monomer	BLAST	X-ray	1.83Å	0.38	0.88	Glutamate racemase
3uhp.1.A	35.39	monomer	BLAST	X-ray	2.79Å	0.38	0.88	Glutamate racemase
5w1q.1.A	33.33	homo-dimer	HHblits	X-ray	1.95Å	0.36	0.89	Glutamate racemase
2jfy.1.B	33.06	homo-dimer	HHblits	X-ray	1.90Å	0.37	0.88	GLUTAMATE RACEMASE
2jfz.1.A	33.06	homo-dimer	HHblits	X-ray	1.86Å	0.37	0.88	GLUTAMATE RACEMASE
2jfx.1.A	33.06	homo-dimer	HHblits	X-ray	2.30Å	0.37	0.88	GLUTAMATE RACEMASE
2jfx.1.B	33.06	homo-dimer	HHblits	X-ray	2.30Å	0.37	0.88	GLUTAMATE RACEMASE
2jfy.1.A	33.06	homo-dimer	HHblits	X-ray	1.90Å	0.37	0.88	GLUTAMATE RACEMASE
4b1f.1.B	33.06	homo-dimer	HHblits	X-ray	2.05Å	0.37	0.88	GLUTAMATE RACEMASE
2w4i.1.A	33.06	homo-tetramer	HHblits	X-ray	1.87Å	0.37	0.88	GLUTAMATE RACEMASE
3uho.1.A	34.16	monomer	HHblits	X-ray	2.20Å	0.37	0.88	Glutamate racemase
3uhf.2.A	34.16	monomer	HHblits	X-ray	1.83Å	0.37	0.88	Glutamate racemase
3uhp.1.A	34.16	monomer	HHblits	X-ray	2.79Å	0.37	0.88	Glutamate racemase
2jfn.1.A	29.80	monomer	BLAST	X-ray	1.90Å	0.36	0.88	GLUTAMATE RACEMASE
2jfn.1.A	26.00	monomer	HHblits	X-ray	1.90Å	0.34	0.90	GLUTAMATE RACEMASE
1b73.1.A	45.45	homo-dimer	BLAST	X-ray	2.30Å	0.43	0.71	GLUTAMATE RACEMASE
2eq5.1.A	18.48	homo-dimer	HHblits	X-ray	2.20Å	0.29	0.76	228aa long hypothetical hydantoin racemase
2eq5.2.B	18.48	homo-dimer	HHblits	X-ray	2.20Å	0.29	0.76	228aa long hypothetical hydantoin racemase
3s81.1.A	19.02	homo-dimer	HHblits	X-ray	1.80Å	0.31	0.74	Putative aspartate racemase
1jfl.1.A	20.98	homo-dimer	HHblits	X-ray	1.90Å	0.31	0.74	ASPARTATE RACEMASE
4fq7.1.A	14.29	homo-tetramer	HHblits	X-ray	3.00Å	0.29	0.76	Maleate cis-trans isomerase
2dx7.1.A	20.49	homo-dimer	HHblits	X-ray	2.00Å	0.30	0.74	aspartate racemase
2dx7.1.B	20.49	homo-dimer	HHblits	X-ray	2.00Å	0.30	0.74	aspartate racemase
4fq5.1.A	13.81	homo-tetramer	HHblits	X-ray	2.10Å	0.28	0.76	Maleate cis-trans isomerase
4fq5.1.B	13.81	homo-tetramer	HHblits	X-ray	2.10Å	0.28	0.76	Maleate cis-trans isomerase
2zsk.1.A	20.79	homo-dimer	HHblits	X-ray	2.55Å	0.30	0.73	226aa long hypothetical aspartate racemase
5hsg.1.A	16.34	monomer	HHblits	X-ray	1.30Å	0.30	0.73	Putative ABC transporter, nucleotide binding/ATPase protein
5ell.1.A	15.53	homo-dimer	HHblits	X-ray	1.80Å	0.28	0.74	Asp/Glu_racemase family protein
5ell.1.B	15.53	homo-dimer	HHblits	X-ray	1.80Å	0.28	0.74	Asp/Glu_racemase family protein
5elm.1.A	14.98	homo-dimer	HHblits	X-ray	2.00Å	0.28	0.75	Asp/Glu_racemase family protein
5elm.1.B	14.98	homo-dimer	HHblits	X-ray	2.00Å	0.28	0.75	Asp/Glu_racemase family protein
5elm.2.A	14.98	homo-dimer	HHblits	X-ray	2.00Å	0.28	0.75	Asp/Glu_racemase family protein
5elm.2.B	14.98	homo-dimer	HHblits	X-ray	2.00Å	0.28	0.75	Asp/Glu_racemase family protein
5hqt.1.A	15.53	homo-dimer	HHblits	X-ray	1.60Å	0.28	0.74	aspartate/glutamate racemase
1u6k.1.A	15.76	homo-hexamer	HHblits	X-ray	1.55Å	0.29	0.73	F420-dependent methylenetetrahydromethanopterin dehydrogenase
2ioy.1.A	15.35	monomer	HHblits	X-ray	1.90Å	0.29	0.73	Periplasmic sugar-binding protein
5ibq.1.A	17.73	monomer	HHblits	X-ray	1.20Å	0.29	0.73	Probable ribose ABC transporter, substrate-binding protein
5b19.1.A	19.60	homo-dimer	HHblits	X-ray	1.85Å	0.30	0.72	Aspartate racemase
5b19.1.B	19.60	homo-dimer	HHblits	X-ray	1.85Å	0.30	0.72	Aspartate racemase
2xed.1.A	13.11	monomer	HHblits	X-ray	1.95Å	0.27	0.74	PUTATIVE MALEATE ISOMERASE
2xec.1.A	13.66	homo-dimer	HHblits	X-ray	2.20Å	0.28	0.74	PUTATIVE MALEATE ISOMERASE
2gx6.1.A	16.34	monomer	HHblits	X-ray	1.97Å	0.28	0.73	D-ribose-binding periplasmic protein
3ojc.1.A	18.09	homo-tetramer	HHblits	X-ray	1.75Å	0.29	0.72	Putative aspartate/glutamate racemase
3ojc.1.B	18.09	homo-tetramer	HHblits	X-ray	1.75Å	0.29	0.72	Putative aspartate/glutamate racemase
3ojc.1.C	18.09	homo-tetramer	HHblits	X-ray	1.75Å	0.29	0.72	Putative aspartate/glutamate racemase
3ojc.1.D	18.09	homo-tetramer	HHblits	X-ray	1.75Å	0.29	0.72	Putative aspartate/glutamate racemase
3qvj.1.A	20.79	homo-hexamer	HHblits	X-ray	2.10Å	0.28	0.73	Putative hydantoin racemase
4ix1.1.A	13.04	homo-dimer	HHblits	X-ray	2.80Å	0.26	0.75	hypothetical protein
4ix1.1.B	13.04	homo-dimer	HHblits	X-ray	2.80Å	0.26	0.75	hypothetical protein
4rxm.1.A	14.22	monomer	HHblits	X-ray	1.75Å	0.27	0.74	Possible sugar ABC superfamily ATP binding cassette transporter, binding protein
2pug.1.B	11.88	homo-dimer	HHblits	X-ray	2.70Å	0.28	0.73	PROTEIN (PURINE REPRESSOR)
3qvl.1.A	19.70	homo-hexamer	HHblits	X-ray	1.82Å	0.27	0.73	Putative hydantoin racemase
4rs3.1.A	12.81	monomer	HHblits	X-ray	1.40Å	0.27	0.73	ABC transporter, carbohydrate uptake transporter-2 (CUT2) family, periplasmic sugar-binding protein
1jhz.1.A	11.33	homo-dimer	HHblits	X-ray	2.40Å	0.27	0.73	PURINE NUCLEOTIDE SYNTHESIS REPRESSOR
1jhz.1.B	11.33	homo-dimer	HHblits	X-ray	2.40Å	0.27	0.73	PURINE NUCLEOTIDE SYNTHESIS REPRESSOR
1dbq.1.A	10.84	homo-dimer	HHblits	X-ray	2.20Å	0.27	0.73	PURINE REPRESSOR
1dbq.1.B	10.84	homo-dimer	HHblits	X-ray	2.20Å	0.27	0.73	PURINE REPRESSOR
2vk2.1.A	15.42	monomer	HHblits	X-ray	1.20Å	0.28	0.73	ABC TRANSPORTER PERIPLASMIC-BINDING PROTEIN YTFQ
4y9t.1.A	12.81	monomer	HHblits	X-ray	1.80Å	0.27	0.73	ABC transporter, solute binding protein
2dgd.1.A	12.32	homo-octamer	HHblits	X-ray	2.90Å	0.27	0.73	223aa long hypothetical arylmalonate decarboxylase
4ry9.1.A	12.75	monomer	HHblits	X-ray	1.40Å	0.26	0.74	Periplasmic binding protein/LacI transcriptional regulator
4wzz.1.A	11.33	monomer	HHblits	X-ray	1.70Å	0.27	0.73	Putative sugar ABC transporter, substrate-binding protein
5ix8.1.A	9.27	monomer	HHblits	X-ray	1.60Å	0.26	0.74	Putative sugar ABC transport system, substrate-binding protein
2vlb.1.A	13.37	monomer	HHblits	X-ray	1.92Å	0.27	0.73	ARYLMALONATE DECARBOXYLASE
2vlb.2.A	13.37	monomer	HHblits	X-ray	1.92Å	0.27	0.73	ARYLMALONATE DECARBOXYLASE
2vlb.3.A	13.37	monomer	HHblits	X-ray	1.92Å	0.27	0.73	ARYLMALONATE DECARBOXYLASE
2vlb.4.A	13.37	monomer	HHblits	X-ray	1.92Å	0.27	0.73	ARYLMALONATE DECARBOXYLASE
4yv7.1.A	13.86	monomer	HHblits	X-ray	2.30Å	0.27	0.73	Periplasmic binding protein/LacI transcriptional regulator
1vpw.1.B	11.50	homo-dimer	HHblits	X-ray	2.70Å	0.27	0.72	PURINE REPRESSOR
5lfd.1.A	14.50	homo-hexamer	HHblits	X-ray	2.15Å	0.27	0.72	Allantoin racemase
4rsm.1.A	12.94	monomer	HHblits	X-ray	1.60Å	0.27	0.73	Periplasmic binding protein/LacI transcriptional regulator
3ixm.1.A	14.00	monomer	HHblits	X-ray	1.90Å	0.27	0.72	Arylmalonate decarboxylase
1jye.1.A	11.82	homo-dimer	HHblits	X-ray	1.70Å	0.26	0.73	Lactose Operon Repressor
3ma0.1.A	12.32	monomer	HHblits	X-ray	2.20Å	0.26	0.73	D-xylose-binding periplasmic protein
3m9w.1.A	12.32	monomer	HHblits	X-ray	2.15Å	0.26	0.73	D-xylose-binding periplasmic protein
5dkv.1.A	14.78	monomer	HHblits	X-ray	1.68Å	0.26	0.73	ABC transporter substrate binding protein (Ribose)
5dkv.4.A	14.78	monomer	HHblits	X-ray	1.68Å	0.26	0.73	ABC transporter substrate binding protein (Ribose)
3dg9.1.A	13.00	monomer	HHblits	X-ray	1.50Å	0.27	0.72	Arylmalonate decarboxylase
4ru1.1.A	14.00	monomer	HHblits	X-ray	1.50Å	0.27	0.72	Monosaccharide ABC transporter substrate-binding protein, CUT2 family
3dtv.3.A	13.57	monomer	HHblits	X-ray	2.10Å	0.27	0.72	Arylmalonate decarboxylase
3dtv.2.A	13.57	monomer	HHblits	X-ray	2.10Å	0.27	0.72	Arylmalonate decarboxylase
3dtv.1.A	13.57	monomer	HHblits	X-ray	2.10Å	0.27	0.72	Arylmalonate decarboxylase
3dtv.4.A	13.57	monomer	HHblits	X-ray	2.10Å	0.27	0.72	Arylmalonate decarboxylase
3eis.1.A	13.57	monomer	HHblits	X-ray	2.10Å	0.27	0.72	Arylmalonate decarboxylase
3eis.2.A	13.57	monomer	HHblits	X-ray	2.10Å	0.27	0.72	Arylmalonate decarboxylase
3k9c.1.A	11.00	homo-dimer	HHblits	X-ray	2.14Å	0.26	0.72	Transcriptional regulator, LacI family protein
3ixl.1.A	13.13	monomer	HHblits	X-ray	1.45Å	0.27	0.71	Arylmalonate decarboxylase
3hzr.1.A	9.79	homo-dimer	HHblits	X-ray	3.00Å	0.26	0.70	Tryptophanyl-tRNA synthetase
5koj.1.B	17.46	hetero-oligomer	HHblits	X-ray	2.59Å	0.27	0.68	Nitrogenase FeMo beta subunit protein NifK
2pju.1.B	15.88	homo-dimer	HHblits	X-ray	2.10Å	0.28	0.61	Propionate catabolism operon regulatory protein
2pju.1.A	15.88	homo-dimer	HHblits	X-ray	2.10Å	0.28	0.61	Propionate catabolism operon regulatory protein
2pju.2.B	15.88	homo-dimer	HHblits	X-ray	2.10Å	0.28	0.61	Propionate catabolism operon regulatory protein
4ry0.1.A	18.01	monomer	HHblits	X-ray	1.40Å	0.30	0.58	Probable ribose ABC transporter, substrate-binding protein
1dbp.1.A	17.50	monomer	HHblits	X-ray	2.20Å	0.29	0.58	D-RIBOSE-BINDING PROTEIN
1zhh.1.A	8.64	hetero-oligomer	HHblits	X-ray	1.94Å	0.25	0.58	Autoinducer 2-binding periplasmic protein luxP
4fx7.1.A	8.18	monomer	HHblits	X-ray	2.08Å	0.26	0.57	Imidazole glycerol phosphate synthase subunit HisF
3g1w.1.A	8.07	homo-dimer	HHblits	X-ray	2.02Å	0.25	0.58	Sugar ABC transporter
4x2r.1.A	17.31	monomer	HHblits	X-ray	1.05Å	0.27	0.56	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase
2bdq.1.A	15.44	homo-dimer	HHblits	X-ray	2.30Å	0.29	0.54	copper homeostasis protein CutC
4r9x.1.A	14.67	homo-dimer	HHblits	X-ray	1.85Å	0.27	0.54	Copper homeostasis protein CutC
4r9x.1.B	14.67	homo-dimer	HHblits	X-ray	1.85Å	0.27	0.54	Copper homeostasis protein CutC
5v96.1.A	14.38	monomer	HHblits	X-ray	2.00Å	0.27	0.53	S-adenosyl-l-homocysteine Hydrolase
4ccz.1.A	14.18	monomer	HHblits	X-ray	2.70Å	0.28	0.51	METHIONINE SYNTHASE
3bol.1.A	18.98	homo-dimer	HHblits	X-ray	1.85Å	0.30	0.49	5-methyltetrahydrofolate S-homocysteine methyltransferase
1q7m.2.A	18.98	monomer	HHblits	X-ray	2.10Å	0.30	0.49	5-methyltetrahydrofolate S-homocysteine methyltransferase
1q7q.1.A	18.98	monomer	HHblits	X-ray	3.10Å	0.30	0.49	5-methyltetrahydrofolate S-homocysteine methyltransferase
1q8a.2.A	18.98	monomer	HHblits	X-ray	1.70Å	0.30	0.49	5-methyltetrahydrofolate S-homocysteine methyltransferase
5dmm.1.A	16.67	monomer	HHblits	X-ray	1.78Å	0.26	0.50	Homocysteine S-methyltransferase
5dmn.1.A	16.67	homo-dimer	HHblits	X-ray	2.89Å	0.26	0.50	Homocysteine S-methyltransferase
5a9r.1.A	16.67	homo-dimer	HHblits	X-ray	1.55Å	0.29	0.48	IMINE REDUCTASE
5a9s.1.A	16.67	hetero-oligomer	HHblits	X-ray	2.06Å	0.29	0.48	IMINE REDUCTASE
5fwn.1.B	16.67	homo-dimer	HHblits	X-ray	2.14Å	0.29	0.48	IMINE REDUCTASE
3pef.1.A	14.39	homo-tetramer	HHblits	X-ray	2.07Å	0.28	0.48	6-phosphogluconate dehydrogenase, NAD-binding
3pef.2.C	14.39	homo-tetramer	HHblits	X-ray	2.07Å	0.28	0.48	6-phosphogluconate dehydrogenase, NAD-binding
1wau.1.A	11.11	homo-trimer	HHblits	X-ray	2.80Å	0.26	0.49	KHG/KDPG ALDOLASE
3t95.1.A	18.11	monomer	HHblits	X-ray	1.75Å	0.30	0.46	Autoinducer 2-binding protein lsrB
3pdu.1.A	16.92	homo-tetramer	HHblits	X-ray	1.89Å	0.28	0.47	3-hydroxyisobutyrate dehydrogenase family protein
2gf2.1.A	19.23	homo-dimer	HHblits	X-ray	2.38Å	0.28	0.47	3-hydroxyisobutyrate dehydrogenase
3obb.1.A	12.98	homo-tetramer	HHblits	X-ray	2.20Å	0.27	0.47	Probable 3-hydroxyisobutyrate dehydrogenase
2i9p.1.A	19.23	homo-tetramer	HHblits	X-ray	2.55Å	0.28	0.47	3-hydroxyisobutyrate dehydrogenase
4dll.1.A	12.21	homo-dimer	HHblits	X-ray	2.11Å	0.27	0.47	2-hydroxy-3-oxopropionate reductase
4mwa.1.A	16.67	homo-tetramer	HHblits	X-ray	1.85Å	0.29	0.45	4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
4mwa.1.B	16.67	homo-tetramer	HHblits	X-ray	1.85Å	0.29	0.45	4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
4mwa.1.C	16.67	homo-tetramer	HHblits	X-ray	1.85Å	0.29	0.45	4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
4mwa.1.D	16.67	homo-tetramer	HHblits	X-ray	1.85Å	0.29	0.45	4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
4mwa.2.B	16.67	homo-tetramer	HHblits	X-ray	1.85Å	0.29	0.45	4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
4mwa.2.D	16.67	homo-tetramer	HHblits	X-ray	1.85Å	0.29	0.45	4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
5bra.1.A	13.28	monomer	HHblits	X-ray	2.97Å	0.27	0.46	Putative periplasmic binding protein with substrate ribose
4yo7.1.A	14.52	monomer	HHblits	X-ray	1.70Å	0.29	0.45	Sugar ABC transporter (Sugar-binding protein)
1jh9.1.B	12.20	homo-dimer	HHblits	X-ray	2.55Å	0.29	0.44	PURINE NUCLEOTIDE SYNTHESIS REPRESSOR
3olz.1.A	12.21	homo-tetramer	HHblits	X-ray	2.75Å	0.24	0.47	Glutamate receptor, ionotropic kainate 3
3olz.1.B	12.21	homo-tetramer	HHblits	X-ray	2.75Å	0.24	0.47	Glutamate receptor, ionotropic kainate 3
2xpc.1.A	23.77	monomer	HHblits	X-ray	1.49Å	0.30	0.44	UDP-N-ACETYLMURAMOYLALANINE--D-GLUTAMATE LIGASE
3gbv.1.A	9.52	homo-dimer	HHblits	X-ray	2.20Å	0.27	0.45	Putative LacI-family transcriptional regulator
3gbv.1.B	9.52	homo-dimer	HHblits	X-ray	2.20Å	0.27	0.45	Putative LacI-family transcriptional regulator
3rot.1.A	14.29	homo-dimer	HHblits	X-ray	1.91Å	0.27	0.45	ABC sugar transporter, periplasmic sugar binding protein
4x9s.1.A	20.49	monomer	HHblits	X-ray	1.60Å	0.28	0.44	Phosphoribosyl isomerase A
4ywh.1.A	12.00	monomer	HHblits	X-ray	2.35Å	0.26	0.45	ABC TRANSPORTER SOLUTE BINDING PROTEIN
4o5a.1.A	10.48	homo-dimer	HHblits	X-ray	1.78Å	0.27	0.45	LacI family transcription regulator
1tlf.1.A	14.75	homo-tetramer	HHblits	X-ray	2.60Å	0.28	0.44	LAC REPRESSOR
1tlf.1.B	14.75	homo-tetramer	HHblits	X-ray	2.60Å	0.28	0.44	LAC REPRESSOR
1tlf.1.C	14.75	homo-tetramer	HHblits	X-ray	2.60Å	0.28	0.44	LAC REPRESSOR
1tlf.1.D	14.75	homo-tetramer	HHblits	X-ray	2.60Å	0.28	0.44	LAC REPRESSOR
3tdn.1.A	8.00	homo-dimer	HHblits	X-ray	1.40Å	0.26	0.45	FLR SYMMETRIC ALPHA-BETA TIM BARREL
1efa.1.C	14.75	homo-dimer	HHblits	X-ray	2.60Å	0.28	0.44	LAC REPRESSOR
1jwl.1.D	14.75	homo-dimer	HHblits	X-ray	4.00Å	0.28	0.44	Lactose Operon Repressor
4rk5.1.A	14.75	homo-dimer	HHblits	X-ray	1.35Å	0.28	0.44	Transcriptional regulator, LacI family
3brs.1.A	12.20	monomer	HHblits	X-ray	2.00Å	0.27	0.44	Periplasmic binding protein/LacI transcriptional regulator
4joq.1.A	14.75	homo-dimer	HHblits	X-ray	1.90Å	0.27	0.44	ABC ribose transporter, periplasmic solute-binding protein
4axk.1.A	17.21	monomer	HHblits	X-ray	2.25Å	0.27	0.44	1-(5-PHOSPHORIBOSYL)-5-((5'-PHOSPHORIBOSYLAMINO) METHYLIDENEAMINO)IMIDAZOLE-4-CARBOXAMIDE ISOMERASE
4axk.2.A	17.21	monomer	HHblits	X-ray	2.25Å	0.27	0.44	1-(5-PHOSPHORIBOSYL)-5-((5'-PHOSPHORIBOSYLAMINO) METHYLIDENEAMINO)IMIDAZOLE-4-CARBOXAMIDE ISOMERASE
2x30.1.A	17.50	monomer	HHblits	X-ray	1.95Å	0.28	0.43	PHOSPHORIBOSYL ISOMERASE A
3d6n.1.B	16.67	hetero-oligomer	HHblits	X-ray	2.30Å	0.28	0.43	Aspartate carbamoyltransferase
4wxe.1.A	15.83	monomer	HHblits	X-ray	1.50Å	0.28	0.43	Transcriptional regulator, LacI family
4rk3.1.A	14.88	homo-dimer	HHblits	X-ray	1.80Å	0.27	0.44	Transcriptional regulator, LacI family
1vzw.1.A	16.67	monomer	HHblits	X-ray	1.80Å	0.27	0.43	PHOSPHORIBOSYL ISOMERASE A
2vep.1.A	16.67	monomer	HHblits	X-ray	1.80Å	0.27	0.43	PHOSPHORIBOSYL ISOMERASE A
2y85.1.A	14.75	monomer	HHblits	X-ray	2.40Å	0.26	0.44	PHOSPHORIBOSYL ISOMERASE A
3zs4.1.A	14.75	monomer	HHblits	X-ray	1.90Å	0.26	0.44	PHOSPHORIBOSYL ISOMERASE A
3h9u.1.A	14.05	homo-octamer	HHblits	X-ray	1.90Å	0.26	0.44	Adenosylhomocysteinase
2y88.1.A	13.93	monomer	HHblits	X-ray	1.33Å	0.26	0.44	PHOSPHORIBOSYL ISOMERASE A
2y89.1.A	13.93	monomer	HHblits	X-ray	2.50Å	0.26	0.44	PHOSPHORIBOSYL ISOMERASE A
3tze.1.A	15.13	homo-dimer	HHblits	X-ray	2.60Å	0.28	0.43	Tryptophanyl-tRNA synthetase
4wd0.1.A	14.05	homo-hexamer	HHblits	X-ray	1.50Å	0.26	0.44	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase
3g85.1.A	14.05	monomer	HHblits	X-ray	1.84Å	0.26	0.44	Transcriptional regulator (LacI family)
4u28.1.A	16.95	monomer	HHblits	X-ray	1.33Å	0.28	0.43	Phosphoribosyl isomerase A
5ufh.1.A	10.00	homo-dimer	HHblits	X-ray	1.45Å	0.26	0.43	LacI-type transcriptional regulator
4tx9.1.A	16.10	monomer	HHblits	X-ray	1.60Å	0.27	0.43	Phosphoribosyl isomerase A
3g1u.1.A	15.00	homo-tetramer	HHblits	X-ray	2.20Å	0.26	0.43	Adenosylhomocysteinase
4obb.1.A	14.78	monomer	HHblits	X-ray	1.53Å	0.29	0.42	Amino acid/amide ABC transporter substrate-binding protein, HAAT family
4mlc.1.A	11.97	monomer	HHblits	X-ray	2.71Å	0.28	0.42	Extracellular ligand-binding receptor
4q6b.1.A	11.97	monomer	HHblits	X-ray	1.67Å	0.28	0.42	Extracellular ligand-binding receptor
5ide.1.B	8.26	hetero-oligomer	HHblits	EM	NA	0.25	0.44	Glutamate receptor 3
5ide.1.D	8.26	hetero-oligomer	HHblits	EM	NA	0.25	0.44	Glutamate receptor 3
5idf.1.B	8.26	hetero-oligomer	HHblits	EM	NA	0.25	0.44	Glutamate receptor 3
5idf.1.D	8.26	hetero-oligomer	HHblits	EM	NA	0.25	0.44	Glutamate receptor 3
3n0x.1.A	11.67	monomer	HHblits	X-ray	1.50Å	0.25	0.43	Possible substrate binding protein of ABC transporter system
4evs.1.A	10.43	monomer	HHblits	X-ray	1.45Å	0.26	0.42	PUTATIVE ABC TRANSPORTER SUBUNIT, SUBSTRATE-BINDING COMPONENT
3i09.1.A	14.78	monomer	HHblits	X-ray	1.80Å	0.26	0.42	Periplasmic branched-chain amino acid-binding protein
4f06.1.A	9.57	monomer	HHblits	X-ray	1.30Å	0.26	0.42	Extracellular ligand-binding receptor
1iu9.1.A	20.75	monomer	HHblits	X-ray	2.04Å	0.31	0.38	aspartate racemase
3n0w.1.A	8.70	monomer	HHblits	X-ray	1.88Å	0.24	0.42	ABC branched chain amino acid family transporter, periplasmic ligand binding protein
1v8b.1.A	22.22	homo-tetramer	HHblits	X-ray	2.40Å	0.29	0.39	adenosylhomocysteinase
1jfl.1.A	37.23	homo-dimer	BLAST	X-ray	1.90Å	0.39	0.34	ASPARTATE RACEMASE
4rk0.1.A	18.10	homo-dimer	HHblits	X-ray	1.80Å	0.29	0.38	LacI family sugar-binding transcriptional regulator
4rk0.1.B	18.10	homo-dimer	HHblits	X-ray	1.80Å	0.29	0.38	LacI family sugar-binding transcriptional regulator
2dx7.1.A	36.96	homo-dimer	BLAST	X-ray	2.00Å	0.39	0.33	aspartate racemase
2dx7.1.B	36.96	homo-dimer	BLAST	X-ray	2.00Å	0.39	0.33	aspartate racemase
3s81.1.A	16.50	homo-dimer	HHblits	X-ray	1.80Å	0.30	0.37	Putative aspartate racemase
2jfq.1.A	16.67	homo-dimer	HHblits	X-ray	2.15Å	0.30	0.37	GLUTAMATE RACEMASE
2jfq.1.B	16.67	homo-dimer	HHblits	X-ray	2.15Å	0.30	0.37	GLUTAMATE RACEMASE
3ojc.1.A	11.54	homo-tetramer	HHblits	X-ray	1.75Å	0.28	0.38	Putative aspartate/glutamate racemase
3ojc.1.B	11.54	homo-tetramer	HHblits	X-ray	1.75Å	0.28	0.38	Putative aspartate/glutamate racemase
3ojc.1.C	11.54	homo-tetramer	HHblits	X-ray	1.75Å	0.28	0.38	Putative aspartate/glutamate racemase
3ojc.1.D	11.54	homo-tetramer	HHblits	X-ray	1.75Å	0.28	0.38	Putative aspartate/glutamate racemase
1jfl.1.A	17.82	homo-dimer	HHblits	X-ray	1.90Å	0.30	0.36	ASPARTATE RACEMASE
2zsk.1.A	20.59	homo-dimer	HHblits	X-ray	2.55Å	0.29	0.37	226aa long hypothetical aspartate racemase
1zuw.1.A	18.63	homo-dimer	HHblits	X-ray	1.75Å	0.29	0.37	glutamate racemase 1
1zuw.1.B	18.63	homo-dimer	HHblits	X-ray	1.75Å	0.29	0.37	glutamate racemase 1
2dx7.1.A	16.83	homo-dimer	HHblits	X-ray	2.00Å	0.30	0.36	aspartate racemase
2dx7.1.B	16.83	homo-dimer	HHblits	X-ray	2.00Å	0.30	0.36	aspartate racemase
3gfg.1.A	22.00	homo-dimer	HHblits	X-ray	2.59Å	0.31	0.36	Uncharacterized oxidoreductase yvaA
5hqt.1.A	13.59	homo-dimer	HHblits	X-ray	1.60Å	0.28	0.37	aspartate/glutamate racemase
1vpd.1.A	20.00	monomer	HHblits	X-ray	1.65Å	0.30	0.36	TARTRONATE SEMIALDEHYDE REDUCTASE
5hj7.1.A	16.67	homo-dimer	HHblits	X-ray	2.30Å	0.29	0.37	Glutamate racemase
3out.1.A	16.67	homo-hexamer	HHblits	X-ray	1.65Å	0.28	0.37	Glutamate racemase
2jfw.1.A	14.71	homo-dimer	HHblits	X-ray	2.00Å	0.28	0.37	GLUTAMATE RACEMASE
3g0o.1.A	12.75	homo-dimer	HHblits	X-ray	1.80Å	0.28	0.37	3-hydroxyisobutyrate dehydrogenase
5elm.1.A	13.59	homo-dimer	HHblits	X-ray	2.00Å	0.27	0.37	Asp/Glu_racemase family protein
5elm.1.B	13.59	homo-dimer	HHblits	X-ray	2.00Å	0.27	0.37	Asp/Glu_racemase family protein
5elm.2.A	13.59	homo-dimer	HHblits	X-ray	2.00Å	0.27	0.37	Asp/Glu_racemase family protein
5elm.2.B	13.59	homo-dimer	HHblits	X-ray	2.00Å	0.27	0.37	Asp/Glu_racemase family protein
5ijw.1.A	14.71	homo-dimer	HHblits	X-ray	1.76Å	0.28	0.37	Glutamate racemase
5ijw.1.B	14.71	homo-dimer	HHblits	X-ray	1.76Å	0.28	0.37	Glutamate racemase
2gzm.1.A	17.82	homo-dimer	HHblits	X-ray	1.99Å	0.29	0.36	Glutamate racemase
2gzm.1.B	17.82	homo-dimer	HHblits	X-ray	1.99Å	0.29	0.36	Glutamate racemase
2gzm.2.B	17.82	homo-dimer	HHblits	X-ray	1.99Å	0.29	0.36	Glutamate racemase
2vvt.1.A	15.84	homo-dimer	HHblits	X-ray	1.65Å	0.29	0.36	GLUTAMATE RACEMASE
2vvt.1.B	15.84	homo-dimer	HHblits	X-ray	1.65Å	0.29	0.36	GLUTAMATE RACEMASE
5ell.1.A	11.65	homo-dimer	HHblits	X-ray	1.80Å	0.27	0.37	Asp/Glu_racemase family protein
5ell.1.B	11.65	homo-dimer	HHblits	X-ray	1.80Å	0.27	0.37	Asp/Glu_racemase family protein
2jfp.1.A	14.85	homo-dimer	HHblits	X-ray	1.98Å	0.28	0.36	GLUTAMATE RACEMASE
2jfo.1.B	14.85	homo-dimer	HHblits	X-ray	2.50Å	0.28	0.36	GLUTAMATE RACEMASE
5b19.1.A	16.83	homo-dimer	HHblits	X-ray	1.85Å	0.28	0.36	Aspartate racemase
5b19.1.B	16.83	homo-dimer	HHblits	X-ray	1.85Å	0.28	0.36	Aspartate racemase
3hfr.1.A	15.69	homo-dimer	HHblits	X-ray	2.30Å	0.27	0.37	Glutamate racemase
3hfr.1.B	15.69	homo-dimer	HHblits	X-ray	2.30Å	0.27	0.37	Glutamate racemase
2dwu.1.A	18.00	homo-dimer	HHblits	X-ray	1.60Å	0.28	0.36	Glutamate racemase
2dwu.2.A	18.00	homo-dimer	HHblits	X-ray	1.60Å	0.28	0.36	Glutamate racemase
5lfd.1.A	10.00	homo-hexamer	HHblits	X-ray	2.15Å	0.28	0.36	Allantoin racemase
2oho.1.A	8.91	homo-dimer	HHblits	X-ray	2.25Å	0.27	0.36	Glutamate Racemase
2oho.1.B	8.91	homo-dimer	HHblits	X-ray	2.25Å	0.27	0.36	Glutamate Racemase
2ohv.1.A	12.87	homo-dimer	HHblits	X-ray	2.50Å	0.27	0.36	Glutamate Racemase
2ohg.1.A	12.87	homo-dimer	HHblits	X-ray	2.50Å	0.27	0.36	Glutamate racemase
3qvj.1.A	10.89	homo-hexamer	HHblits	X-ray	2.10Å	0.27	0.36	Putative hydantoin racemase
2xec.1.A	18.37	homo-dimer	HHblits	X-ray	2.20Å	0.29	0.35	PUTATIVE MALEATE ISOMERASE
5w1q.1.A	14.00	homo-dimer	HHblits	X-ray	1.95Å	0.27	0.36	Glutamate racemase
3q3c.1.A	14.00	homo-tetramer	HHblits	X-ray	2.30Å	0.27	0.36	Probable 3-hydroxyisobutyrate dehydrogenase
3uho.1.A	14.00	monomer	HHblits	X-ray	2.20Å	0.27	0.36	Glutamate racemase
3uhf.2.A	14.00	monomer	HHblits	X-ray	1.83Å	0.27	0.36	Glutamate racemase
3uhp.1.A	14.00	monomer	HHblits	X-ray	2.79Å	0.27	0.36	Glutamate racemase
2pn1.1.A	10.78	homo-dimer	HHblits	X-ray	2.00Å	0.25	0.37	Carbamoylphosphate synthase large subunit
3qvl.1.A	12.12	homo-hexamer	HHblits	X-ray	1.82Å	0.27	0.36	Putative hydantoin racemase
1c30.1.A	13.40	hetero-oligomer	HHblits	X-ray	2.00Å	0.28	0.35	CARBAMOYL PHOSPHATE SYNTHETASE: LARGE SUBUNIT
1bxr.1.A	13.40	hetero-oligomer	HHblits	X-ray	2.10Å	0.28	0.35	CARBAMOYL-PHOSPHATE SYNTHASE
2dgd.1.A	14.29	homo-octamer	HHblits	X-ray	2.90Å	0.27	0.35	223aa long hypothetical arylmalonate decarboxylase
2vlb.1.A	12.12	monomer	HHblits	X-ray	1.92Å	0.26	0.36	ARYLMALONATE DECARBOXYLASE
2vlb.2.A	12.12	monomer	HHblits	X-ray	1.92Å	0.26	0.36	ARYLMALONATE DECARBOXYLASE
2vlb.3.A	12.12	monomer	HHblits	X-ray	1.92Å	0.26	0.36	ARYLMALONATE DECARBOXYLASE
2vlb.4.A	12.12	monomer	HHblits	X-ray	1.92Å	0.26	0.36	ARYLMALONATE DECARBOXYLASE
3dg9.1.A	12.12	monomer	HHblits	X-ray	1.50Å	0.26	0.36	Arylmalonate decarboxylase
2bdq.1.A	15.46	homo-dimer	HHblits	X-ray	2.30Å	0.28	0.35	copper homeostasis protein CutC
3ixm.1.A	12.24	monomer	HHblits	X-ray	1.90Å	0.26	0.35	Arylmalonate decarboxylase
3dtv.3.A	12.37	monomer	HHblits	X-ray	2.10Å	0.26	0.35	Arylmalonate decarboxylase
3dtv.2.A	12.37	monomer	HHblits	X-ray	2.10Å	0.26	0.35	Arylmalonate decarboxylase
3dtv.1.A	12.37	monomer	HHblits	X-ray	2.10Å	0.26	0.35	Arylmalonate decarboxylase
3dtv.4.A	12.37	monomer	HHblits	X-ray	2.10Å	0.26	0.35	Arylmalonate decarboxylase
3eis.1.A	12.37	monomer	HHblits	X-ray	2.10Å	0.26	0.35	Arylmalonate decarboxylase
3eis.2.A	12.37	monomer	HHblits	X-ray	2.10Å	0.26	0.35	Arylmalonate decarboxylase
3ixl.1.A	10.20	monomer	HHblits	X-ray	1.45Å	0.25	0.35	Arylmalonate decarboxylase
3lq1.1.A	11.70	homo-dimer	HHblits	X-ray	2.60Å	0.28	0.34	2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase
2jfn.1.A	9.47	monomer	HHblits	X-ray	1.90Å	0.27	0.34	GLUTAMATE RACEMASE
2rir.1.A	13.04	homo-tetramer	HHblits	X-ray	2.79Å	0.28	0.33	Dipicolinate synthase, A chain
2rir.1.B	13.04	homo-tetramer	HHblits	X-ray	2.79Å	0.28	0.33	Dipicolinate synthase, A chain
3d4o.1.A	11.96	homo-dimer	HHblits	X-ray	2.10Å	0.27	0.33	Dipicolinate synthase subunit A
3d4o.1.B	11.96	homo-dimer	HHblits	X-ray	2.10Å	0.27	0.33	Dipicolinate synthase subunit A
1ez1.1.A	13.83	homo-dimer	HHblits	X-ray	1.75Å	0.25	0.34	PHOSPHORIBOSYLGLYCINAMIDE FORMYLTRANSFERASE 2
1ez1.1.B	13.83	homo-dimer	HHblits	X-ray	1.75Å	0.25	0.34	PHOSPHORIBOSYLGLYCINAMIDE FORMYLTRANSFERASE 2
2x7j.1.A	15.22	homo-tetramer	HHblits	X-ray	2.35Å	0.27	0.33	2-SUCCINYL-5-ENOLPYRUVYL-6-HYDROXY-3-CYCLOHEXENE -1-CARBOXYLATE SYNTHASE
1kji.1.A	12.77	homo-dimer	HHblits	X-ray	1.60Å	0.25	0.34	phosphoribosylglycinamide formyltransferase 2
1kji.1.B	12.77	homo-dimer	HHblits	X-ray	1.60Å	0.25	0.34	phosphoribosylglycinamide formyltransferase 2
4hnu.1.A	10.75	homo-tetramer	HHblits	X-ray	3.00Å	0.26	0.34	Pyruvate carboxylase
4hnu.1.B	10.75	homo-tetramer	HHblits	X-ray	3.00Å	0.26	0.34	Pyruvate carboxylase
4hnu.1.C	10.75	homo-tetramer	HHblits	X-ray	3.00Å	0.26	0.34	Pyruvate carboxylase
4hnu.1.D	10.75	homo-tetramer	HHblits	X-ray	3.00Å	0.26	0.34	Pyruvate carboxylase
1gso.1.A	13.19	monomer	HHblits	X-ray	1.60Å	0.27	0.33	PROTEIN (GLYCINAMIDE RIBONUCLEOTIDE SYNTHETASE)
3lp8.1.A	21.35	monomer	HHblits	X-ray	2.15Å	0.29	0.32	Phosphoribosylamine-glycine ligase
4hnv.1.A	9.78	homo-tetramer	HHblits	X-ray	2.80Å	0.26	0.33	Pyruvate carboxylase
4hnv.1.B	9.78	homo-tetramer	HHblits	X-ray	2.80Å	0.26	0.33	Pyruvate carboxylase
4hnv.1.C	9.78	homo-tetramer	HHblits	X-ray	2.80Å	0.26	0.33	Pyruvate carboxylase
4hnv.1.D	9.78	homo-tetramer	HHblits	X-ray	2.80Å	0.26	0.33	Pyruvate carboxylase
3bg5.1.A	10.87	homo-tetramer	HHblits	X-ray	2.80Å	0.26	0.33	Pyruvate carboxylase
3bg5.1.B	10.87	homo-tetramer	HHblits	X-ray	2.80Å	0.26	0.33	Pyruvate carboxylase
3bg5.1.C	10.87	homo-tetramer	HHblits	X-ray	2.80Å	0.26	0.33	Pyruvate carboxylase
3bg5.1.D	10.87	homo-tetramer	HHblits	X-ray	2.80Å	0.26	0.33	Pyruvate carboxylase
4hnt.1.A	10.87	homo-tetramer	HHblits	X-ray	2.80Å	0.26	0.33	Pyruvate carboxylase
4hnt.1.B	10.87	homo-tetramer	HHblits	X-ray	2.80Å	0.26	0.33	Pyruvate carboxylase
4hnt.1.C	10.87	homo-tetramer	HHblits	X-ray	2.80Å	0.26	0.33	Pyruvate carboxylase
4hnt.1.D	10.87	homo-tetramer	HHblits	X-ray	2.80Å	0.26	0.33	Pyruvate carboxylase
5mlk.1.A	13.19	homo-dimer	HHblits	X-ray	1.94Å	0.27	0.33	Acetyl-COA carboxylase
3mjf.1.A	12.09	monomer	HHblits	X-ray	1.47Å	0.27	0.33	Phosphoribosylamine--glycine ligase
2qk4.1.A	12.09	monomer	HHblits	X-ray	2.45Å	0.26	0.33	Trifunctional purine biosynthetic protein adenosine-3
2fss.1.A	14.61	homo-dimer	HHblits	X-ray	1.70Å	0.28	0.32	formate dehydrogenase
2fss.1.B	14.61	homo-dimer	HHblits	X-ray	1.70Å	0.28	0.32	formate dehydrogenase
2fss.2.A	14.61	homo-dimer	HHblits	X-ray	1.70Å	0.28	0.32	formate dehydrogenase
4qsh.1.A	11.11	homo-tetramer	HHblits	X-ray	2.51Å	0.27	0.32	Pyruvate carboxylase
3lp6.1.B	22.35	homo-octamer	HHblits	X-ray	1.70Å	0.31	0.31	Phosphoribosylaminoimidazole carboxylase catalytic subunit
3lp6.1.A	22.35	homo-octamer	HHblits	X-ray	1.70Å	0.31	0.31	Phosphoribosylaminoimidazole carboxylase catalytic subunit
4zht.1.A	10.99	homo-tetramer	HHblits	X-ray	2.69Å	0.25	0.33	Bifunctional UDP-N-acetylglucosamine 2-epimerase/N-acetylmannosamine kinase
3gid.1.A	8.89	monomer	HHblits	X-ray	2.30Å	0.26	0.32	Acetyl-CoA carboxylase 2
3gid.2.A	8.89	monomer	HHblits	X-ray	2.30Å	0.26	0.32	Acetyl-CoA carboxylase 2
3glk.1.A	8.89	monomer	HHblits	X-ray	2.10Å	0.26	0.32	Acetyl-CoA carboxylase 2
5kkn.2.A	8.89	monomer	HHblits	X-ray	2.60Å	0.26	0.32	Acetyl-CoA carboxylase 2
5kkn.1.A	8.89	monomer	HHblits	X-ray	2.60Å	0.26	0.32	Acetyl-CoA carboxylase 2
4hq6.1.A	10.11	monomer	HHblits	X-ray	2.70Å	0.27	0.32	Acetyl-CoA carboxylase 2
1ulz.1.A	8.89	homo-dimer	HHblits	X-ray	2.20Å	0.26	0.32	pyruvate carboxylase n-terminal domain
3nkl.1.A	16.09	homo-dimer	HHblits	X-ray	1.90Å	0.28	0.31	UDP-D-quinovosamine 4-dehydrogenase
3nkl.1.B	16.09	homo-dimer	HHblits	X-ray	1.90Å	0.28	0.31	UDP-D-quinovosamine 4-dehydrogenase
4mv4.2.A	11.11	monomer	HHblits	X-ray	1.61Å	0.26	0.32	Biotin carboxylase
2ys6.1.A	13.48	monomer	HHblits	X-ray	2.21Å	0.26	0.32	Phosphoribosylglycinamide synthetase
3ouu.1.A	13.48	homo-dimer	HHblits	X-ray	2.25Å	0.26	0.32	Biotin carboxylase
5tov.1.A	17.24	homo-tetramer	HHblits	X-ray	1.90Å	0.28	0.31	Adenosylhomocysteinase
5tov.1.B	17.24	homo-tetramer	HHblits	X-ray	1.90Å	0.28	0.31	Adenosylhomocysteinase
2ip4.1.A	12.50	monomer	HHblits	X-ray	2.80Å	0.27	0.32	Phosphoribosylamine--glycine ligase
2ip4.2.A	12.50	monomer	HHblits	X-ray	2.80Å	0.27	0.32	Phosphoribosylamine--glycine ligase
2c00.1.A	8.79	monomer	HHblits	X-ray	2.50Å	0.24	0.33	BIOTIN CARBOXYLASE
2c00.2.A	8.79	monomer	HHblits	X-ray	2.50Å	0.24	0.33	BIOTIN CARBOXYLASE
2vqd.1.A	8.79	monomer	HHblits	X-ray	2.41Å	0.24	0.33	BIOTIN CARBOXYLASE
2gps.1.A	13.33	monomer	HHblits	X-ray	2.80Å	0.25	0.32	Biotin carboxylase
1iu9.1.A	16.67	monomer	HHblits	X-ray	2.04Å	0.30	0.30	aspartate racemase
2dzd.1.A	8.89	homo-dimer	HHblits	X-ray	2.40Å	0.25	0.32	pyruvate carboxylase
3g8d.1.A	14.77	monomer	HHblits	X-ray	1.90Å	0.26	0.32	Biotin carboxylase
5h80.1.A	10.11	homo-dimer	HHblits	X-ray	1.70Å	0.25	0.32	Carboxylase
4qsk.1.A	11.49	homo-tetramer	HHblits	X-ray	2.70Å	0.27	0.31	Pyruvate carboxylase
4ay3.1.A	30.00	homo-dimer	HHblits	X-ray	1.76Å	0.34	0.29	N5-CARBOXYAMINOIMIDAZOLE RIBONUCLEOTIDE MUTASE
4b4k.1.C	30.00	homo-octamer	HHblits	X-ray	2.50Å	0.34	0.29	N5-CARBOXYAMINOIMIDAZOLE RIBONUCLEOTIDE MUTASE
3btv.1.A	17.07	homo-dimer	HHblits	X-ray	2.10Å	0.31	0.30	Galactose/lactose metabolism regulatory protein GAL80
3bts.1.A	17.07	hetero-oligomer	HHblits	X-ray	2.70Å	0.31	0.30	Galactose/lactose metabolism regulatory protein GAL80
3bts.1.B	17.07	hetero-oligomer	HHblits	X-ray	2.70Å	0.31	0.30	Galactose/lactose metabolism regulatory protein GAL80
2yya.1.A	8.05	monomer	HHblits	X-ray	2.40Å	0.27	0.31	Phosphoribosylamine--glycine ligase
1tm2.1.A	10.59	monomer	HHblits	X-ray	1.90Å	0.29	0.31	sugar transport protein
1tjy.1.A	10.59	monomer	HHblits	X-ray	1.30Å	0.29	0.31	sugar transport protein
4r9x.1.A	19.05	homo-dimer	HHblits	X-ray	1.85Å	0.29	0.30	Copper homeostasis protein CutC
4r9x.1.B	19.05	homo-dimer	HHblits	X-ray	1.85Å	0.29	0.30	Copper homeostasis protein CutC
4grd.1.A	23.17	homo-octamer	HHblits	X-ray	1.85Å	0.31	0.30	Phosphoribosylaminoimidazole carboxylase catalytic subunit
4pz0.1.A	12.94	monomer	HHblits	X-ray	1.25Å	0.28	0.31	sugar ABC transporter, sugar-binding protein
2gpw.1.A	14.77	monomer	HHblits	X-ray	2.20Å	0.26	0.32	Biotin carboxylase
2gpw.4.A	14.77	monomer	HHblits	X-ray	2.20Å	0.26	0.32	Biotin carboxylase
2vpq.1.A	6.82	homo-dimer	HHblits	X-ray	2.10Å	0.26	0.32	ACETYL-COA CARBOXYLASE
1dv2.1.A	14.77	monomer	HHblits	X-ray	2.50Å	0.25	0.32	BIOTIN CARBOXYLASE
2hjs.1.A	11.63	homo-dimer	HHblits	X-ray	2.20Å	0.27	0.31	USG-1 protein homolog
3opq.1.A	24.69	homo-octamer	HHblits	X-ray	2.00Å	0.32	0.29	Phosphoribosylaminoimidazole carboxylase,catalytic subunit
3u9s.1.A	9.09	hetero-oligomer	HHblits	X-ray	3.50Å	0.25	0.32	Methylcrotonyl-CoA carboxylase, alpha-subunit
3u9t.1.A	9.09	hetero-oligomer	HHblits	X-ray	2.90Å	0.25	0.32	Methylcrotonyl-CoA carboxylase, alpha-subunit
4kqc.1.A	23.17	monomer	HHblits	X-ray	1.62Å	0.31	0.30	Periplasmic binding protein/LacI transcriptional regulator
1xtu.1.A	14.12	homo-tetramer	HHblits	X-ray	2.80Å	0.28	0.31	Probable uracil phosphoribosyltransferase
3g6w.1.A	14.12	homo-tetramer	HHblits	X-ray	2.90Å	0.28	0.31	Uracil phosphoribosyltransferase
3g6w.1.B	14.12	homo-tetramer	HHblits	X-ray	2.90Å	0.28	0.31	Uracil phosphoribosyltransferase
1xtv.1.B	14.12	homo-tetramer	HHblits	X-ray	2.60Å	0.28	0.31	Probable uracil phosphoribosyltransferase
1xtv.1.C	14.12	homo-tetramer	HHblits	X-ray	2.60Å	0.28	0.31	Probable uracil phosphoribosyltransferase
1xtt.1.A	14.12	homo-tetramer	HHblits	X-ray	1.80Å	0.28	0.31	Probable uracil phosphoribosyltransferase
1xtt.1.B	14.12	homo-tetramer	HHblits	X-ray	1.80Å	0.28	0.31	Probable uracil phosphoribosyltransferase
1vst.1.A	14.12	homo-tetramer	HHblits	X-ray	2.80Å	0.28	0.31	Uracil phosphoribosyltransferase
3ejw.1.A	14.29	monomer	HHblits	X-ray	1.80Å	0.29	0.30	SmLsrB
1wbh.1.A	14.12	homo-trimer	HHblits	X-ray	1.55Å	0.28	0.31	KHG/KDPG ALDOLASE
2xcl.1.A	10.34	monomer	HHblits	X-ray	2.10Å	0.26	0.31	PHOSPHORIBOSYLAMINE--GLYCINE LIGASE
2pn1.1.A	11.76	homo-dimer	HHblits	X-ray	2.00Å	0.27	0.31	Carbamoylphosphate synthase large subunit
5kws.1.A	20.73	monomer	HHblits	X-ray	1.32Å	0.30	0.30	Galactose-binding protein
5ktk.1.A	13.10	monomer	HHblits	X-ray	1.98Å	0.28	0.30	Polyketide synthase PksJ
3g8c.1.A	11.49	monomer	HHblits	X-ray	2.00Å	0.25	0.31	Biotin carboxylase
3g8c.2.A	11.49	monomer	HHblits	X-ray	2.00Å	0.25	0.31	Biotin carboxylase
2w6m.1.A	11.49	monomer	HHblits	X-ray	2.00Å	0.25	0.31	BIOTIN CARBOXYLASE
1bnc.1.B	11.49	homo-dimer	HHblits	X-ray	2.40Å	0.25	0.31	BIOTIN CARBOXYLASE
1bnc.1.A	11.49	homo-dimer	HHblits	X-ray	2.40Å	0.25	0.31	BIOTIN CARBOXYLASE
4hr7.1.A	11.49	hetero-oligomer	HHblits	X-ray	2.50Å	0.25	0.31	Biotin carboxylase
4hr7.1.C	11.49	hetero-oligomer	HHblits	X-ray	2.50Å	0.25	0.31	Biotin carboxylase
4hr7.1.E	11.49	hetero-oligomer	HHblits	X-ray	2.50Å	0.25	0.31	Biotin carboxylase
4hr7.1.F	11.49	hetero-oligomer	HHblits	X-ray	2.50Å	0.25	0.31	Biotin carboxylase
2j9g.2.A	11.49	monomer	HHblits	X-ray	2.05Å	0.25	0.31	BIOTIN CARBOXYLASE
2vr1.2.A	11.49	monomer	HHblits	X-ray	2.60Å	0.25	0.31	BIOTIN CARBOXYLASE
5vev.1.A	9.41	monomer	HHblits	X-ray	1.90Å	0.27	0.31	Phosphoribosylamine--glycine ligase
5eqv.1.A	19.51	monomer	HHblits	X-ray	1.45Å	0.29	0.30	bifunctional 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase periplasmic precursor protein
2jfy.1.B	12.94	homo-dimer	HHblits	X-ray	1.90Å	0.26	0.31	GLUTAMATE RACEMASE
2jfz.1.A	12.94	homo-dimer	HHblits	X-ray	1.86Å	0.26	0.31	GLUTAMATE RACEMASE
2jfx.1.A	12.94	homo-dimer	HHblits	X-ray	2.30Å	0.26	0.31	GLUTAMATE RACEMASE
2jfx.1.B	12.94	homo-dimer	HHblits	X-ray	2.30Å	0.26	0.31	GLUTAMATE RACEMASE
2jfy.1.A	12.94	homo-dimer	HHblits	X-ray	1.90Å	0.26	0.31	GLUTAMATE RACEMASE
4b1f.1.B	12.94	homo-dimer	HHblits	X-ray	2.05Å	0.26	0.31	GLUTAMATE RACEMASE
2w4i.1.A	12.94	homo-tetramer	HHblits	X-ray	1.87Å	0.26	0.31	GLUTAMATE RACEMASE
3rv3.1.A	9.20	homo-dimer	HHblits	X-ray	1.91Å	0.25	0.31	Biotin carboxylase
4iil.1.A	15.48	monomer	HHblits	X-ray	1.30Å	0.27	0.30	Membrane lipoprotein TpN38(b)
1o5o.1.A	18.52	homo-tetramer	HHblits	X-ray	2.30Å	0.30	0.29	Uracil phosphoribosyltransferase
4nv3.1.A	16.05	monomer	HHblits	X-ray	1.09Å	0.30	0.29	Amino acid/amide ABC transporter substrate-binding protein, HAAT family
4z0n.1.A	18.52	monomer	HHblits	X-ray	1.26Å	0.30	0.29	Periplasmic binding protein/LacI transcriptional regulator
1h6c.1.A	15.85	homo-tetramer	HHblits	X-ray	2.20Å	0.28	0.30	PRECURSOR FORM OF GLUCOSE-FRUCTOSE OXIDOREDUCTASE
2ehj.1.A	17.50	homo-tetramer	HHblits	X-ray	2.80Å	0.30	0.29	Uracil phosphoribosyltransferase
2ehj.1.C	17.50	homo-tetramer	HHblits	X-ray	2.80Å	0.30	0.29	Uracil phosphoribosyltransferase
3ors.1.A	23.08	homo-octamer	HHblits	X-ray	1.45Å	0.32	0.28	N5-Carboxyaminoimidazole Ribonucleotide Mutase
3ors.1.B	23.08	homo-octamer	HHblits	X-ray	1.45Å	0.32	0.28	N5-Carboxyaminoimidazole Ribonucleotide Mutase
3ors.1.E	23.08	homo-octamer	HHblits	X-ray	1.45Å	0.32	0.28	N5-Carboxyaminoimidazole Ribonucleotide Mutase
1nvm.1.B	17.07	hetero-oligomer	HHblits	X-ray	1.70Å	0.28	0.30	acetaldehyde dehydrogenase (acylating)
1nvm.2.B	17.07	hetero-oligomer	HHblits	X-ray	1.70Å	0.28	0.30	acetaldehyde dehydrogenase (acylating)
2pud.1.B	11.11	homo-dimer	HHblits	X-ray	2.60Å	0.29	0.29	PROTEIN (PURINE REPRESSOR)
3oow.1.A	25.97	homo-octamer	HHblits	X-ray	1.75Å	0.33	0.28	Phosphoribosylaminoimidazole carboxylase,catalytic subunit
3gbp.1.A	21.25	monomer	HHblits	X-ray	2.40Å	0.30	0.29	GALACTOSE-BINDING PROTEIN
1jfs.1.B	11.11	homo-dimer	HHblits	X-ray	2.90Å	0.29	0.29	PURINE NUCLEOTIDE SYNTHESIS REPRESSOR
1bdi.1.B	11.11	homo-dimer	HHblits	X-ray	3.00Å	0.29	0.29	PROTEIN (PURINE REPRESSOR)
2p9h.1.A	16.05	homo-dimer	HHblits	X-ray	2.00Å	0.29	0.29	Lactose operon repressor
4gmg.1.A	7.06	homo-dimer	HHblits	X-ray	2.31Å	0.25	0.31	Yersiniabactin biosynthetic protein YbtU
5kvq.1.B	7.06	homo-dimer	HHblits	X-ray	1.45Å	0.25	0.31	Irp3 protein
1glg.1.A	20.00	monomer	HHblits	X-ray	2.00Å	0.30	0.29	GALACTOSE/GLUCOSE-BINDING PROTEIN
2qw1.1.A	20.00	monomer	HHblits	X-ray	1.70Å	0.30	0.29	D-galactose-binding periplasmic protein
2fvy.1.A	20.00	monomer	HHblits	X-ray	0.92Å	0.30	0.29	D-galactose-binding periplasmic protein
2ipm.1.A	20.00	monomer	HHblits	X-ray	1.12Å	0.30	0.29	D-galactose-binding periplasmic protein
3bo9.1.A	16.25	homo-dimer	HHblits	X-ray	2.71Å	0.30	0.29	Putative nitroalkan dioxygenase
4wwh.1.A	17.28	monomer	HHblits	X-ray	1.20Å	0.29	0.29	ABC transporter
1jft.1.B	11.11	homo-dimer	HHblits	X-ray	2.50Å	0.29	0.29	PURINE NUCLEOTIDE SYNTHESIS REPRESSOR
2hph.1.A	18.75	monomer	HHblits	X-ray	1.33Å	0.29	0.29	D-galactose-binding periplasmic protein
3s99.1.A	10.98	monomer	HHblits	X-ray	2.05Å	0.27	0.30	Basic membrane lipoprotein
4iil.1.A	18.75	monomer	HHblits	X-ray	1.30Å	0.29	0.29	Membrane lipoprotein TpN38(b)
4p98.1.A	12.05	monomer	HHblits	X-ray	1.90Å	0.26	0.30	Extracellular solute-binding protein
4iql.1.A	16.05	homo-dimer	HHblits	X-ray	1.94Å	0.28	0.29	Enoyl-(Acyl-carrier-protein) reductase II
2ipn.1.A	18.75	monomer	HHblits	X-ray	1.15Å	0.29	0.29	D-galactose-binding periplasmic protein
2ipl.1.A	20.25	monomer	HHblits	X-ray	1.20Å	0.30	0.29	D-galactose-binding periplasmic protein
3rc1.1.A	14.63	monomer	HHblits	X-ray	1.71Å	0.27	0.30	Sugar 3-ketoreductase
3i45.1.A	15.48	monomer	HHblits	X-ray	1.36Å	0.25	0.30	Twin-arginine translocation pathway signal protein
4zjp.1.A	18.75	monomer	HHblits	X-ray	1.63Å	0.29	0.29	Monosaccharide-transporting ATPase
3gfg.1.A	13.58	homo-dimer	HHblits	X-ray	2.59Å	0.28	0.29	Uncharacterized oxidoreductase yvaA
3trh.1.A	23.08	homo-octamer	HHblits	X-ray	2.20Å	0.31	0.28	Phosphoribosylaminoimidazole carboxylase carboxyltransferase subunit
1z16.1.A	15.00	monomer	HHblits	X-ray	1.72Å	0.28	0.29	Leu/Ile/Val-binding protein
1z15.1.A	15.00	monomer	HHblits	X-ray	1.70Å	0.28	0.29	Leu/Ile/Val-binding protein
3ec7.1.A	15.19	homo-tetramer	HHblits	X-ray	2.15Å	0.29	0.29	Putative Dehydrogenase
4n54.1.A	12.35	homo-tetramer	HHblits	X-ray	2.05Å	0.27	0.29	Inositol dehydrogenase
4n54.1.C	12.35	homo-tetramer	HHblits	X-ray	2.05Å	0.27	0.29	Inositol dehydrogenase
4n54.1.D	12.35	homo-tetramer	HHblits	X-ray	2.05Å	0.27	0.29	Inositol dehydrogenase
3q2k.1.A	15.38	homo-octamer	HHblits	X-ray	2.13Å	0.30	0.28	oxidoreductase
3q2k.1.B	15.38	homo-octamer	HHblits	X-ray	2.13Å	0.30	0.28	oxidoreductase
3hut.1.A	16.25	monomer	HHblits	X-ray	1.93Å	0.28	0.29	putative branched-chain amino acid ABC transporter
2hqb.1.A	12.66	monomer	HHblits	X-ray	2.70Å	0.28	0.29	Transcriptional activator of comK gene
4irx.1.A	12.82	monomer	HHblits	X-ray	1.45Å	0.29	0.28	Sugar ABC transporter, periplasmic sugar-binding protein
3uk0.1.A	18.99	monomer	HHblits	X-ray	1.49Å	0.28	0.29	Extracellular ligand-binding receptor
1f6d.1.B	15.00	homo-dimer	HHblits	X-ray	2.50Å	0.27	0.29	UDP-N-ACETYLGLUCOSAMINE 2-EPIMERASE
1f6d.1.A	15.00	homo-dimer	HHblits	X-ray	2.50Å	0.27	0.29	UDP-N-ACETYLGLUCOSAMINE 2-EPIMERASE
4gnr.1.A	8.75	monomer	HHblits	X-ray	1.00Å	0.27	0.29	ABC transporter substrate-binding protein-branched chain amino acid transport
4ycs.1.A	15.38	monomer	HHblits	X-ray	1.98Å	0.28	0.28	Uncharacterized protein
4ycs.2.A	15.38	monomer	HHblits	X-ray	1.98Å	0.28	0.28	Uncharacterized protein
3h5l.1.A	8.43	monomer	HHblits	X-ray	1.70Å	0.23	0.30	putative Branched-chain amino acid ABC transporter
3rc7.1.A	16.88	monomer	HHblits	X-ray	2.00Å	0.29	0.28	Sugar 3-ketoreductase
3lft.1.A	20.78	monomer	HHblits	X-ray	1.35Å	0.28	0.28	uncharacterized protein
3q2i.1.A	15.58	homo-octamer	HHblits	X-ray	1.50Å	0.28	0.28	dehydrogenase
4iq0.1.A	11.69	homo-dimer	HHblits	X-ray	2.00Å	0.28	0.28	Oxidoreductase, Gfo/Idh/MocA family
4iq0.2.B	11.69	homo-dimer	HHblits	X-ray	2.00Å	0.28	0.28	Oxidoreductase, Gfo/Idh/MocA family
3btv.1.A	18.42	homo-dimer	HHblits	X-ray	2.10Å	0.29	0.27	Galactose/lactose metabolism regulatory protein GAL80
3bts.1.A	18.42	hetero-oligomer	HHblits	X-ray	2.70Å	0.29	0.27	Galactose/lactose metabolism regulatory protein GAL80
3bts.1.B	18.42	hetero-oligomer	HHblits	X-ray	2.70Å	0.29	0.27	Galactose/lactose metabolism regulatory protein GAL80
5dn1.1.A	19.74	monomer	HHblits	X-ray	1.95Å	0.28	0.27	Phosphoribosyl isomerase A
1gub.1.A	7.59	monomer	HHblits	X-ray	3.10Å	0.25	0.29	D-ALLOSE-BINDING PERIPLASMIC PROTEIN
1gud.1.A	7.59	monomer	HHblits	X-ray	1.71Å	0.25	0.29	D-ALLOSE-BINDING PERIPLASMIC PROTEIN
1gud.2.A	7.59	monomer	HHblits	X-ray	1.71Å	0.25	0.29	D-ALLOSE-BINDING PERIPLASMIC PROTEIN
1rpj.1.A	7.59	monomer	HHblits	X-ray	1.80Å	0.25	0.29	PROTEIN (PRECURSOR OF PERIPLASMIC SUGAR RECEPTOR)
4jb0.1.A	15.38	monomer	HHblits	X-ray	1.91Å	0.26	0.28	branched-chain amino acid transport system substrate-binding protein
3tx6.1.A	16.88	monomer	HHblits	X-ray	1.50Å	0.27	0.28	Putative branched-chain amino acid transport system substrate-binding protein
1qh1.1.B	9.09	hetero-oligomer	HHblits	X-ray	1.60Å	0.27	0.28	PROTEIN (NITROGENASE MOLYBDENUM IRON PROTEIN)
4ew6.1.A	12.99	homo-dimer	HHblits	X-ray	2.30Å	0.27	0.28	D-galactose-1-dehydrogenase protein
3p74.1.A	17.33	monomer	HHblits	X-ray	1.20Å	0.29	0.27	Pentaerythritol tetranitrate reductase
3q2i.1.A	11.69	homo-octamer	HHblits	X-ray	1.50Å	0.26	0.28	dehydrogenase
3p84.1.A	17.33	monomer	HHblits	X-ray	1.10Å	0.29	0.27	Pentaerythritol tetranitrate reductase
2vpt.1.A	11.84	homo-dimer	HHblits	X-ray	1.40Å	0.27	0.27	LIPOLYTIC ENZYME
3p82.1.A	17.33	monomer	HHblits	X-ray	2.20Å	0.28	0.27	Pentaerythritol tetranitrate reductase
1vys.1.A	16.22	monomer	HHblits	X-ray	1.80Å	0.28	0.27	PENTAERYTHRITOL TETRANITRATE REDUCTASE
2qiw.1.A	17.81	homo-dimer	HHblits	X-ray	1.80Å	0.29	0.26	PEP phosphonomutase
2abb.1.A	16.22	monomer	HHblits	X-ray	1.00Å	0.28	0.27	pentaerythritol tetranitrate reductase
3p81.1.A	16.22	monomer	HHblits	X-ray	1.20Å	0.28	0.27	Pentaerythritol tetranitrate reductase
3qlv.1.C	15.07	hetero-oligomer	HHblits	X-ray	3.94Å	0.29	0.26	Glutamate receptor, ionotropic kainate 2
3h6g.1.A	15.07	homo-dimer	HHblits	X-ray	2.70Å	0.29	0.26	Glutamate receptor, ionotropic kainate 2
3h6h.1.A	15.07	homo-dimer	HHblits	X-ray	2.90Å	0.29	0.26	Glutamate receptor, ionotropic kainate 2
5kuh.1.A	13.51	homo-tetramer	HHblits	EM	NA	0.28	0.27	Glutamate receptor ionotropic, kainate 2
5kuh.1.B	13.51	homo-tetramer	HHblits	EM	NA	0.28	0.27	Glutamate receptor ionotropic, kainate 2
3p67.1.A	14.86	monomer	HHblits	X-ray	1.50Å	0.28	0.27	Pentaerythritol tetranitrate reductase
3p8j.1.A	14.86	monomer	HHblits	X-ray	1.00Å	0.28	0.27	Pentaerythritol tetranitrate reductase
5lgx.1.A	15.07	monomer	HHblits	X-ray	1.50Å	0.28	0.26	Pentaerythritol tetranitrate reductase
3qlt.1.A	13.70	homo-dimer	HHblits	X-ray	2.99Å	0.28	0.26	Glutamate receptor, ionotropic kainate 2
3qlu.1.B	13.70	hetero-oligomer	HHblits	X-ray	2.91Å	0.28	0.26	Glutamate receptor, ionotropic kainate 2
3i05.1.A	17.81	homo-dimer	HHblits	X-ray	2.80Å	0.28	0.26	Tryptophanyl-tRNA synthetase
3gka.1.A	18.67	monomer	HHblits	X-ray	2.30Å	0.26	0.27	N-ethylmaleimide reductase
1vyp.1.A	15.07	monomer	HHblits	X-ray	1.27Å	0.28	0.26	PENTAERYTHRITOL TETRANITRATE REDUCTASE
4gmf.1.A	14.67	homo-dimer	HHblits	X-ray	1.85Å	0.26	0.27	Yersiniabactin biosynthetic protein YbtU
4ab4.1.A	18.67	monomer	HHblits	X-ray	1.50Å	0.26	0.27	XENOBIOTIC REDUCTASE B
1o5t.1.A	13.70	homo-dimer	HHblits	X-ray	2.50Å	0.27	0.26	Tryptophanyl-tRNA synthetase
1ulh.1.A	13.70	homo-dimer	HHblits	X-ray	2.31Å	0.27	0.26	Tryptophanyl-tRNA synthetase
1ulh.1.B	13.70	homo-dimer	HHblits	X-ray	2.31Å	0.27	0.26	Tryptophanyl-tRNA synthetase
2aba.1.A	12.50	monomer	HHblits	X-ray	1.05Å	0.28	0.26	pentaerythritol tetranitrate reductase
3p8i.1.A	13.89	monomer	HHblits	X-ray	1.19Å	0.28	0.26	Pentaerythritol tetranitrate reductase
3p62.1.A	13.89	monomer	HHblits	X-ray	1.40Å	0.28	0.26	Pentaerythritol tetranitrate reductase
4nas.1.A	12.86	homo-dimer	HHblits	X-ray	1.92Å	0.30	0.25	Ribulose-bisphosphate carboxylase
4gmf.1.A	4.05	homo-dimer	HHblits	X-ray	1.85Å	0.25	0.27	Yersiniabactin biosynthetic protein YbtU
3t9p.1.A	21.13	homo-dimer	HHblits	X-ray	1.97Å	0.28	0.26	Mandelate racemase/muconate lactonizing enzyme family protein
2qui.1.B	13.89	homo-dimer	HHblits	X-ray	2.40Å	0.27	0.26	Tryptophanyl-tRNA synthetase
2quk.1.A	13.89	homo-dimer	HHblits	X-ray	2.80Å	0.27	0.26	Tryptophanyl-tRNA synthetase
2qui.1.A	13.89	homo-dimer	HHblits	X-ray	2.40Å	0.27	0.26	Tryptophanyl-tRNA synthetase
1r6u.1.A	12.33	homo-dimer	HHblits	X-ray	2.00Å	0.26	0.26	Tryptophanyl-tRNA synthetase
1r6u.1.B	12.33	homo-dimer	HHblits	X-ray	2.00Å	0.26	0.26	Tryptophanyl-tRNA synthetase
1m1b.1.A	12.68	homo-tetramer	HHblits	X-ray	2.25Å	0.28	0.26	PHOSPHOENOLPYRUVATE PHOSPHOMUTASE
1s2v.1.A	12.68	homo-tetramer	HHblits	X-ray	2.10Å	0.28	0.26	Phosphoenolpyruvate phosphomutase
1s2w.1.A	12.68	monomer	HHblits	X-ray	1.69Å	0.28	0.26	Phosphoenolpyruvate phosphomutase
3wgi.1.B	12.50	homo-dimer	HHblits	X-ray	3.25Å	0.27	0.26	Redox-sensing transcriptional repressor rex
3wg9.2.A	12.50	homo-dimer	HHblits	X-ray	1.97Å	0.27	0.26	Redox-sensing transcriptional repressor rex
3wg9.2.B	12.50	homo-dimer	HHblits	X-ray	1.97Å	0.27	0.26	Redox-sensing transcriptional repressor rex
3wgh.1.B	12.50	homo-dimer	HHblits	X-ray	2.05Å	0.27	0.26	Redox-sensing transcriptional repressor rex
3wgg.1.A	12.50	homo-dimer	HHblits	X-ray	2.10Å	0.27	0.26	Redox-sensing transcriptional repressor rex
3wgg.1.B	12.50	homo-dimer	HHblits	X-ray	2.10Å	0.27	0.26	Redox-sensing transcriptional repressor rex
2poz.1.A	20.00	homo-octamer	HHblits	X-ray	2.04Å	0.29	0.25	Putative dehydratase
2poz.1.E	20.00	homo-octamer	HHblits	X-ray	2.04Å	0.29	0.25	Putative dehydratase
1r6t.1.A	12.50	homo-dimer	HHblits	X-ray	2.10Å	0.26	0.26	Tryptophanyl-tRNA synthetase
1r6t.1.B	12.50	homo-dimer	HHblits	X-ray	2.10Å	0.26	0.26	Tryptophanyl-tRNA synthetase
2azx.1.B	12.50	homo-dimer	HHblits	X-ray	2.80Å	0.26	0.26	Tryptophanyl-tRNA synthetase
4iyj.1.A	19.12	homo-dimer	HHblits	X-ray	1.37Å	0.30	0.25	GDSL-like protein
1o66.1.A	20.29	homo-pentamer	HHblits	X-ray	1.75Å	0.29	0.25	3-methyl-2-oxobutanoate hydroxymethyltransferase
3r25.1.A	14.08	homo-dimer	HHblits	X-ray	1.60Å	0.27	0.26	mandelate racemase / muconate lactonizing enzyme
3sbf.1.A	14.08	homo-dimer	HHblits	X-ray	1.50Å	0.27	0.26	mandelate racemase / muconate lactonizing enzyme
3cea.1.A	12.68	homo-tetramer	HHblits	X-ray	2.40Å	0.26	0.26	Myo-inositol 2-dehydrogenase
3jva.1.A	11.27	homo-octamer	HHblits	X-ray	1.70Å	0.26	0.26	Dipeptide Epimerase
3jva.1.B	11.27	homo-octamer	HHblits	X-ray	1.70Å	0.26	0.26	Dipeptide Epimerase
3ec7.1.A	11.76	homo-tetramer	HHblits	X-ray	2.15Å	0.30	0.25	Putative Dehydrogenase
3dfh.1.A	14.08	homo-octamer	HHblits	X-ray	2.20Å	0.26	0.26	mandelate racemase
5unc.1.A	8.57	homo-tetramer	HHblits	X-ray	1.71Å	0.27	0.25	PHOSPHOENOLPYRUVATE PHOSPHOMUTASE
1m3u.1.A	19.40	homo-10-mer	HHblits	X-ray	1.80Å	0.31	0.24	3-methyl-2-oxobutanoate hydroxymethyltransferase
4e6m.1.A	5.71	homo-octamer	HHblits	X-ray	1.80Å	0.27	0.25	Putative dehydratase protein
3ugv.1.A	7.04	homo-octamer	HHblits	X-ray	2.30Å	0.25	0.26	Enolase
5cx1.1.B	13.04	hetero-oligomer	HHblits	X-ray	1.75Å	0.28	0.25	Nitrogenase molybdenum-iron protein beta chain
1m34.1.B	13.04	hetero-oligomer	HHblits	X-ray	2.30Å	0.28	0.25	Nitrogenase Molybdenum-Iron Protein beta chain
4xpi.1.B	13.04	hetero-oligomer	HHblits	X-ray	1.97Å	0.28	0.25	Nitrogenase molybdenum-iron protein beta chain
2eq5.1.A	14.71	homo-dimer	HHblits	X-ray	2.20Å	0.29	0.25	228aa long hypothetical hydantoin racemase
2eq5.2.B	14.71	homo-dimer	HHblits	X-ray	2.20Å	0.29	0.25	228aa long hypothetical hydantoin racemase
3t6c.1.A	15.49	homo-octamer	HHblits	X-ray	1.60Å	0.25	0.26	Putative ManD family dehydratase
3t6c.1.B	15.49	homo-octamer	HHblits	X-ray	1.60Å	0.25	0.26	Putative ManD family dehydratase
3tji.1.A	8.45	homo-octamer	HHblits	X-ray	1.80Å	0.25	0.26	Mandelate racemase/muconate lactonizing enzyme, N-terminal domain protein
4gir.1.A	10.00	homo-octamer	HHblits	X-ray	2.00Å	0.26	0.25	Enolase
4j3z.1.A	12.86	homo-octamer	HHblits	X-ray	2.50Å	0.26	0.25	Mandelate racemase/muconate lactonizing enzyme
3s47.1.A	8.45	homo-dimer	HHblits	X-ray	1.70Å	0.24	0.26	Mandelate racemase/muconate lactonizing protein
3ez4.1.A	14.93	homo-10-mer	HHblits	X-ray	2.10Å	0.29	0.24	3-methyl-2-oxobutanoate hydroxymethyltransferase
3t4w.1.A	10.00	homo-octamer	HHblits	X-ray	2.52Å	0.25	0.25	Mandelate racemase/muconate lactonizing enzyme family protein
3gy1.1.A	8.45	homo-octamer	HHblits	X-ray	1.60Å	0.24	0.26	Mandelate racemase/muconate lactonizing protein
3v2u.1.A	20.90	hetero-oligomer	HHblits	X-ray	2.11Å	0.29	0.24	Galactose/lactose metabolism regulatory protein GAL80
4mkx.1.A	11.76	homo-tetramer	HHblits	X-ray	1.60Å	0.27	0.25	Inositol dehydrogenase
3twa.1.A	11.27	homo-dimer	HHblits	X-ray	1.80Å	0.24	0.26	Putative dehydratase
3tw9.2.A	11.27	homo-dimer	HHblits	X-ray	1.70Å	0.24	0.26	Putative dehydratase
1zlp.1.A	14.71	homo-tetramer	HHblits	X-ray	2.70Å	0.27	0.25	petal death protein
3rc7.1.A	10.14	monomer	HHblits	X-ray	2.00Å	0.26	0.25	Sugar 3-ketoreductase
1v2g.1.A	13.24	monomer	HHblits	X-ray	2.00Å	0.27	0.25	Acyl-CoA thioesterase I
1yzf.1.A	19.70	monomer	HHblits	X-ray	1.90Å	0.29	0.24	lipase/acylhydrolase
2pod.1.A	8.57	homo-octamer	HHblits	X-ray	2.34Å	0.25	0.25	Mandelate racemase / muconate lactonizing enzyme
3rr1.1.A	12.86	homo-octamer	HHblits	X-ray	1.95Å	0.25	0.25	Putative D-galactonate dehydratase
5b5s.1.A	17.65	monomer	HHblits	X-ray	1.50Å	0.27	0.25	Acetic acid
3rcy.1.A	10.14	homo-octamer	HHblits	X-ray	1.99Å	0.25	0.25	Mandelate racemase/muconate lactonizing enzyme-like protein
1j00.1.A	13.43	monomer	HHblits	X-ray	2.00Å	0.27	0.24	Thioesterase I
1u8u.1.A	13.43	monomer	HHblits	X-ray	2.08Å	0.27	0.24	Acyl-CoA thioesterase I
3rcb.1.A	10.29	monomer	HHblits	X-ray	2.49Å	0.26	0.25	Sugar 3-ketoreductase
1evj.1.A	13.43	homo-dimer	HHblits	X-ray	2.70Å	0.27	0.24	GLUCOSE-FRUCTOSE OXIDOREDUCTASE
1ryd.1.A	11.76	homo-tetramer	HHblits	X-ray	2.20Å	0.26	0.25	glucose-fructose oxidoreductase
1rye.1.B	11.76	homo-tetramer	HHblits	X-ray	2.30Å	0.26	0.25	glucose-fructose oxidoreductase
1rye.1.A	11.76	homo-tetramer	HHblits	X-ray	2.30Å	0.26	0.25	glucose-fructose oxidoreductase
4il2.1.A	5.71	homo-octamer	HHblits	X-ray	1.95Å	0.23	0.25	Starvation sensing protein rspA
4iq0.1.A	10.61	homo-dimer	HHblits	X-ray	2.00Å	0.28	0.24	Oxidoreductase, Gfo/Idh/MocA family
4iq0.2.B	10.61	homo-dimer	HHblits	X-ray	2.00Å	0.28	0.24	Oxidoreductase, Gfo/Idh/MocA family
5a02.1.A	5.97	homo-dimer	HHblits	X-ray	2.00Å	0.26	0.24	ALDOSE-ALDOSE OXIDOREDUCTASE
2o14.1.A	15.15	monomer	HHblits	X-ray	2.10Å	0.27	0.24	Hypothetical protein yxiM
2uyy.1.A	16.92	homo-tetramer	HHblits	X-ray	2.50Å	0.29	0.23	N-PAC PROTEIN
1vc4.1.A	13.85	monomer	HHblits	X-ray	1.80Å	0.29	0.23	Indole-3-Glycerol Phosphate Synthase
1vc4.2.A	13.85	monomer	HHblits	X-ray	1.80Å	0.29	0.23	Indole-3-Glycerol Phosphate Synthase
1ofg.1.A	11.94	homo-tetramer	HHblits	X-ray	2.70Å	0.26	0.24	GLUCOSE-FRUCTOSE OXIDOREDUCTASE
4rk0.1.A	10.77	homo-dimer	HHblits	X-ray	1.80Å	0.28	0.23	LacI family sugar-binding transcriptional regulator
4rk0.1.B	10.77	homo-dimer	HHblits	X-ray	1.80Å	0.28	0.23	LacI family sugar-binding transcriptional regulator
3q2k.1.A	17.19	homo-octamer	HHblits	X-ray	2.13Å	0.29	0.23	oxidoreductase
3q2k.1.B	17.19	homo-octamer	HHblits	X-ray	2.13Å	0.29	0.23	oxidoreductase
3rc9.1.A	8.96	monomer	HHblits	X-ray	1.91Å	0.25	0.24	Sugar 3-ketoreductase
3q94.1.A	16.13	homo-dimer	HHblits	X-ray	2.30Å	0.31	0.22	Fructose-bisphosphate aldolase, class II
2ho5.1.A	12.70	homo-dimer	HHblits	X-ray	2.56Å	0.29	0.23	Oxidoreductase, Gfo/Idh/MocA family
2go1.1.A	14.29	homo-dimer	HHblits	X-ray	2.10Å	0.29	0.23	NAD-dependent formate dehydrogenase
2gug.1.A	14.29	homo-dimer	HHblits	X-ray	2.28Å	0.29	0.23	Formate dehydrogenase
3lft.1.A	14.06	monomer	HHblits	X-ray	1.35Å	0.27	0.23	uncharacterized protein
2ake.1.B	14.29	homo-dimer	HHblits	X-ray	3.10Å	0.28	0.23	Tryptophanyl-tRNA synthetase
2gsd.1.A	11.11	homo-dimer	HHblits	X-ray	1.95Å	0.27	0.23	NAD-dependent formate dehydrogenase
2p2q.1.A	11.29	monomer	HHblits	X-ray	2.42Å	0.27	0.22	Acetyl-coenzyme A synthetase
4u63.1.A	8.06	monomer	HHblits	X-ray	1.67Å	0.27	0.22	DNA photolyase
4mg4.1.A	12.90	homo-dimer	HHblits	X-ray	1.70Å	0.26	0.22	Phosphonomutase
4mg4.2.B	12.90	homo-dimer	HHblits	X-ray	1.70Å	0.26	0.22	Phosphonomutase
2p2f.1.A	9.68	monomer	HHblits	X-ray	2.58Å	0.26	0.22	Acetyl-coenzyme A synthetase
1pg3.1.A	9.68	monomer	HHblits	X-ray	2.30Å	0.26	0.22	acetyl-CoA synthetase
2p2m.1.A	9.68	monomer	HHblits	X-ray	2.11Å	0.26	0.22	Acetyl-coenzyme A synthetase
4pbs.1.A	8.20	homo-dimer	HHblits	X-ray	2.01Å	0.24	0.22	Tyrosine--tRNA ligase
4mwa.1.A	16.67	homo-tetramer	HHblits	X-ray	1.85Å	0.31	0.19	4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
4mwa.1.B	16.67	homo-tetramer	HHblits	X-ray	1.85Å	0.31	0.19	4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
4mwa.1.C	16.67	homo-tetramer	HHblits	X-ray	1.85Å	0.31	0.19	4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
4mwa.1.D	16.67	homo-tetramer	HHblits	X-ray	1.85Å	0.31	0.19	4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
4mwa.2.B	16.67	homo-tetramer	HHblits	X-ray	1.85Å	0.31	0.19	4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
4mwa.2.D	16.67	homo-tetramer	HHblits	X-ray	1.85Å	0.31	0.19	4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
3noy.1.A	14.29	homo-dimer	HHblits	X-ray	2.70Å	0.28	0.20	4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
3noy.2.A	14.29	homo-dimer	HHblits	X-ray	2.70Å	0.28	0.20	4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
1b73.1.A	16.07	homo-dimer	HHblits	X-ray	2.30Å	0.27	0.20	GLUTAMATE RACEMASE
4fq7.1.A	18.87	homo-tetramer	HHblits	X-ray	3.00Å	0.30	0.19	Maleate cis-trans isomerase
4yv7.1.A	16.07	monomer	HHblits	X-ray	2.30Å	0.25	0.20	Periplasmic binding protein/LacI transcriptional regulator
2xed.1.A	17.65	monomer	HHblits	X-ray	1.95Å	0.29	0.18	PUTATIVE MALEATE ISOMERASE
4fq5.1.A	17.65	homo-tetramer	HHblits	X-ray	2.10Å	0.29	0.18	Maleate cis-trans isomerase
4fq5.1.B	17.65	homo-tetramer	HHblits	X-ray	2.10Å	0.29	0.18	Maleate cis-trans isomerase
1m3u.1.A	31.25	homo-10-mer	HHblits	X-ray	1.80Å	0.33	0.17	3-methyl-2-oxobutanoate hydroxymethyltransferase
3vav.1.A	22.92	homo-10-mer	HHblits	X-ray	1.80Å	0.32	0.17	3-methyl-2-oxobutanoate hydroxymethyltransferase
3ez4.1.A	22.92	homo-10-mer	HHblits	X-ray	2.10Å	0.32	0.17	3-methyl-2-oxobutanoate hydroxymethyltransferase
5aun.1.B	18.37	hetero-oligomer	HHblits	X-ray	1.63Å	0.30	0.18	ATPase involved in chromosome partitioning, ParA/MinD family, Mrp homolog
3vx3.1.A	18.37	homo-dimer	HHblits	X-ray	2.10Å	0.30	0.18	ATPase involved in chromosome partitioning, ParA/MinD family, Mrp homolog
5auq.3.A	18.37	homo-dimer	HHblits	X-ray	2.53Å	0.30	0.18	ATPase involved in chromosome partitioning, ParA/MinD family, Mrp homolog
3vx3.1.B	18.37	homo-dimer	HHblits	X-ray	2.10Å	0.30	0.18	ATPase involved in chromosome partitioning, ParA/MinD family, Mrp homolog
1fui.1.A	10.00	homo-trimer	HHblits	X-ray	2.50Å	0.27	0.18	L-FUCOSE ISOMERASE
1oy0.1.A	12.50	homo-10-mer	HHblits	X-ray	2.80Å	0.30	0.17	Ketopantoate hydroxymethyltransferase
3vav.1.A	16.33	homo-10-mer	HHblits	X-ray	1.80Å	0.29	0.18	3-methyl-2-oxobutanoate hydroxymethyltransferase
1g21.1.B	17.02	hetero-oligomer	HHblits	X-ray	3.00Å	0.32	0.17	NITROGENASE MOLYBDENUM-IRON PROTEIN BETA CHAIN
4ix1.1.A	9.80	homo-dimer	HHblits	X-ray	2.80Å	0.25	0.18	hypothetical protein
4ix1.1.B	9.80	homo-dimer	HHblits	X-ray	2.80Å	0.25	0.18	hypothetical protein
1rdu.1.A	21.28	monomer	HHblits	NMR	NA	0.31	0.17	conserved hypothetical protein
3a9t.1.A	18.75	homo-hexamer	HHblits	X-ray	2.61Å	0.29	0.17	D-arabinose isomerase
1eo1.1.A	14.58	monomer	HHblits	NMR	NA	0.29	0.17	HYPOTHETICAL PROTEIN MTH1175
1fwr.1.A	10.00	homo-trimer	HHblits	X-ray	2.70Å	0.25	0.18	KDPG ALDOLASE
1fq0.1.A	10.00	homo-trimer	HHblits	X-ray	2.10Å	0.25	0.18	KDPG ALDOLASE
1eua.1.C	10.00	homo-trimer	HHblits	X-ray	1.95Å	0.25	0.18	KDPG ALDOLASE
1a98.1.A	12.00	homo-tetramer	HHblits	X-ray	2.25Å	0.25	0.18	XANTHINE-GUANINE PHOSPHORIBOSYLTRANSFERASE
4c22.1.A	12.50	homo-hexamer	HHblits	X-ray	2.70Å	0.28	0.17	L-FUCOSE ISOMERASE
4c20.1.A	10.42	monomer	HHblits	X-ray	2.41Å	0.27	0.17	L-FUCOSE ISOMERASE
4c21.1.A	10.42	homo-hexamer	HHblits	X-ray	2.55Å	0.27	0.17	L-FUCOSE ISOMERASE
1a96.1.A	14.29	homo-tetramer	HHblits	X-ray	2.00Å	0.26	0.18	XANTHINE-GUANINE PHOSPHORIBOSYLTRANSFERASE
1a96.1.C	14.29	homo-tetramer	HHblits	X-ray	2.00Å	0.26	0.18	XANTHINE-GUANINE PHOSPHORIBOSYLTRANSFERASE
1nul.1.B	14.29	homo-tetramer	HHblits	X-ray	1.80Å	0.26	0.18	XANTHINE-GUANINE PHOSPHORIBOSYLTRANSFERASE
4jls.2.A	14.29	homo-tetramer	HHblits	X-ray	2.20Å	0.26	0.18	Xanthine phosphoribosyltransferase
1a97.1.A	14.58	homo-tetramer	HHblits	X-ray	2.60Å	0.26	0.17	XANTHINE-GUANINE PHOSPHORIBOSYLTRANSFERASE
3mjf.1.A	17.39	monomer	HHblits	X-ray	1.47Å	0.27	0.17	Phosphoribosylamine--glycine ligase
2ys6.1.A	15.56	monomer	HHblits	X-ray	2.21Å	0.28	0.16	Phosphoribosylglycinamide synthetase
1x7i.1.A	20.93	homo-dimer	HHblits	X-ray	1.70Å	0.31	0.16	Copper homeostasis protein cutC
1x7i.1.B	20.93	homo-dimer	HHblits	X-ray	1.70Å	0.31	0.16	Copper homeostasis protein cutC
1twd.1.A	20.93	homo-dimer	HHblits	X-ray	1.70Å	0.31	0.16	Copper homeostasis protein cutC
1twd.1.B	20.93	homo-dimer	HHblits	X-ray	1.70Å	0.31	0.16	Copper homeostasis protein cutC
2qk4.1.A	23.26	monomer	HHblits	X-ray	2.45Å	0.31	0.16	Trifunctional purine biosynthetic protein adenosine-3
4h4x.1.A	26.19	homo-dimer	HHblits	X-ray	1.50Å	0.33	0.15	Biphenyl dioxygenase ferredoxin reductase subunit
1vgv.1.B	20.45	homo-dimer	HHblits	X-ray	2.31Å	0.29	0.16	UDP-N-acetylglucosamine 2-epimerase
1vgv.1.A	20.45	homo-dimer	HHblits	X-ray	2.31Å	0.29	0.16	UDP-N-acetylglucosamine 2-epimerase
1vgv.2.B	20.45	homo-dimer	HHblits	X-ray	2.31Å	0.29	0.16	UDP-N-acetylglucosamine 2-epimerase
3iwp.1.B	20.93	homo-tetramer	HHblits	X-ray	2.50Å	0.30	0.16	Copper homeostasis protein cutC homolog
3iwp.1.A	20.93	homo-tetramer	HHblits	X-ray	2.50Å	0.30	0.16	Copper homeostasis protein cutC homolog
3iwp.2.B	20.93	homo-tetramer	HHblits	X-ray	2.50Å	0.30	0.16	Copper homeostasis protein cutC homolog
3iwp.2.C	20.93	homo-tetramer	HHblits	X-ray	2.50Å	0.30	0.16	Copper homeostasis protein cutC homolog
3iwp.2.D	20.93	homo-tetramer	HHblits	X-ray	2.50Å	0.30	0.16	Copper homeostasis protein cutC homolog
3iwp.3.A	20.93	homo-tetramer	HHblits	X-ray	2.50Å	0.30	0.16	Copper homeostasis protein cutC homolog
3iwp.3.B	20.93	homo-tetramer	HHblits	X-ray	2.50Å	0.30	0.16	Copper homeostasis protein cutC homolog
3iwp.3.C	20.93	homo-tetramer	HHblits	X-ray	2.50Å	0.30	0.16	Copper homeostasis protein cutC homolog
3iwp.3.D	20.93	homo-tetramer	HHblits	X-ray	2.50Å	0.30	0.16	Copper homeostasis protein cutC homolog
1o66.1.A	16.67	homo-pentamer	HHblits	X-ray	1.75Å	0.32	0.15	3-methyl-2-oxobutanoate hydroxymethyltransferase
1oy0.1.A	21.43	homo-10-mer	HHblits	X-ray	2.80Å	0.32	0.15	Ketopantoate hydroxymethyltransferase
3ga5.1.A	16.28	monomer	HHblits	X-ray	1.87Å	0.30	0.16	D-galactose-binding periplasmic protein
1gso.1.A	20.93	monomer	HHblits	X-ray	1.60Å	0.29	0.16	PROTEIN (GLYCINAMIDE RIBONUCLEOTIDE SYNTHETASE)
5fs9.1.A	19.05	monomer	HHblits	X-ray	1.75Å	0.31	0.15	APOPTOSIS-INDUCING FACTOR 1, MITOCHONDRIAL
2yvg.1.A	26.83	homo-dimer	HHblits	X-ray	1.60Å	0.33	0.15	Ferredoxin reductase
2yvj.1.A	26.83	hetero-oligomer	HHblits	X-ray	1.90Å	0.33	0.15	Ferredoxin reductase
2yvj.1.C	26.83	hetero-oligomer	HHblits	X-ray	1.90Å	0.33	0.15	Ferredoxin reductase
1d7y.1.A	26.83	homo-dimer	HHblits	X-ray	2.10Å	0.33	0.15	FERREDOXIN REDUCTASE
4h4z.1.A	26.83	homo-dimer	HHblits	X-ray	1.95Å	0.33	0.15	Biphenyl dioxygenase ferredoxin reductase subunit
2yya.1.A	8.89	monomer	HHblits	X-ray	2.40Å	0.25	0.16	Phosphoribosylamine--glycine ligase
5jcm.1.A	19.05	monomer	HHblits	X-ray	1.90Å	0.30	0.15	Os09g0567300 protein
1m6i.1.A	19.51	monomer	HHblits	X-ray	1.80Å	0.32	0.15	Programmed cell death protein 8
5fs6.1.A	19.51	monomer	HHblits	X-ray	1.90Å	0.32	0.15	APOPTOSIS-INDUCING FACTOR 1, MITOCHONDRIAL
4x2r.1.A	30.77	monomer	HHblits	X-ray	1.05Å	0.35	0.14	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase
1v8b.1.A	14.29	homo-tetramer	HHblits	X-ray	2.40Å	0.30	0.15	adenosylhomocysteinase
3o8o.1.B	16.67	hetero-oligomer	HHblits	X-ray	2.90Å	0.29	0.15	6-phosphofructokinase subunit beta
4h4v.1.A	27.50	homo-dimer	HHblits	X-ray	1.40Å	0.33	0.14	Biphenyl dioxygenase ferredoxin reductase subunit
2gr3.1.A	27.50	homo-dimer	HHblits	X-ray	1.50Å	0.33	0.14	ferredoxin reductase
4h4t.1.A	27.50	homo-dimer	HHblits	X-ray	1.50Å	0.33	0.14	Biphenyl dioxygenase ferredoxin reductase subunit
4h4r.1.A	27.50	homo-dimer	HHblits	X-ray	1.40Å	0.33	0.14	Biphenyl dioxygenase ferredoxin reductase subunit
4h4p.1.A	27.50	homo-dimer	HHblits	X-ray	1.50Å	0.33	0.14	Biphenyl dioxygenase ferredoxin reductase subunit
2xcl.1.A	6.67	monomer	HHblits	X-ray	2.10Å	0.24	0.16	PHOSPHORIBOSYLAMINE--GLYCINE LIGASE
5jcl.1.A	19.05	monomer	HHblits	X-ray	1.80Å	0.29	0.15	Os09g0567300 protein
1go1.1.A	25.00	monomer	HHblits	NMR	NA	0.33	0.14	50S RIBOSOMAL PROTEIN L30E
1go0.1.A	25.00	monomer	HHblits	NMR	NA	0.33	0.14	50S RIBOSOMAL PROTEIN L30E
1h7m.1.A	25.00	monomer	HHblits	X-ray	1.96Å	0.33	0.14	50S RIBOSOMAL PROTEIN L30E
3jah.57.A	26.83	monomer	HHblits	EM	NA	0.31	0.15	eS12
5k0y.1.d	26.83	hetero-oligomer	HHblits	EM	NA	0.31	0.15	40S ribosomal protein S12
3ef6.1.A	28.21	monomer	HHblits	X-ray	1.80Å	0.35	0.14	Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase
4emi.1.A	28.21	monomer	HHblits	X-ray	1.81Å	0.35	0.14	TodA
4emj.1.A	28.21	hetero-oligomer	HHblits	X-ray	2.40Å	0.35	0.14	TodA
3ra6.1.A	25.00	monomer	HHblits	X-ray	2.00Å	0.33	0.14	50S ribosomal protein L30e
3n4y.1.A	25.00	monomer	HHblits	X-ray	2.40Å	0.32	0.14	50S ribosomal protein L30e
1w41.1.A	25.00	monomer	HHblits	X-ray	1.70Å	0.32	0.14	50S RIBOSOMAL PROTEIN L30E
1w40.1.A	25.00	monomer	HHblits	X-ray	2.03Å	0.32	0.14	50S RIBOSOMAL PROTEIN L30E
3n4z.1.A	25.00	monomer	HHblits	X-ray	2.40Å	0.32	0.14	50S ribosomal protein L30e
3n4z.2.A	25.00	monomer	HHblits	X-ray	2.40Å	0.32	0.14	50S ribosomal protein L30e
1w42.1.A	25.00	monomer	HHblits	X-ray	1.80Å	0.32	0.14	50S RIBOSOMAL PROTEIN L30E
3ra5.1.A	25.00	homo-dimer	HHblits	X-ray	1.80Å	0.32	0.14	50S ribosomal protein L30e
3syi.1.A	14.63	homo-dimer	HHblits	X-ray	2.20Å	0.31	0.15	Sulfide-quinone reductase, putative
4fx9.1.A	14.63	homo-dimer	HHblits	X-ray	2.70Å	0.31	0.15	Coenzyme A disulfide reductase
5lzz.57.A	24.39	monomer	HHblits	EM	3.47Å	0.31	0.15	40S ribosomal protein S12
4ujc.57.A	24.39	monomer	HHblits	EM	9.50Å	0.31	0.15	40S RIBOSOMAL PROTEIN ES12
5aj0.58.A	24.39	monomer	HHblits	EM	3.50Å	0.31	0.15	40S ribosomal protein S12
4kzx.1.M	24.39	hetero-oligomer	HHblits	X-ray	7.81Å	0.31	0.15	40S ribosomal protein S12
5vyc.5.M	24.39	hetero-oligomer	HHblits	X-ray	6.00Å	0.31	0.15	40S ribosomal protein S12
4qwv.1.A	16.67	monomer	HHblits	X-ray	2.45Å	0.29	0.15	High-affinity leucine-specific transport system periplasmic binding protein, Chemotaxis protein CheY
3klj.1.A	19.51	monomer	HHblits	X-ray	2.10Å	0.30	0.15	NAD(FAD)-dependent dehydrogenase, NirB-family (N-terminal domain)
3lfo.1.A	25.00	monomer	HHblits	X-ray	1.80Å	0.32	0.14	50S ribosomal protein L30e
3h5l.1.A	14.63	monomer	HHblits	X-ray	1.70Å	0.30	0.15	putative Branched-chain amino acid ABC transporter
1q1r.1.A	21.95	monomer	HHblits	X-ray	1.91Å	0.30	0.15	Putidaredoxin reductase
1q1w.2.A	21.95	monomer	HHblits	X-ray	2.60Å	0.30	0.15	Putidaredoxin reductase
4ru0.1.A	18.60	monomer	HHblits	X-ray	2.44Å	0.26	0.16	Putative branched-chain amino acid ABC transporter, periplasmic branched-chain amino acid-binding protein
5oql.1.V	17.07	hetero-oligomer	HHblits	EM	NA	0.30	0.15	Snu13
4bur.1.A	20.00	monomer	HHblits	X-ray	2.88Å	0.32	0.14	APOPTOSIS INDUCING FACTOR 1, MITOCHONDRIAL
4bur.3.A	20.00	monomer	HHblits	X-ray	2.88Å	0.32	0.14	APOPTOSIS INDUCING FACTOR 1, MITOCHONDRIAL
4fdc.1.A	20.00	monomer	HHblits	X-ray	2.40Å	0.32	0.14	Apoptosis-inducing factor 1, mitochondrial
4lii.1.A	20.00	monomer	HHblits	X-ray	1.88Å	0.32	0.14	Apoptosis-inducing factor 1, mitochondrial
5fs8.1.A	20.00	monomer	HHblits	X-ray	1.40Å	0.32	0.14	APOPTOSIS-INDUCING FACTOR 1, MITOCHONDRIAL
5fs7.1.A	20.00	monomer	HHblits	X-ray	1.85Å	0.32	0.14	APOPTOSIS-INDUCING FACTOR 1, MITOCHONDRIAL
5fmh.1.A	20.00	monomer	HHblits	X-ray	1.80Å	0.32	0.14	APOPTOSIS-INDUCING FACTOR 1, MITOCHONDRIAL
3gd3.1.A	20.00	monomer	HHblits	X-ray	2.95Å	0.32	0.14	Apoptosis-inducing factor 1, mitochondrial
3gd3.2.A	20.00	monomer	HHblits	X-ray	2.95Å	0.32	0.14	Apoptosis-inducing factor 1, mitochondrial
3gd3.4.A	20.00	monomer	HHblits	X-ray	2.95Å	0.32	0.14	Apoptosis-inducing factor 1, mitochondrial
5kvi.1.A	20.00	monomer	HHblits	X-ray	2.00Å	0.32	0.14	Apoptosis-inducing factor 1, mitochondrial
3gd4.1.A	20.00	homo-dimer	HHblits	X-ray	2.24Å	0.32	0.14	Apoptosis-inducing factor 1, mitochondrial
3gd4.1.B	20.00	homo-dimer	HHblits	X-ray	2.24Å	0.32	0.14	Apoptosis-inducing factor 1, mitochondrial
5miu.1.A	20.00	monomer	HHblits	X-ray	3.50Å	0.32	0.14	Apoptosis-inducing factor 1, mitochondrial
5miv.1.A	20.00	homo-dimer	HHblits	X-ray	3.10Å	0.32	0.14	Apoptosis-inducing factor 1, mitochondrial
5miv.1.B	20.00	homo-dimer	HHblits	X-ray	3.10Å	0.32	0.14	Apoptosis-inducing factor 1, mitochondrial
1gv4.1.A	20.00	monomer	HHblits	X-ray	2.00Å	0.32	0.14	PROGRAMED CELL DEATH PROTEIN 8
5kvh.1.A	20.00	homo-dimer	HHblits	X-ray	2.27Å	0.32	0.14	Apoptosis-inducing factor 1, mitochondrial
2y85.1.A	22.50	monomer	HHblits	X-ray	2.40Å	0.32	0.14	PHOSPHORIBOSYL ISOMERASE A
3zs4.1.A	22.50	monomer	HHblits	X-ray	1.90Å	0.32	0.14	PHOSPHORIBOSYL ISOMERASE A
3lxd.1.A	17.07	monomer	HHblits	X-ray	2.50Å	0.29	0.15	FAD-dependent pyridine nucleotide-disulphide oxidoreductase
4gnr.1.A	17.07	monomer	HHblits	X-ray	1.00Å	0.29	0.15	ABC transporter substrate-binding protein-branched chain amino acid transport
3j7a.1.R	19.51	hetero-oligomer	HHblits	EM	NA	0.29	0.15	40S ribosomal protein eS12
3noy.1.A	33.33	homo-dimer	HHblits	X-ray	2.70Å	0.33	0.14	4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
3noy.2.A	33.33	homo-dimer	HHblits	X-ray	2.70Å	0.33	0.14	4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
3ics.1.A	17.07	homo-dimer	HHblits	X-ray	1.94Å	0.29	0.15	Coenzyme A-Disulfide Reductase
4u4n.116.A	17.07	monomer	HHblits	X-ray	3.10Å	0.29	0.15	60S ribosomal protein L8-A
4u4r.41.A	17.07	monomer	HHblits	X-ray	2.80Å	0.29	0.15	60S ribosomal protein L8-A
1w3e.1.A	22.50	monomer	HHblits	X-ray	1.77Å	0.31	0.14	50S RIBOSOMAL PROTEIN L30E
4v4n.65.A	22.50	monomer	HHblits	EM	NA	0.31	0.14	50S ribosomal protein L30E
4v6u.56.A	22.50	monomer	HHblits	EM	NA	0.31	0.14	50S ribosomal protein L30e
2r68.1.A	11.90	monomer	HHblits	X-ray	2.40Å	0.27	0.15	Glycosyl transferase, group 1
3lb8.1.A	22.50	hetero-oligomer	HHblits	X-ray	2.60Å	0.31	0.14	Putidaredoxin reductase
3lb8.2.A	22.50	hetero-oligomer	HHblits	X-ray	2.60Å	0.31	0.14	Putidaredoxin reductase
3fg2.1.A	17.07	monomer	HHblits	X-ray	2.20Å	0.29	0.15	Putative rubredoxin reductase
1e7k.1.A	19.51	monomer	HHblits	X-ray	2.90Å	0.29	0.15	15.5 KD RNA BINDING PROTEIN
5o9z.1.O	19.51	hetero-oligomer	HHblits	EM	NA	0.29	0.15	NHP2-like protein 1
4v8m.75.A	22.50	monomer	HHblits	EM	5.57Å	0.30	0.14	60S RIBOSOMAL PROTEIN L7A, PUTATIVE
3cge.1.A	12.20	homo-dimer	HHblits	X-ray	2.26Å	0.28	0.15	Pyridine nucleotide-disulfide oxidoreductase, class I
3kd9.1.A	15.00	homo-dimer	HHblits	X-ray	2.75Å	0.30	0.14	Coenzyme A disulfide reductase
3td9.1.A	9.76	homo-dimer	HHblits	X-ray	1.90Å	0.28	0.15	Branched chain amino acid ABC transporter, periplasmic amino acid-binding protein
3ipc.1.A	23.08	monomer	HHblits	X-ray	1.30Å	0.32	0.14	ABC transporter, substrate binding protein (Amino acid)
2v3a.1.A	20.00	monomer	HHblits	X-ray	2.40Å	0.30	0.14	RUBREDOXIN REDUCTASE
2v3b.1.A	20.00	hetero-oligomer	HHblits	X-ray	2.45Å	0.30	0.14	RUBREDOXIN REDUCTASE
3qlt.1.A	20.00	homo-dimer	HHblits	X-ray	2.99Å	0.30	0.14	Glutamate receptor, ionotropic kainate 2
3qlu.1.B	20.00	hetero-oligomer	HHblits	X-ray	2.91Å	0.30	0.14	Glutamate receptor, ionotropic kainate 2
3qlv.1.C	20.00	hetero-oligomer	HHblits	X-ray	3.94Å	0.30	0.14	Glutamate receptor, ionotropic kainate 2
3h6g.1.A	20.00	homo-dimer	HHblits	X-ray	2.70Å	0.30	0.14	Glutamate receptor, ionotropic kainate 2
3h6h.1.A	20.00	homo-dimer	HHblits	X-ray	2.90Å	0.30	0.14	Glutamate receptor, ionotropic kainate 2
4kv7.1.A	22.50	monomer	HHblits	X-ray	1.20Å	0.30	0.14	Probable leucine/isoleucine/valine-binding protein
3ipa.1.A	23.08	monomer	HHblits	X-ray	1.55Å	0.32	0.14	ABC transporter, substrate binding protein (Amino acid)
4to8.1.A	23.68	homo-dimer	HHblits	X-ray	2.10Å	0.34	0.14	Fructose-1,6-bisphosphate aldolase, class II
3sg0.1.A	15.00	monomer	HHblits	X-ray	1.20Å	0.30	0.14	Extracellular ligand-binding receptor
3szw.1.A	12.50	homo-dimer	HHblits	X-ray	2.20Å	0.30	0.14	Sulfide-quinone reductase, putative
5jci.1.A	20.00	monomer	HHblits	X-ray	1.70Å	0.30	0.14	Os09g0567300 protein
4nut.1.A	17.07	hetero-oligomer	HHblits	X-ray	1.55Å	0.27	0.15	13 kDa ribonucleoprotein-associated protein
3cpq.1.A	20.00	homo-dimer	HHblits	X-ray	1.90Å	0.29	0.14	50S ribosomal protein L30e
2lbp.1.A	17.50	monomer	HHblits	X-ray	2.40Å	0.29	0.14	LEUCINE-BINDING PROTEIN
3cgb.1.A	12.50	homo-dimer	HHblits	X-ray	1.90Å	0.29	0.14	Pyridine nucleotide-disulfide oxidoreductase, class I
3v7e.1.A	17.50	monomer	HHblits	X-ray	2.80Å	0.29	0.14	Ribosome-associated protein L7Ae-like
4tzz.2.A	17.50	monomer	HHblits	X-ray	3.64Å	0.29	0.14	Ribosome-associated protein L7Ae-like
4tzp.2.A	17.50	monomer	HHblits	X-ray	8.50Å	0.29	0.14	Ribosome-associated protein L7Ae-like
4tzw.1.A	17.50	monomer	HHblits	X-ray	4.67Å	0.29	0.14	Ribosome-associated protein L7Ae-like
3o85.1.A	12.20	monomer	HHblits	X-ray	1.81Å	0.27	0.15	Ribosomal protein L7Ae
2c7g.1.A	17.50	homo-dimer	HHblits	X-ray	1.80Å	0.29	0.14	NADPH-FERREDOXIN REDUCTASE FPRA
1lqu.1.A	17.50	monomer	HHblits	X-ray	1.25Å	0.29	0.14	FprA
4evq.1.A	20.51	monomer	HHblits	X-ray	1.40Å	0.30	0.14	Putative ABC transporter subunit, substrate-binding component
3hyv.1.A	21.05	homo-trimer	HHblits	X-ray	2.30Å	0.32	0.14	Sulfide-quinone reductase
4fx7.1.A	7.50	monomer	HHblits	X-ray	2.08Å	0.28	0.14	Imidazole glycerol phosphate synthase subunit HisF
1e1m.1.A	20.51	monomer	HHblits	X-ray	1.85Å	0.30	0.14	ADRENODOXIN REDUCTASE
1e1l.1.A	20.51	monomer	HHblits	X-ray	2.30Å	0.30	0.14	ADRENODOXIN REDUCTASE
1e6e.2.A	20.51	hetero-oligomer	HHblits	X-ray	2.30Å	0.30	0.14	NADPH\:ADRENODOXIN OXIDOREDUCTASE
1e6e.1.A	20.51	hetero-oligomer	HHblits	X-ray	2.30Å	0.30	0.14	NADPH\:ADRENODOXIN OXIDOREDUCTASE
3sxi.1.A	12.82	homo-dimer	HHblits	X-ray	2.18Å	0.30	0.14	Sulfide-quinone reductase, putative
3sx6.1.A	12.82	homo-dimer	HHblits	X-ray	1.80Å	0.30	0.14	Sulfide-quinone reductase, putative
4x9s.1.A	23.08	monomer	HHblits	X-ray	1.60Å	0.30	0.14	Phosphoribosyl isomerase A
5kuh.1.A	20.51	homo-tetramer	HHblits	EM	NA	0.30	0.14	Glutamate receptor ionotropic, kainate 2
5kuh.1.B	20.51	homo-tetramer	HHblits	EM	NA	0.30	0.14	Glutamate receptor ionotropic, kainate 2
4bts.100.A	12.20	monomer	HHblits	X-ray	3.70Å	0.26	0.15	40S RIBOSOMAL PROTEIN RPS12E
4v5o.2.3	12.20	hetero-oligomer	HHblits	X-ray	3.93Å	0.26	0.15	RIBOSOMAL PROTEIN L7AE CONTAINING PROTEIN
4v5o.1.3	12.20	hetero-oligomer	HHblits	X-ray	3.93Å	0.26	0.15	RIBOSOMAL PROTEIN L7AE CONTAINING PROTEIN
4u5b.1.A	7.14	hetero-oligomer	HHblits	X-ray	3.50Å	0.24	0.15	Glutamate receptor 2
4u5b.1.B	7.14	hetero-oligomer	HHblits	X-ray	3.50Å	0.24	0.15	Glutamate receptor 2
4u5b.1.C	7.14	hetero-oligomer	HHblits	X-ray	3.50Å	0.24	0.15	Glutamate receptor 2
4u5b.1.D	7.14	hetero-oligomer	HHblits	X-ray	3.50Å	0.24	0.15	Glutamate receptor 2
4v8m.58.A	17.50	monomer	HHblits	EM	5.57Å	0.28	0.14	60S RIBOSOMAL PROTEIN L30
4n0q.1.A	17.95	monomer	HHblits	X-ray	2.30Å	0.30	0.14	Leu/Ile/Val-binding protein homolog 3
3jcs.1.b	17.50	hetero-oligomer	HHblits	EM	NA	0.28	0.14	ribosomal protein L30e
5t2a.23.A	17.50	monomer	HHblits	EM	NA	0.28	0.14	eL30
4q6w.1.A	7.50	monomer	HHblits	X-ray	1.84Å	0.28	0.14	Putative leu/ile/val-binding protein
5l1n.1.A	12.82	homo-dimer	HHblits	X-ray	3.60Å	0.30	0.14	Coenzyme A disulfide reductase
4v6w.7.A	15.00	monomer	HHblits	EM	NA	0.27	0.14	40S ribosomal protein S12
1usi.1.A	17.95	monomer	HHblits	X-ray	1.80Å	0.29	0.14	LEUCINE-SPECIFIC BINDING PROTEIN
1usg.1.A	17.95	homo-dimer	HHblits	X-ray	1.53Å	0.29	0.14	LEUCINE-SPECIFIC BINDING PROTEIN
2hqb.1.A	20.51	monomer	HHblits	X-ray	2.70Å	0.29	0.14	Transcriptional activator of comK gene
4lck.1.A	17.95	monomer	HHblits	X-ray	3.20Å	0.29	0.14	Ribosomal protein YbxF
4lck.2.A	17.95	monomer	HHblits	X-ray	3.20Å	0.29	0.14	Ribosomal protein YbxF
2liv.1.A	17.95	monomer	HHblits	X-ray	2.40Å	0.29	0.14	LEUCINE
4u4f.1.A	7.32	homo-tetramer	HHblits	X-ray	4.79Å	0.25	0.15	Glutamate receptor 2
4u4f.1.B	7.32	homo-tetramer	HHblits	X-ray	4.79Å	0.25	0.15	Glutamate receptor 2
4u4f.1.C	7.32	homo-tetramer	HHblits	X-ray	4.79Å	0.25	0.15	Glutamate receptor 2
4u4f.1.D	7.32	homo-tetramer	HHblits	X-ray	4.79Å	0.25	0.15	Glutamate receptor 2
4u4g.1.A	7.32	homo-tetramer	HHblits	X-ray	4.49Å	0.25	0.15	Glutamate receptor 2
4u4g.1.B	7.32	homo-tetramer	HHblits	X-ray	4.49Å	0.25	0.15	Glutamate receptor 2
4u4g.1.C	7.32	homo-tetramer	HHblits	X-ray	4.49Å	0.25	0.15	Glutamate receptor 2
4u4g.1.D	7.32	homo-tetramer	HHblits	X-ray	4.49Å	0.25	0.15	Glutamate receptor 2
4dqd.1.A	10.26	monomer	HHblits	X-ray	1.60Å	0.28	0.14	Extracellular ligand-binding receptor
1qo0.1.A	10.00	hetero-oligomer	HHblits	X-ray	2.25Å	0.26	0.14	AMIC
1pea.1.A	10.00	homo-dimer	HHblits	X-ray	2.10Å	0.26	0.14	AMIDASE OPERON
4eyk.1.A	12.82	monomer	HHblits	X-ray	1.90Å	0.28	0.14	Twin-arginine translocation pathway signal
4eqr.1.A	12.82	homo-dimer	HHblits	X-ray	1.80Å	0.28	0.14	Coenzyme A disulfide reductase
5er0.1.A	10.26	homo-dimer	HHblits	X-ray	2.41Å	0.28	0.14	NADH oxidase
4d67.1.1	15.38	hetero-oligomer	HHblits	EM	9.00Å	0.28	0.14	60S RIBOSOMAL PROTEIN L30
3j92.1.1	15.38	hetero-oligomer	HHblits	EM	NA	0.28	0.14	eL30
3j7o.1.4	15.38	hetero-oligomer	HHblits	EM	3.50Å	0.28	0.14	Ribosomal protein eL30
5t2c.43.A	15.38	monomer	HHblits	EM	NA	0.28	0.14	60S ribosomal protein L30
4ug0.28.A	15.38	monomer	HHblits	EM	NA	0.28	0.14	60S RIBOSOMAL PROTEIN L30
4v6x.63.A	15.38	monomer	HHblits	EM	NA	0.28	0.14	60S ribosomal protein L30
4v5z.48.A	15.38	monomer	HHblits	EM	NA	0.28	0.14	60S Ribosomal protein L30e
5lks.28.A	15.38	monomer	HHblits	EM	NA	0.28	0.14	60S ribosomal protein L30
5aj0.29.A	15.38	monomer	HHblits	EM	3.50Å	0.28	0.14	60S ribosomal protein L30
3vi6.1.A	15.38	monomer	HHblits	X-ray	1.59Å	0.28	0.14	60S ribosomal protein L30
4v6w.63.A	23.68	monomer	HHblits	EM	NA	0.30	0.14	60S ribosomal protein L30
3ukj.1.A	15.38	monomer	HHblits	X-ray	1.60Å	0.28	0.14	Extracellular ligand-binding receptor
5lzz.28.A	15.38	monomer	HHblits	EM	3.47Å	0.27	0.14	eL30
3nnd.1.A	12.50	homo-tetramer	HHblits	X-ray	2.80Å	0.25	0.14	Possible substrate binding protein of ABC transporter system
3saj.1.A	15.00	homo-dimer	HHblits	X-ray	2.50Å	0.25	0.14	Glutamate receptor 1
3saj.1.B	15.00	homo-dimer	HHblits	X-ray	2.50Å	0.25	0.14	Glutamate receptor 1
3saj.2.A	15.00	homo-dimer	HHblits	X-ray	2.50Å	0.25	0.14	Glutamate receptor 1
3saj.2.B	15.00	homo-dimer	HHblits	X-ray	2.50Å	0.25	0.14	Glutamate receptor 1
1qnl.1.A	10.26	homo-tetramer	HHblits	X-ray	2.70Å	0.27	0.14	ALIPHATIC AMIDASE EXPRESSION-REGULATING PROTEIN
4ru0.1.A	10.26	monomer	HHblits	X-ray	2.44Å	0.27	0.14	Putative branched-chain amino acid ABC transporter, periplasmic branched-chain amino acid-binding protein
3lkv.1.A	21.62	homo-dimer	HHblits	X-ray	2.20Å	0.31	0.13	uncharacterized CONSERVED DOMAIN PROTEIN
4mlc.1.A	21.62	monomer	HHblits	X-ray	2.71Å	0.31	0.13	Extracellular ligand-binding receptor
4q6b.1.A	21.62	monomer	HHblits	X-ray	1.67Å	0.31	0.13	Extracellular ligand-binding receptor
5ide.1.A	7.50	hetero-oligomer	HHblits	EM	NA	0.25	0.14	Glutamate receptor 2
5ide.1.C	7.50	hetero-oligomer	HHblits	EM	NA	0.25	0.14	Glutamate receptor 2
5idf.1.A	7.50	hetero-oligomer	HHblits	EM	NA	0.25	0.14	Glutamate receptor 2
5idf.1.C	7.50	hetero-oligomer	HHblits	EM	NA	0.25	0.14	Glutamate receptor 2
5kbv.1.A	7.50	homo-tetramer	HHblits	EM	NA	0.25	0.14	Glutamate receptor 2
5kbv.1.B	7.50	homo-tetramer	HHblits	EM	NA	0.25	0.14	Glutamate receptor 2
5kbv.1.C	7.50	homo-tetramer	HHblits	EM	NA	0.25	0.14	Glutamate receptor 2
5kbv.1.D	7.50	homo-tetramer	HHblits	EM	NA	0.25	0.14	Glutamate receptor 2
5l1g.1.C	7.50	homo-tetramer	HHblits	X-ray	4.51Å	0.25	0.14	Glutamate receptor 2
5l1g.1.B	7.50	homo-tetramer	HHblits	X-ray	4.51Å	0.25	0.14	Glutamate receptor 2
5l1g.1.A	7.50	homo-tetramer	HHblits	X-ray	4.51Å	0.25	0.14	Glutamate receptor 2
5l1g.1.D	7.50	homo-tetramer	HHblits	X-ray	4.51Å	0.25	0.14	Glutamate receptor 2
5l1b.1.D	7.50	homo-tetramer	HHblits	X-ray	4.00Å	0.25	0.14	Glutamate receptor 2,Glutamate receptor 2
5l1b.1.C	7.50	homo-tetramer	HHblits	X-ray	4.00Å	0.25	0.14	Glutamate receptor 2,Glutamate receptor 2
5l1b.1.B	7.50	homo-tetramer	HHblits	X-ray	4.00Å	0.25	0.14	Glutamate receptor 2,Glutamate receptor 2
5l1b.1.A	7.50	homo-tetramer	HHblits	X-ray	4.00Å	0.25	0.14	Glutamate receptor 2,Glutamate receptor 2
2zvi.1.A	10.53	homo-dimer	HHblits	X-ray	2.30Å	0.28	0.14	2,3-diketo-5-methylthiopentyl-1-phosphate enolase
2zvi.1.B	10.53	homo-dimer	HHblits	X-ray	2.30Å	0.28	0.14	2,3-diketo-5-methylthiopentyl-1-phosphate enolase
2zvi.2.A	10.53	homo-dimer	HHblits	X-ray	2.30Å	0.28	0.14	2,3-diketo-5-methylthiopentyl-1-phosphate enolase
2oek.1.A	13.51	homo-dimer	HHblits	X-ray	1.80Å	0.30	0.13	2,3-diketo-5-methylthiopentyl-1-phosphate enolase
4evq.1.A	18.42	monomer	HHblits	X-ray	1.40Å	0.28	0.14	Putative ABC transporter subunit, substrate-binding component
1f0k.1.A	10.00	homo-dimer	HHblits	X-ray	1.90Å	0.23	0.14	UDP-N-ACETYLGLUCOSAMINE-N-ACETYLMURAMYL-(PENTAPEPTIDE) PYROPHOSPHORYL-UNDECAPRENOL N-ACETYLGLUCOSAMINE TRANSFERASE
1f0k.1.B	10.00	homo-dimer	HHblits	X-ray	1.90Å	0.23	0.14	UDP-N-ACETYLGLUCOSAMINE-N-ACETYLMURAMYL-(PENTAPEPTIDE) PYROPHOSPHORYL-UNDECAPRENOL N-ACETYLGLUCOSAMINE TRANSFERASE
1nlm.1.A	10.00	homo-dimer	HHblits	X-ray	2.50Å	0.23	0.14	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase
1nlm.1.B	10.00	homo-dimer	HHblits	X-ray	2.50Å	0.23	0.14	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase
3i45.1.A	7.69	monomer	HHblits	X-ray	1.36Å	0.25	0.14	Twin-arginine translocation pathway signal protein
3tx6.1.A	7.69	monomer	HHblits	X-ray	1.50Å	0.25	0.14	Putative branched-chain amino acid transport system substrate-binding protein
3uk0.1.A	7.69	monomer	HHblits	X-ray	1.49Å	0.25	0.14	Extracellular ligand-binding receptor
3ukj.1.A	7.69	monomer	HHblits	X-ray	1.60Å	0.25	0.14	Extracellular ligand-binding receptor
3vrd.1.B	19.44	hetero-oligomer	HHblits	X-ray	1.50Å	0.31	0.13	Flavocytochrome c flavin subunit
4maa.1.A	7.89	monomer	HHblits	X-ray	2.00Å	0.27	0.14	Putative branched-chain amino acid ABC transporter, periplasmic amino acid-binding protein
2lbp.1.A	13.16	monomer	HHblits	X-ray	2.40Å	0.27	0.14	LEUCINE-BINDING PROTEIN
4n0q.1.A	16.22	monomer	HHblits	X-ray	2.30Å	0.28	0.13	Leu/Ile/Val-binding protein homolog 3
4maa.1.A	15.79	monomer	HHblits	X-ray	2.00Å	0.26	0.14	Putative branched-chain amino acid ABC transporter, periplasmic amino acid-binding protein
3t8q.1.A	25.00	homo-dimer	HHblits	X-ray	2.00Å	0.30	0.13	Mandelate racemase/muconate lactonizing enzyme family protein
4obb.1.A	10.81	monomer	HHblits	X-ray	1.53Å	0.28	0.13	Amino acid/amide ABC transporter substrate-binding protein, HAAT family
4nv3.1.A	10.81	monomer	HHblits	X-ray	1.09Å	0.28	0.13	Amino acid/amide ABC transporter substrate-binding protein, HAAT family
3ipa.1.A	10.81	monomer	HHblits	X-ray	1.55Å	0.28	0.13	ABC transporter, substrate binding protein (Amino acid)
4jb0.1.A	7.89	monomer	HHblits	X-ray	1.91Å	0.25	0.14	branched-chain amino acid transport system substrate-binding protein
3hut.1.A	20.00	monomer	HHblits	X-ray	1.93Å	0.32	0.13	putative branched-chain amino acid ABC transporter
4dqd.1.A	7.89	monomer	HHblits	X-ray	1.60Å	0.25	0.14	Extracellular ligand-binding receptor
3u4f.1.A	22.22	homo-dimer	HHblits	X-ray	1.90Å	0.29	0.13	Mandelate racemase/muconate lactonizing enzyme family protein
3h5v.2.A	7.89	homo-dimer	HHblits	X-ray	2.33Å	0.25	0.14	Glutamate receptor 2
3h5v.1.B	7.89	homo-dimer	HHblits	X-ray	2.33Å	0.25	0.14	Glutamate receptor 2
3h5v.1.A	7.89	homo-dimer	HHblits	X-ray	2.33Å	0.25	0.14	Glutamate receptor 2
3h5w.1.A	7.89	homo-dimer	HHblits	X-ray	2.69Å	0.25	0.14	Glutamate receptor 2
3h5w.1.B	7.89	homo-dimer	HHblits	X-ray	2.69Å	0.25	0.14	Glutamate receptor 2
4h1z.1.A	13.89	homo-octamer	HHblits	X-ray	2.01Å	0.29	0.13	Enolase Q92Zs5
3sg0.1.A	5.26	monomer	HHblits	X-ray	1.20Å	0.24	0.14	Extracellular ligand-binding receptor
4f06.1.A	8.11	monomer	HHblits	X-ray	1.30Å	0.26	0.13	Extracellular ligand-binding receptor
5cx1.1.A	11.11	hetero-oligomer	HHblits	X-ray	1.75Å	0.28	0.13	Nitrogenase molybdenum-iron protein alpha chain
3my9.1.A	13.51	homo-octamer	HHblits	X-ray	2.20Å	0.25	0.13	Muconate cycloisomerase
4q6w.1.A	2.70	monomer	HHblits	X-ray	1.84Å	0.25	0.13	Putative leu/ile/val-binding protein
3hly.1.A	22.86	monomer	HHblits	X-ray	2.40Å	0.29	0.13	Flavodoxin-like domain
3hly.2.A	22.86	monomer	HHblits	X-ray	2.40Å	0.29	0.13	Flavodoxin-like domain
3hly.3.A	22.86	monomer	HHblits	X-ray	2.40Å	0.29	0.13	Flavodoxin-like domain
1qo0.1.A	5.41	hetero-oligomer	HHblits	X-ray	2.25Å	0.25	0.13	AMIC
1pea.1.A	5.41	homo-dimer	HHblits	X-ray	2.10Å	0.25	0.13	AMIDASE OPERON
2ppg.1.A	14.29	homo-octamer	HHblits	X-ray	2.49Å	0.29	0.13	Putative isomerase
2ppg.1.C	14.29	homo-octamer	HHblits	X-ray	2.49Å	0.29	0.13	Putative isomerase
5fwy.1.B	10.81	hetero-oligomer	HHblits	X-ray	2.12Å	0.25	0.13	GLUTAMATE RECEPTOR 3
3o21.2.A	10.81	homo-dimer	HHblits	X-ray	2.20Å	0.25	0.13	Glutamate receptor 3
3o21.1.B	10.81	homo-dimer	HHblits	X-ray	2.20Å	0.25	0.13	Glutamate receptor 3
3o21.1.A	10.81	homo-dimer	HHblits	X-ray	2.20Å	0.25	0.13	Glutamate receptor 3
3p3w.1.A	10.81	homo-dimer	HHblits	X-ray	4.20Å	0.25	0.13	Glutamate receptor 3
3p3w.1.B	10.81	homo-dimer	HHblits	X-ray	4.20Å	0.25	0.13	Glutamate receptor 3
3td9.1.A	2.70	homo-dimer	HHblits	X-ray	1.90Å	0.23	0.13	Branched chain amino acid ABC transporter, periplasmic amino acid-binding protein
4gpa.1.A	17.14	homo-dimer	HHblits	X-ray	2.25Å	0.27	0.13	Glutamate receptor 4
5fwx.1.B	17.14	hetero-oligomer	HHblits	X-ray	2.50Å	0.27	0.13	GLUTAMATE RECEPTOR 4
3o2j.1.A	8.33	homo-dimer	HHblits	X-ray	1.95Å	0.25	0.13	Glutamate receptor 2
3o2j.1.B	8.33	homo-dimer	HHblits	X-ray	1.95Å	0.25	0.13	Glutamate receptor 2
3ijd.1.A	17.14	homo-dimer	HHblits	X-ray	2.00Å	0.27	0.13	uncharacterized protein
3ks9.1.A	15.15	homo-dimer	HHblits	X-ray	1.90Å	0.30	0.12	Metabotropic glutamate receptor 1
2f9f.1.A	18.75	monomer	HHblits	X-ray	1.80Å	0.29	0.12	first mannosyl transferase (wbaZ-1)
2vdc.1.G	19.35	hetero-oligomer	HHblits	EM	9.50Å	0.31	0.11	GLUTAMATE SYNTHASE [NADPH] SMALL CHAIN
5dmm.1.A	15.63	monomer	HHblits	X-ray	1.78Å	0.28	0.12	Homocysteine S-methyltransferase
5dmn.1.A	15.63	homo-dimer	HHblits	X-ray	2.89Å	0.28	0.12	Homocysteine S-methyltransferase
1usi.1.A	27.59	monomer	HHblits	X-ray	1.80Å	0.33	0.10	LEUCINE-SPECIFIC BINDING PROTEIN
1usg.1.A	27.59	homo-dimer	HHblits	X-ray	1.53Å	0.33	0.10	LEUCINE-SPECIFIC BINDING PROTEIN
3saj.1.A	16.67	homo-dimer	HHblits	X-ray	2.50Å	0.29	0.11	Glutamate receptor 1
3saj.1.B	16.67	homo-dimer	HHblits	X-ray	2.50Å	0.29	0.11	Glutamate receptor 1
3saj.2.A	16.67	homo-dimer	HHblits	X-ray	2.50Å	0.29	0.11	Glutamate receptor 1
3saj.2.B	16.67	homo-dimer	HHblits	X-ray	2.50Å	0.29	0.11	Glutamate receptor 1
5fwy.1.B	17.24	hetero-oligomer	HHblits	X-ray	2.12Å	0.30	0.10	GLUTAMATE RECEPTOR 3
3o21.2.A	17.24	homo-dimer	HHblits	X-ray	2.20Å	0.30	0.10	Glutamate receptor 3
3o21.1.B	17.24	homo-dimer	HHblits	X-ray	2.20Å	0.30	0.10	Glutamate receptor 3
3o21.1.A	17.24	homo-dimer	HHblits	X-ray	2.20Å	0.30	0.10	Glutamate receptor 3
3p3w.1.A	17.24	homo-dimer	HHblits	X-ray	4.20Å	0.30	0.10	Glutamate receptor 3
3p3w.1.B	17.24	homo-dimer	HHblits	X-ray	4.20Å	0.30	0.10	Glutamate receptor 3
3n0w.1.A	10.00	monomer	HHblits	X-ray	1.88Å	0.27	0.11	ABC branched chain amino acid family transporter, periplasmic ligand binding protein
3i09.1.A	17.24	monomer	HHblits	X-ray	1.80Å	0.27	0.10	Periplasmic branched-chain amino acid-binding protein
3n0x.1.A	6.67	monomer	HHblits	X-ray	1.50Å	0.23	0.11	Possible substrate binding protein of ABC transporter system
4rpg.1.A	26.92	homo-dimer	HHblits	X-ray	2.40Å	0.34	0.09	UDP-galactopyranose mutase
4rpl.2.B	26.92	homo-dimer	HHblits	X-ray	2.25Å	0.34	0.09	UDP-galactopyranose mutase
4ccz.1.A	14.29	monomer	HHblits	X-ray	2.70Å	0.28	0.10	METHIONINE SYNTHASE
5dkv.1.A	24.00	monomer	HHblits	X-ray	1.68Å	0.31	0.09	ABC transporter substrate binding protein (Ribose)
5dkv.4.A	24.00	monomer	HHblits	X-ray	1.68Å	0.31	0.09	ABC transporter substrate binding protein (Ribose)
1gub.1.A	11.54	monomer	HHblits	X-ray	3.10Å	0.25	0.09	D-ALLOSE-BINDING PERIPLASMIC PROTEIN
1gud.1.A	11.54	monomer	HHblits	X-ray	1.71Å	0.25	0.09	D-ALLOSE-BINDING PERIPLASMIC PROTEIN
1gud.2.A	11.54	monomer	HHblits	X-ray	1.71Å	0.25	0.09	D-ALLOSE-BINDING PERIPLASMIC PROTEIN
1rpj.1.A	11.54	monomer	HHblits	X-ray	1.80Å	0.25	0.09	PROTEIN (PRECURSOR OF PERIPLASMIC SUGAR RECEPTOR)
4zpj.1.A	7.69	monomer	HHblits	X-ray	2.24Å	0.24	0.09	Extracellular ligand-binding receptor
4rs3.1.A	16.67	monomer	HHblits	X-ray	1.40Å	0.30	0.09	ABC transporter, carbohydrate uptake transporter-2 (CUT2) family, periplasmic sugar-binding protein
4rsm.1.A	12.50	monomer	HHblits	X-ray	1.60Å	0.30	0.09	Periplasmic binding protein/LacI transcriptional regulator
3brs.1.A	21.74	monomer	HHblits	X-ray	2.00Å	0.33	0.08	Periplasmic binding protein/LacI transcriptional regulator
5bra.1.A	8.00	monomer	HHblits	X-ray	2.97Å	0.26	0.09	Putative periplasmic binding protein with substrate ribose
2uyy.1.A	45.00	homo-tetramer	HHblits	X-ray	2.50Å	0.43	0.07	N-PAC PROTEIN
1drk.1.A	16.67	monomer	HHblits	X-ray	2.00Å	0.28	0.09	D-RIBOSE-BINDING PROTEIN
4yo7.1.A	8.33	monomer	HHblits	X-ray	1.70Å	0.28	0.09	Sugar ABC transporter (Sugar-binding protein)
1dbq.1.A	22.73	homo-dimer	HHblits	X-ray	2.20Å	0.34	0.08	PURINE REPRESSOR
1dbq.1.B	22.73	homo-dimer	HHblits	X-ray	2.20Å	0.34	0.08	PURINE REPRESSOR
1jhz.1.A	22.73	homo-dimer	HHblits	X-ray	2.40Å	0.34	0.08	PURINE NUCLEOTIDE SYNTHESIS REPRESSOR
1jhz.1.B	22.73	homo-dimer	HHblits	X-ray	2.40Å	0.34	0.08	PURINE NUCLEOTIDE SYNTHESIS REPRESSOR
1bdi.1.B	22.73	homo-dimer	HHblits	X-ray	3.00Å	0.34	0.08	PROTEIN (PURINE REPRESSOR)
1jft.1.B	22.73	homo-dimer	HHblits	X-ray	2.50Å	0.34	0.08	PURINE NUCLEOTIDE SYNTHESIS REPRESSOR
4zn0.1.A	26.09	homo-dimer	HHblits	X-ray	2.60Å	0.30	0.08	Thioredoxin reductase
4zn0.1.B	26.09	homo-dimer	HHblits	X-ray	2.60Å	0.30	0.08	Thioredoxin reductase
5ufh.1.A	17.39	homo-dimer	HHblits	X-ray	1.45Å	0.30	0.08	LacI-type transcriptional regulator
4ywh.1.A	13.04	monomer	HHblits	X-ray	2.35Å	0.29	0.08	ABC TRANSPORTER SOLUTE BINDING PROTEIN
4ry9.1.A	17.39	monomer	HHblits	X-ray	1.40Å	0.29	0.08	Periplasmic binding protein/LacI transcriptional regulator
1qnl.1.A	13.64	homo-tetramer	HHblits	X-ray	2.70Å	0.32	0.08	ALIPHATIC AMIDASE EXPRESSION-REGULATING PROTEIN
2liv.1.A	27.27	monomer	HHblits	X-ray	2.40Å	0.32	0.08	LEUCINE
3lkv.1.A	20.83	homo-dimer	HHblits	X-ray	2.20Å	0.26	0.09	uncharacterized CONSERVED DOMAIN PROTEIN
2gx6.1.A	13.04	monomer	HHblits	X-ray	1.97Å	0.28	0.08	D-ribose-binding periplasmic protein
1m7h.4.B	12.50	homo-tetramer	HHblits	X-ray	2.00Å	0.25	0.09	Adenylylsulfate kinase
1d6j.1.B	12.50	homo-dimer	HHblits	X-ray	2.00Å	0.25	0.09	ADENOSINE-5'PHOSPHOSULFATE KINASE
1d6j.1.A	12.50	homo-dimer	HHblits	X-ray	2.00Å	0.25	0.09	ADENOSINE-5'PHOSPHOSULFATE KINASE
1m7h.4.C	12.50	homo-tetramer	HHblits	X-ray	2.00Å	0.25	0.09	Adenylylsulfate kinase
1m7g.5.A	12.50	homo-tetramer	HHblits	X-ray	1.43Å	0.25	0.09	Adenylylsulfate kinase
3ma0.1.A	8.70	monomer	HHblits	X-ray	2.20Å	0.28	0.08	D-xylose-binding periplasmic protein
3m9w.1.A	8.70	monomer	HHblits	X-ray	2.15Å	0.28	0.08	D-xylose-binding periplasmic protein
1tm2.1.A	8.70	monomer	HHblits	X-ray	1.90Å	0.28	0.08	sugar transport protein
1tjy.1.A	8.70	monomer	HHblits	X-ray	1.30Å	0.28	0.08	sugar transport protein
4rxm.1.A	17.39	monomer	HHblits	X-ray	1.75Å	0.28	0.08	Possible sugar ABC superfamily ATP binding cassette transporter, binding protein
3sqs.1.A	17.39	homo-octamer	HHblits	X-ray	1.90Å	0.28	0.08	mandelate racemase/muconate lactonizing protein
1glg.1.A	13.04	monomer	HHblits	X-ray	2.00Å	0.27	0.08	GALACTOSE/GLUCOSE-BINDING PROTEIN
2qw1.1.A	13.04	monomer	HHblits	X-ray	1.70Å	0.27	0.08	D-galactose-binding periplasmic protein
2fvy.1.A	13.04	monomer	HHblits	X-ray	0.92Å	0.27	0.08	D-galactose-binding periplasmic protein
2ipm.1.A	13.04	monomer	HHblits	X-ray	1.12Å	0.27	0.08	D-galactose-binding periplasmic protein
2ipn.1.A	13.04	monomer	HHblits	X-ray	1.15Å	0.27	0.08	D-galactose-binding periplasmic protein
5ibq.1.A	13.04	monomer	HHblits	X-ray	1.20Å	0.27	0.08	Probable ribose ABC transporter, substrate-binding protein
4o5a.1.A	17.39	homo-dimer	HHblits	X-ray	1.78Å	0.26	0.08	LacI family transcription regulator
4zjp.1.A	18.18	monomer	HHblits	X-ray	1.63Å	0.30	0.08	Monosaccharide-transporting ATPase
3dfu.1.A	13.64	homo-dimer	HHblits	X-ray	2.07Å	0.30	0.08	Uncharacterized Protein from 6-Phosphogluconate Dehydrogenase-Like Family
3dfu.1.B	13.64	homo-dimer	HHblits	X-ray	2.07Å	0.30	0.08	Uncharacterized Protein from 6-Phosphogluconate Dehydrogenase-Like Family
3nzg.1.A	13.04	homo-octamer	HHblits	X-ray	2.00Å	0.26	0.08	Putative racemase
2ipl.1.A	13.64	monomer	HHblits	X-ray	1.20Å	0.28	0.08	D-galactose-binding periplasmic protein
5kws.1.A	13.64	monomer	HHblits	X-ray	1.32Å	0.28	0.08	Galactose-binding protein
2hph.1.A	13.64	monomer	HHblits	X-ray	1.33Å	0.28	0.08	D-galactose-binding periplasmic protein
5xd7.1.A	4.35	homo-dimer	HHblits	X-ray	2.20Å	0.24	0.08	3,6-anhydro-alpha-L-galactonate cycloisomerase
3sjn.1.A	9.09	homo-octamer	HHblits	X-ray	1.90Å	0.27	0.08	Mandelate racemase/muconate lactonizing protein
3k9c.1.A	4.76	homo-dimer	HHblits	X-ray	2.14Å	0.29	0.08	Transcriptional regulator, LacI family protein
4jn7.1.A	9.09	homo-octamer	HHblits	X-ray	1.15Å	0.25	0.08	ENOLASE
4dwd.1.A	14.29	homo-octamer	HHblits	X-ray	1.50Å	0.28	0.08	Mandelate racemase/muconate lactonizing enzyme, C-terminal domain protein
3tq0.1.A	14.29	homo-dimer	HHblits	X-ray	1.90Å	0.27	0.08	Dihydroorotate dehydrogenase
3gbp.1.A	9.52	monomer	HHblits	X-ray	2.40Å	0.26	0.08	GALACTOSE-BINDING PROTEIN
2w0u.1.A	10.00	homo-tetramer	HHblits	X-ray	2.84Å	0.29	0.07	HYDROXYACID OXIDASE 1
3ipc.1.A	10.00	monomer	HHblits	X-ray	1.30Å	0.28	0.07	ABC transporter, substrate binding protein (Amino acid)
4evs.1.A	10.00	monomer	HHblits	X-ray	1.45Å	0.27	0.07	PUTATIVE ABC TRANSPORTER SUBUNIT, SUBSTRATE-BINDING COMPONENT
4eyk.1.A	10.00	monomer	HHblits	X-ray	1.90Å	0.27	0.07	Twin-arginine translocation pathway signal
1urp.1.A	0.00	monomer	HHblits	X-ray	2.30Å	0.26	0.07	D-RIBOSE-BINDING PROTEIN
2dri.1.A	0.00	monomer	HHblits	X-ray	1.60Å	0.26	0.07	D-RIBOSE-BINDING PROTEIN
4ry0.1.A	10.00	monomer	HHblits	X-ray	1.40Å	0.26	0.07	Probable ribose ABC transporter, substrate-binding protein
1z16.1.A	13.33	monomer	HHblits	X-ray	1.72Å	0.26	0.05	Leu/Ile/Val-binding protein
1z15.1.A	13.33	monomer	HHblits	X-ray	1.70Å	0.26	0.05	Leu/Ile/Val-binding protein