SWISS-MODEL | Workspace | Model Results

SWISS-MODEL Homology Modelling Report

Model Building Report

This document lists the results for the homology modelling project "A0A076GRR6-MurA-E-faecium" submitted to SWISS-MODEL workspace on Oct. 15, 2017, 7:19 p.m..The submitted primary amino acid sequence is given in Table T1.

If you use any results in your research, please cite the relevant publications:

Marco Biasini; Stefan Bienert; Andrew Waterhouse; Konstantin Arnold; Gabriel Studer; Tobias Schmidt; Florian Kiefer; Tiziano Gallo Cassarino; Martino Bertoni; Lorenza Bordoli; Torsten Schwede. (2014). SWISS-MODEL: modelling protein tertiary and quaternary structure using evolutionary information. Nucleic Acids Research (1 July 2014) 42 (W1): W252-W258; doi: 10.1093/nar/gku340.
Arnold, K., Bordoli, L., Kopp, J. and Schwede, T. (2006) The SWISS-MODEL workspace: a web-based environment for protein structure homology modelling. Bioinformatics, 22, 195-201.
Benkert, P., Biasini, M. and Schwede, T. (2011) Toward the estimation of the absolute quality of individual protein structure models. Bioinformatics, 27, 343-350

Results

The SWISS-MODEL template library (SMTL version 2017-09-21, PDB release 2017-09-15) was searched with Blast (Altschul et al., 1997) and HHBlits (Remmert, et al., 2011) for evolutionary related structures matching the target sequence in Table T1. For details on the template search, see Materials and Methods. Overall 244 templates were found (Table T2).

Models

The following models were built (see Materials and Methods "Model Building"):

Model #01	File	Built with	Oligo-State	Ligands	GMQE	QMEAN
	PDB	ProMod3 Version 1.0.2.	MONOMER	None	0.78	-1.86

QMEAN	-1.86
Cβ	-0.73
All Atom	-0.22
Solvation	0.04
Torsion	-1.82

Template	Seq Identity	Oligo-state	Found by	Method	Resolution	Seq Similarity	Range	Coverage	Description
3sg1.1.A	49.15	monomer	BLAST	X-ray	2.60Å	0.43	1 - 415	0.98	UDP-N-acetylglucosamine 1-carboxyvinyltransferase 1

The template contained no ligands.

Target    MKKIVIKGNRPLAGEVTISGAKNSAVALIPAAILA-DSPVILEGVPDIQDVHSLIEILEIMGATVHFSNNILEIDPREIV
3sg1.1.A  MEKIIVRGGKRLNGTVRVEGAKNAVLPIIAAALLASDGKNVLSEVPVLSDVYTINEVLRHLNAEVVFENNQVTIDASKEL

Target    SVPMPHGKINSLRASYYFMGTLLGKFGEAVVGLPGGCYLGPRPIDLHVKGFEALGAEVTNEHGAMYLRTENEGLHGNRIF
3sg1.1.A  NIEAPFEYVRKMRASVQVMGPLLARNGRARIALPGGCAIGSRPIDQHLKGFEAMGAKVQVGNGFVEAYVEGE-LKGAKIY

Target    MDVVSVGATINVMLAAVKAKGQTVIENAAREPEIIDVATLLNNMGAKVRGAGTDVIRIEGVEALHGCRHFMIPDRIEAGT
3sg1.1.A  LDFPSVGATENIMSAATLAKGTTILENAAKEPEIVDLANFLNAMGAKVRGAGTGTIRIEGVDKLYGANHSIIPDRIEAGT

Target    YLALAAAAGNGIKVKNVIFEHLESFIAKLQEIGVHMKISEDE-IEVYPSKELKAANIMTYPYPGFATDLQQPLTALLLMT
3sg1.1.A  FMVAAAITGGDILIENAVPEHLRSITAKMEEMGVKI-IEENEGVRVIGPDKLKAVDIKTMPHPGFPTDMQSQMMALLLQA

Target    VGTSEIIDTIYAKRVNHVPELARMGADITVEGNMIIVNGPNKLHGTEVVASDLRAGACLVIAGLLAEGTTTIYNVDYILR
3sg1.1.A  DGTSMITETVFENRFMHVEEFRRMNADIKIEGRSVIMNGPNSLQGAEVGATDLRAAAALILAGLVSEGYTRVTELKHLDR

Target    GYDHIIEKLTALGASIEMTEEVGAE
3sg1.1.A  GYVDFHKKLAALGATIE--------

Model #02	File	Built with	Oligo-State	Ligands	GMQE	QMEAN
	PDB	ProMod3 Version 1.0.2.	MONOMER	None	0.16	-2.63

QMEAN	-2.63
Cβ	-1.12
All Atom	-0.59
Solvation	-0.85
Torsion	-2.28

Template	Seq Identity	Oligo-state	Found by	Method	Resolution	Seq Similarity	Range	Coverage	Description
1rf4.1.A	31.93	monomer	BLAST	X-ray	2.20Å	0.36	298 - 418	0.28	5-enolpyruvylshikimate-3-phosphate synthase

Ligand	Added to Model	Description
SPQ	✕ - Binding site not conserved.	(3R,4S,5R)-5-{[(1R)-1-CARBOXY-2-FLUORO-1-(PHOSPHONOOXY)ETHYL]OXY}-4-HYDROXY-3-(PHOSPHONOOXY)CYCLOHEX-1-ENE-1-CARBOXYLIC ACID

Target    MKKIVIKGNRPLAGEVTISGAKNSAVALIPAAILADSPVILEGVPDIQDVHSLIEILEIMGATVHFSNNILEIDPREIVS
1rf4.1.A  --------------------------------------------------------------------------------

Target    VPMPHGKINSLRASYYFMGTLLGKFGEAVVGLPGGCYLGPRPIDLHVKGFEALGAEVTNEHGAMYLRTENEGLHGNRIFM
1rf4.1.A  --------------------------------------------------------------------------------

Target    DVVSVGATINVMLAAVKAKGQTVIENAAREPEIIDVATLLNNMGAKVRGAGTDVIRIEGVEALHGCRHFMIPDRIEAGTY
1rf4.1.A  --------------------------------------------------------------------------------

Target    LALAAAAGNGIKVKNVIFEHLESFIAKLQEIGVHMKISEDEIEVYPSKELKAANIMTYPYPGFATDLQQPLTALLLMTVG
1rf4.1.A  ---------------------------------------------------------YELPIASAQVKSALMFAALQAKG

Target    TSEIIDTIYAKRVNHVPE-LARMGADITVEGNMIIVNGPNKLHGTEVVA-SDLRAGACLVIAGLLAEGTTTIYNVDYILR
1rf4.1.A  ESVIIEKEYTR--NHTEDMLQQFGGHLSVDGKKITVQGPQKLTGQKVVVPGDISSAAFWLVAGLIAPNSRLVLQNVGINE

Target    GYDHIIEKLTALGASIEMTEEVGAE
1rf4.1.A  TRTGIIDVIRAMGGKLEITE-----

Materials and Methods

Template Search

Template search with Blast and HHBlits has been performed against the SWISS-MODEL template library (SMTL, last update: 2017-09-21, last included PDB release: 2017-09-15).

The target sequence was searched with BLAST (Altschul et al., 1997) against the primary amino acid sequence contained in the SMTL. A total of 64 templates were found.

An initial HHblits profile has been built using the procedure outlined in (Remmert, et al., 2011), followed by 1 iteration of HHblits against NR20. The obtained profile has then be searched against all profiles of the SMTL. A total of 182 templates were found.

Template Selection

For each identified template, the template's quality has been predicted from features of the target-template alignment. The templates with the highest quality have then been selected for model building.

Model Building

Models are built based on the target-template alignment using ProMod3. Coordinates which are conserved between the target and the template are copied from the template to the model. Insertions and deletions are remodelled using a fragment library. Side chains are then rebuilt. Finally, the geometry of the resulting model is regularized by using a force field. In case loop modelling with ProMod3 fails, an alternative model is built with PROMOD-II (Guex, et al., 1997).

Model Quality Estimation

The global and per-residue model quality has been assessed using the QMEAN scoring function (Benkert, et al., 2011) . For improved performance, weights of the individual QMEAN terms have been trained specifically for SWISS-MODEL.

Ligand Modelling

Ligands present in the template structure are transferred by homology to the model when the following criteria are met (Gallo -Casserino, to be published): (a) The ligands are annotated as biologically relevant in the template library, (b) the ligand is in contact with the model, (c) the ligand is not clashing with the protein, (d) the residues in contact with the ligand are conserved between the target and the template. If any of these four criteria is not satisfied, a certain ligand will not be included in the model. The model summary includes information on why and which ligand has not been included.

Oligomeric State Conservation

Homo-oligomeric structure of the target protein is predicted based on the analysis of pairwise interfaces of the identified template structures. For each relevant interface between polypeptide chains (interfaces with more than 10 residue-residue interactions), the QscoreOligomer (Mariani et al., 2011) is predicted from features such as similarity to target and frequency of observing this interface in the identified templates (Kiefer, Bertoni, Biasini, to be published). The prediction is performed with a random forest regressor using these features as input parameters to predict the probability of conservation for each interface. The QscoreOligomer of the whole complex is then calculated as the weight-averaged QscoreOligomer of the interfaces. The oligomeric state of the target is predicted to be the same as in the template when QscoreOligomer is predicted to be higher or equal to 0.5.

References

Altschul, S.F., Madden, T.L., Schaffer, A.A., Zhang, J., Zhang, Z., Miller, W. and Lipman, D.J. (1997) Gapped BLAST and PSI-BLAST: a new generation of protein database search programs. Nucleic Acids Res, 25, 3389-3402.
Remmert, M., Biegert, A., Hauser, A. and Soding, J. (2012) HHblits: lightning-fast iterative protein sequence searching by HMM-HMM alignment. Nat Methods, 9, 173-175.
Guex, N. and Peitsch, M.C. (1997) SWISS-MODEL and the Swiss-PdbViewer: an environment for comparative protein modeling. Electrophoresis, 18, 2714-2723.
Sali, A. and Blundell, T.L. (1993) Comparative protein modelling by satisfaction of spatial restraints. J Mol Biol, 234, 779-815.
Benkert, P., Biasini, M. and Schwede, T. (2011) Toward the estimation of the absolute quality of individual protein structure models. Bioinformatics, 27, 343-350.
Mariani, V., Kiefer, F., Schmidt, T., Haas, J. and Schwede, T. (2011) Assessment of template based protein structure predictions in CASP9. Proteins, 79 Suppl 10, 37-58.

Table T1:

Primary amino acid sequence for which templates were searched and models were built.

MKKIVIKGNRPLAGEVTISGAKNSAVALIPAAILADSPVILEGVPDIQDVHSLIEILEIMGATVHFSNNILEIDPREIVSVPMPHGKINSLRASYYFMGT
LLGKFGEAVVGLPGGCYLGPRPIDLHVKGFEALGAEVTNEHGAMYLRTENEGLHGNRIFMDVVSVGATINVMLAAVKAKGQTVIENAAREPEIIDVATLL
NNMGAKVRGAGTDVIRIEGVEALHGCRHFMIPDRIEAGTYLALAAAAGNGIKVKNVIFEHLESFIAKLQEIGVHMKISEDEIEVYPSKELKAANIMTYPY
PGFATDLQQPLTALLLMTVGTSEIIDTIYAKRVNHVPELARMGADITVEGNMIIVNGPNKLHGTEVVASDLRAGACLVIAGLLAEGTTTIYNVDYILRGY
DHIIEKLTALGASIEMTEEVGAE

Table T2:

Template	Seq Identity	Oligo-state	Found by	Method	Resolution	Seq Similarity	Coverage	Description
3zh4.1.A	66.59	monomer	HHblits	X-ray	1.80Å	0.49	0.99	UDP-N-ACETYLGLUCOSAMINE 1-CARBOXYVINYLTRANSFERASE
3zh3.1.A	66.35	monomer	HHblits	X-ray	2.90Å	0.48	0.99	UDP-N-ACETYLGLUCOSAMINE 1-CARBOXYVINYLTRANSFERASE
3sg1.1.A	47.61	monomer	HHblits	X-ray	2.60Å	0.42	0.99	UDP-N-acetylglucosamine 1-carboxyvinyltransferase 1
3r38.1.A	45.32	homo-dimer	BLAST	X-ray	2.23Å	0.42	0.99	UDP-N-acetylglucosamine 1-carboxyvinyltransferase 1
3sg1.1.A	49.15	monomer	BLAST	X-ray	2.60Å	0.43	0.98	UDP-N-acetylglucosamine 1-carboxyvinyltransferase 1
3r38.1.A	45.08	homo-dimer	HHblits	X-ray	2.23Å	0.42	0.99	UDP-N-acetylglucosamine 1-carboxyvinyltransferase 1
4r7u.1.A	46.76	homo-tetramer	HHblits	X-ray	2.45Å	0.42	0.99	UDP-N-acetylglucosamine 1-carboxyvinyltransferase
5bq2.1.A	45.80	homo-tetramer	HHblits	X-ray	1.70Å	0.42	0.99	UDP-N-acetylglucosamine 1-carboxyvinyltransferase
3vcy.1.A	47.36	monomer	HHblits	X-ray	1.93Å	0.42	0.98	UDP-N-acetylglucosamine 1-carboxyvinyltransferase
5bq2.1.A	46.02	homo-tetramer	BLAST	X-ray	1.70Å	0.42	0.98	UDP-N-acetylglucosamine 1-carboxyvinyltransferase
3vcy.1.A	48.79	monomer	BLAST	X-ray	1.93Å	0.42	0.97	UDP-N-acetylglucosamine 1-carboxyvinyltransferase
2rl2.1.A	44.39	homo-dimer	HHblits	X-ray	2.30Å	0.41	0.99	UDP-N-acetylglucosamine 1-carboxyvinyltransferase
5wi5.1.A	44.34	monomer	BLAST	X-ray	2.00Å	0.42	0.98	UDP-N-acetylglucosamine 1-carboxyvinyltransferase 1
1uae.1.A	45.43	homo-trimer	HHblits	X-ray	1.80Å	0.41	0.98	UDP-N-ACETYLGLUCOSAMINE ENOLPYRUVYL TRANSFERASE
3kr6.1.A	45.19	monomer	HHblits	X-ray	1.70Å	0.41	0.98	UDP-N-acetylglucosamine 1-carboxyvinyltransferase
3swd.1.A	45.19	monomer	HHblits	X-ray	2.50Å	0.41	0.98	UDP-N-acetylglucosamine 1-carboxyvinyltransferase
2z2c.1.A	45.19	homo-tetramer	HHblits	X-ray	2.05Å	0.41	0.98	UDP-N-acetylglucosamine 1-carboxyvinyltransferase
5wi5.1.A	42.58	monomer	HHblits	X-ray	2.00Å	0.41	0.99	UDP-N-acetylglucosamine 1-carboxyvinyltransferase 1
1naw.1.A	45.19	homo-tetramer	HHblits	X-ray	2.00Å	0.41	0.98	UDP-N-ACETYLGLUCOSAMINE 1-CARBOXYVINYL-TRANSFERASE
1naw.1.B	45.19	homo-tetramer	HHblits	X-ray	2.00Å	0.41	0.98	UDP-N-ACETYLGLUCOSAMINE 1-CARBOXYVINYL-TRANSFERASE
1a2n.1.A	45.30	homo-trimer	HHblits	X-ray	2.80Å	0.41	0.98	UDP-N-ACETYLGLUCOSAMINE ENOLPYRUVYL TRANSFERASE
2rl2.1.A	45.28	homo-dimer	BLAST	X-ray	2.30Å	0.42	0.98	UDP-N-acetylglucosamine 1-carboxyvinyltransferase
3swa.1.A	44.95	monomer	HHblits	X-ray	1.90Å	0.41	0.98	UDP-N-acetylglucosamine 1-carboxyvinyltransferase
1uae.1.A	46.36	homo-trimer	BLAST	X-ray	1.80Å	0.42	0.97	UDP-N-ACETYLGLUCOSAMINE ENOLPYRUVYL TRANSFERASE
1q3g.1.A	44.95	homo-tetramer	HHblits	X-ray	2.65Å	0.41	0.98	UDP-N-acetylglucosamine 1-carboxyvinyltransferase
3swd.1.A	46.12	monomer	BLAST	X-ray	2.50Å	0.42	0.97	UDP-N-acetylglucosamine 1-carboxyvinyltransferase
3kr6.1.A	46.12	monomer	BLAST	X-ray	1.70Å	0.42	0.97	UDP-N-acetylglucosamine 1-carboxyvinyltransferase
2z2c.1.A	46.12	homo-tetramer	BLAST	X-ray	2.05Å	0.42	0.97	UDP-N-acetylglucosamine 1-carboxyvinyltransferase
3spb.1.A	45.30	homo-tetramer	HHblits	X-ray	2.30Å	0.41	0.98	UDP-N-acetylglucosamine 1-carboxyvinyltransferase
1eyn.1.A	45.30	monomer	HHblits	X-ray	1.70Å	0.41	0.98	UDP-N-ACETYLGLUCOSAMINE 1-CARBOXYVINYLTRANSFERASE
1ejc.1.A	45.30	monomer	HHblits	X-ray	1.80Å	0.41	0.98	UDP-N-ACETYLGLUCOSAMINE ENOLPYRUVYLTRANSFERASE
3su9.1.A	45.30	monomer	HHblits	X-ray	2.20Å	0.41	0.98	UDP-N-acetylglucosamine 1-carboxyvinyltransferase
1ybg.1.A	45.30	homo-tetramer	HHblits	X-ray	2.60Å	0.41	0.98	UDP-N-acetylglucosamine 1-carboxyvinyltransferase
3spb.1.B	45.30	homo-tetramer	HHblits	X-ray	2.30Å	0.41	0.98	UDP-N-acetylglucosamine 1-carboxyvinyltransferase
3kqa.1.A	45.30	monomer	HHblits	X-ray	2.25Å	0.41	0.98	UDP-N-acetylglucosamine 1-carboxyvinyltransferase
3kqa.4.A	45.30	monomer	HHblits	X-ray	2.25Å	0.41	0.98	UDP-N-acetylglucosamine 1-carboxyvinyltransferase
3lth.1.A	45.30	monomer	HHblits	X-ray	1.75Å	0.41	0.98	UDP-N-acetylglucosamine 1-carboxyvinyltransferase
1ejd.3.B	45.30	homo-tetramer	HHblits	X-ray	1.55Å	0.41	0.98	UDP-N-ACETYLGLUCOSAMINE ENOLPYRUVYLTRANSFERASE
4e7d.1.A	45.30	monomer	HHblits	X-ray	2.50Å	0.41	0.98	UDP-N-acetylglucosamine 1-carboxyvinyltransferase
4e7d.4.A	45.30	monomer	HHblits	X-ray	2.50Å	0.41	0.98	UDP-N-acetylglucosamine 1-carboxyvinyltransferase
4e7b.3.A	45.30	monomer	HHblits	X-ray	2.00Å	0.41	0.98	UDP-N-acetylglucosamine 1-carboxyvinyltransferase
4e7b.2.A	45.30	monomer	HHblits	X-ray	2.00Å	0.41	0.98	UDP-N-acetylglucosamine 1-carboxyvinyltransferase
4e7d.3.A	45.30	monomer	HHblits	X-ray	2.50Å	0.41	0.98	UDP-N-acetylglucosamine 1-carboxyvinyltransferase
4e7b.4.A	45.30	monomer	HHblits	X-ray	2.00Å	0.41	0.98	UDP-N-acetylglucosamine 1-carboxyvinyltransferase
4r7u.1.A	48.04	homo-tetramer	BLAST	X-ray	2.45Å	0.42	0.96	UDP-N-acetylglucosamine 1-carboxyvinyltransferase
1naw.1.A	46.36	homo-tetramer	BLAST	X-ray	2.00Å	0.42	0.97	UDP-N-ACETYLGLUCOSAMINE 1-CARBOXYVINYL-TRANSFERASE
1naw.1.B	46.36	homo-tetramer	BLAST	X-ray	2.00Å	0.42	0.97	UDP-N-ACETYLGLUCOSAMINE 1-CARBOXYVINYL-TRANSFERASE
4eii.1.A	45.06	monomer	HHblits	X-ray	1.95Å	0.41	0.98	UDP-N-acetylglucosamine 1-carboxyvinyltransferase
3spb.1.A	46.12	homo-tetramer	BLAST	X-ray	2.30Å	0.42	0.97	UDP-N-acetylglucosamine 1-carboxyvinyltransferase
1eyn.1.A	46.12	monomer	BLAST	X-ray	1.70Å	0.42	0.97	UDP-N-ACETYLGLUCOSAMINE 1-CARBOXYVINYLTRANSFERASE
1ejc.1.A	46.12	monomer	BLAST	X-ray	1.80Å	0.42	0.97	UDP-N-ACETYLGLUCOSAMINE ENOLPYRUVYLTRANSFERASE
3su9.1.A	46.12	monomer	BLAST	X-ray	2.20Å	0.42	0.97	UDP-N-acetylglucosamine 1-carboxyvinyltransferase
1ybg.1.A	46.12	homo-tetramer	BLAST	X-ray	2.60Å	0.42	0.97	UDP-N-acetylglucosamine 1-carboxyvinyltransferase
3spb.1.B	46.12	homo-tetramer	BLAST	X-ray	2.30Å	0.42	0.97	UDP-N-acetylglucosamine 1-carboxyvinyltransferase
3kqa.1.A	46.12	monomer	BLAST	X-ray	2.25Å	0.42	0.97	UDP-N-acetylglucosamine 1-carboxyvinyltransferase
3kqa.4.A	46.12	monomer	BLAST	X-ray	2.25Å	0.42	0.97	UDP-N-acetylglucosamine 1-carboxyvinyltransferase
3lth.1.A	46.12	monomer	BLAST	X-ray	1.75Å	0.42	0.97	UDP-N-acetylglucosamine 1-carboxyvinyltransferase
1ejd.3.B	46.12	homo-tetramer	BLAST	X-ray	1.55Å	0.42	0.97	UDP-N-ACETYLGLUCOSAMINE ENOLPYRUVYLTRANSFERASE
4e7d.1.A	46.12	monomer	BLAST	X-ray	2.50Å	0.42	0.97	UDP-N-acetylglucosamine 1-carboxyvinyltransferase
4e7d.4.A	46.12	monomer	BLAST	X-ray	2.50Å	0.42	0.97	UDP-N-acetylglucosamine 1-carboxyvinyltransferase
4e7b.3.A	46.12	monomer	BLAST	X-ray	2.00Å	0.42	0.97	UDP-N-acetylglucosamine 1-carboxyvinyltransferase
4e7b.2.A	46.12	monomer	BLAST	X-ray	2.00Å	0.42	0.97	UDP-N-acetylglucosamine 1-carboxyvinyltransferase
4e7d.3.A	46.12	monomer	BLAST	X-ray	2.50Å	0.42	0.97	UDP-N-acetylglucosamine 1-carboxyvinyltransferase
4e7b.4.A	46.12	monomer	BLAST	X-ray	2.00Å	0.42	0.97	UDP-N-acetylglucosamine 1-carboxyvinyltransferase
1a2n.1.A	46.12	homo-trimer	BLAST	X-ray	2.80Å	0.42	0.97	UDP-N-ACETYLGLUCOSAMINE ENOLPYRUVYL TRANSFERASE
4eii.1.A	45.87	monomer	BLAST	X-ray	1.95Å	0.42	0.97	UDP-N-acetylglucosamine 1-carboxyvinyltransferase
3swa.1.A	45.87	monomer	BLAST	X-ray	1.90Å	0.42	0.97	UDP-N-acetylglucosamine 1-carboxyvinyltransferase
1ryw.1.A	45.06	homo-tetramer	HHblits	X-ray	2.30Å	0.41	0.98	UDP-N-acetylglucosamine 1-carboxyvinyltransferase
1dlg.3.C	45.06	homo-tetramer	HHblits	X-ray	1.90Å	0.41	0.98	UDP-N-ACETYLGLUCOSAMINE ENOLPYRUVYL TRANSFERASE MURA
1dlg.3.B	45.06	homo-tetramer	HHblits	X-ray	1.90Å	0.41	0.98	UDP-N-ACETYLGLUCOSAMINE ENOLPYRUVYL TRANSFERASE MURA
1q3g.1.A	45.87	homo-tetramer	BLAST	X-ray	2.65Å	0.42	0.97	UDP-N-acetylglucosamine 1-carboxyvinyltransferase
3v4t.1.A	45.06	homo-tetramer	HHblits	X-ray	2.50Å	0.41	0.98	UDP-N-acetylglucosamine 1-carboxyvinyltransferase
3v5v.1.A	45.06	homo-tetramer	HHblits	X-ray	2.70Å	0.41	0.98	UDP-N-acetylglucosamine 1-carboxyvinyltransferase
3v5v.1.D	45.06	homo-tetramer	HHblits	X-ray	2.70Å	0.41	0.98	UDP-N-acetylglucosamine 1-carboxyvinyltransferase
4e7f.1.A	45.06	monomer	HHblits	X-ray	2.15Å	0.41	0.98	UDP-N-acetylglucosamine 1-carboxyvinyltransferase
4e7f.2.A	45.06	monomer	HHblits	X-ray	2.15Å	0.41	0.98	UDP-N-acetylglucosamine 1-carboxyvinyltransferase
4e7e.2.A	45.06	monomer	HHblits	X-ray	2.30Å	0.41	0.98	UDP-N-acetylglucosamine 1-carboxyvinyltransferase
1ryw.1.A	45.87	homo-tetramer	BLAST	X-ray	2.30Å	0.41	0.97	UDP-N-acetylglucosamine 1-carboxyvinyltransferase
1dlg.3.C	45.87	homo-tetramer	BLAST	X-ray	1.90Å	0.41	0.97	UDP-N-ACETYLGLUCOSAMINE ENOLPYRUVYL TRANSFERASE MURA
1dlg.3.B	45.87	homo-tetramer	BLAST	X-ray	1.90Å	0.41	0.97	UDP-N-ACETYLGLUCOSAMINE ENOLPYRUVYL TRANSFERASE MURA
3v4t.1.A	45.87	homo-tetramer	BLAST	X-ray	2.50Å	0.41	0.97	UDP-N-acetylglucosamine 1-carboxyvinyltransferase
3v5v.1.A	45.87	homo-tetramer	BLAST	X-ray	2.70Å	0.41	0.97	UDP-N-acetylglucosamine 1-carboxyvinyltransferase
3v5v.1.D	45.87	homo-tetramer	BLAST	X-ray	2.70Å	0.41	0.97	UDP-N-acetylglucosamine 1-carboxyvinyltransferase
4e7f.1.A	45.87	monomer	BLAST	X-ray	2.15Å	0.41	0.97	UDP-N-acetylglucosamine 1-carboxyvinyltransferase
4e7f.2.A	45.87	monomer	BLAST	X-ray	2.15Å	0.41	0.97	UDP-N-acetylglucosamine 1-carboxyvinyltransferase
4e7e.2.A	45.87	monomer	BLAST	X-ray	2.30Å	0.41	0.97	UDP-N-acetylglucosamine 1-carboxyvinyltransferase
5u4h.1.A	43.03	homo-dimer	HHblits	X-ray	1.05Å	0.41	0.98	UDP-N-acetylglucosamine 1-carboxyvinyltransferase
5u4h.1.A	43.48	homo-dimer	BLAST	X-ray	1.05Å	0.41	0.98	UDP-N-acetylglucosamine 1-carboxyvinyltransferase
4e7g.1.A	44.34	monomer	HHblits	X-ray	1.60Å	0.41	0.98	UDP-N-acetylglucosamine 1-carboxyvinyltransferase
4e7g.1.A	45.15	monomer	BLAST	X-ray	1.60Å	0.41	0.97	UDP-N-acetylglucosamine 1-carboxyvinyltransferase
5ujs.1.A	40.38	homo-dimer	BLAST	X-ray	2.46Å	0.40	0.98	UDP-N-acetylglucosamine 1-carboxyvinyltransferase
5ujs.1.B	40.38	homo-dimer	BLAST	X-ray	2.46Å	0.40	0.98	UDP-N-acetylglucosamine 1-carboxyvinyltransferase
5ujs.1.A	40.00	homo-dimer	HHblits	X-ray	2.46Å	0.40	0.98	UDP-N-acetylglucosamine 1-carboxyvinyltransferase
5ujs.1.B	40.00	homo-dimer	HHblits	X-ray	2.46Å	0.40	0.98	UDP-N-acetylglucosamine 1-carboxyvinyltransferase
2yvw.1.A	41.75	monomer	BLAST	X-ray	1.81Å	0.40	0.97	UDP-N-acetylglucosamine 1-carboxyvinyltransferase
2yvw.1.A	40.96	monomer	HHblits	X-ray	1.81Å	0.39	0.98	UDP-N-acetylglucosamine 1-carboxyvinyltransferase
4fqd.1.A	27.58	homo-dimer	HHblits	X-ray	2.50Å	0.33	0.99	NikO protein
4fqd.1.A	31.42	homo-dimer	BLAST	X-ray	2.50Å	0.36	0.95	NikO protein
4n3p.2.A	22.60	monomer	HHblits	X-ray	2.50Å	0.31	0.96	Serine Hydrolase OSH18
4n3p.1.A	22.60	monomer	HHblits	X-ray	2.50Å	0.31	0.96	Serine Hydrolase OSH18
5buf.1.A	20.29	monomer	HHblits	X-ray	2.37Å	0.30	0.97	3-phosphoshikimate 1-carboxyvinyltransferase
5buf.2.A	20.29	monomer	HHblits	X-ray	2.37Å	0.30	0.97	3-phosphoshikimate 1-carboxyvinyltransferase
4egr.1.A	20.92	monomer	HHblits	X-ray	2.50Å	0.30	0.97	3-phosphoshikimate 1-carboxyvinyltransferase
3roi.1.A	20.92	monomer	HHblits	X-ray	2.20Å	0.30	0.97	3-phosphoshikimate 1-carboxyvinyltransferase
3roi.2.A	20.92	monomer	HHblits	X-ray	2.20Å	0.30	0.97	3-phosphoshikimate 1-carboxyvinyltransferase
3tr1.1.A	20.92	monomer	HHblits	X-ray	2.00Å	0.30	0.97	3-phosphoshikimate 1-carboxyvinyltransferase
4gfp.1.A	20.68	monomer	HHblits	X-ray	2.70Å	0.30	0.97	3-phosphoshikimate 1-carboxyvinyltransferase
3rmt.1.B	21.18	homo-tetramer	HHblits	X-ray	2.80Å	0.31	0.96	3-phosphoshikimate 1-carboxyvinyltransferase 1
3rmt.1.A	21.18	homo-tetramer	HHblits	X-ray	2.80Å	0.31	0.96	3-phosphoshikimate 1-carboxyvinyltransferase 1
3rmt.1.D	21.18	homo-tetramer	HHblits	X-ray	2.80Å	0.31	0.96	3-phosphoshikimate 1-carboxyvinyltransferase 1
5bs5.1.A	19.80	monomer	HHblits	X-ray	2.49Å	0.30	0.97	3-phosphoshikimate 1-carboxyvinyltransferase
5bs5.2.A	19.80	monomer	HHblits	X-ray	2.49Å	0.30	0.97	3-phosphoshikimate 1-carboxyvinyltransferase
2qfs.1.A	21.59	monomer	HHblits	X-ray	1.55Å	0.31	0.95	3-phosphoshikimate 1-carboxyvinyltransferase
4n3p.2.A	25.19	monomer	BLAST	X-ray	2.50Å	0.33	0.93	Serine Hydrolase OSH18
4n3p.1.A	25.19	monomer	BLAST	X-ray	2.50Å	0.33	0.93	Serine Hydrolase OSH18
3fk1.1.A	21.59	monomer	HHblits	X-ray	1.70Å	0.31	0.95	3-phosphoshikimate 1-carboxyvinyltransferase
2gg6.1.A	19.56	monomer	HHblits	X-ray	1.64Å	0.30	0.97	3-phosphoshikimate 1-carboxyvinyltransferase
2gg4.1.A	19.56	monomer	HHblits	X-ray	2.10Å	0.30	0.97	3-phosphoshikimate 1-carboxyvinyltransferase
2qfu.1.A	21.59	monomer	HHblits	X-ray	1.60Å	0.31	0.95	3-phosphoshikimate 1-carboxyvinyltransferase
1mi4.1.A	21.59	monomer	HHblits	X-ray	1.70Å	0.31	0.95	5-enolpyruvylshikimate-3-phosphate synthase
2aay.1.A	21.59	monomer	HHblits	X-ray	1.55Å	0.31	0.95	3-phosphoshikimate 1-carboxyvinyltransferase
3fjz.1.A	21.59	monomer	HHblits	X-ray	1.70Å	0.31	0.95	3-phosphoshikimate 1-carboxyvinyltransferase
1q36.1.A	21.34	monomer	HHblits	X-ray	1.60Å	0.31	0.95	3-phosphoshikimate 1-carboxyvinyltransferase
1rf4.1.A	24.94	monomer	BLAST	X-ray	2.20Å	0.33	0.93	5-enolpyruvylshikimate-3-phosphate synthase
1rf5.2.A	24.94	monomer	BLAST	X-ray	2.30Å	0.33	0.93	5-enolpyruvylshikimate-3-phosphate synthase
1rf5.3.A	24.94	monomer	BLAST	X-ray	2.30Å	0.33	0.93	5-enolpyruvylshikimate-3-phosphate synthase
1rf5.4.A	24.94	monomer	BLAST	X-ray	2.30Å	0.33	0.93	5-enolpyruvylshikimate-3-phosphate synthase
1rf5.1.A	24.94	monomer	BLAST	X-ray	2.30Å	0.33	0.93	5-enolpyruvylshikimate-3-phosphate synthase
2ggd.1.A	19.61	monomer	HHblits	X-ray	1.70Å	0.30	0.96	3-phosphoshikimate 1-carboxyvinyltransferase
1rf4.1.A	21.64	monomer	HHblits	X-ray	2.20Å	0.31	0.95	5-enolpyruvylshikimate-3-phosphate synthase
1rf5.2.A	21.64	monomer	HHblits	X-ray	2.30Å	0.31	0.95	5-enolpyruvylshikimate-3-phosphate synthase
1rf5.3.A	21.64	monomer	HHblits	X-ray	2.30Å	0.31	0.95	5-enolpyruvylshikimate-3-phosphate synthase
1rf5.4.A	21.64	monomer	HHblits	X-ray	2.30Å	0.31	0.95	5-enolpyruvylshikimate-3-phosphate synthase
1rf5.1.A	21.64	monomer	HHblits	X-ray	2.30Å	0.31	0.95	5-enolpyruvylshikimate-3-phosphate synthase
3nvs.1.A	20.65	monomer	HHblits	X-ray	1.02Å	0.31	0.95	3-phosphoshikimate 1-carboxyvinyltransferase
2pqd.1.A	19.75	monomer	HHblits	X-ray	1.77Å	0.30	0.96	3-phosphoshikimate 1-carboxyvinyltransferase
2pqb.1.A	19.51	monomer	HHblits	X-ray	1.80Å	0.30	0.96	3-phosphoshikimate 1-carboxyvinyltransferase
5xwb.1.A	18.86	monomer	HHblits	X-ray	2.20Å	0.30	0.95	3-phosphoshikimate 1-carboxyvinyltransferase
5xwb.2.A	18.86	monomer	HHblits	X-ray	2.20Å	0.30	0.95	3-phosphoshikimate 1-carboxyvinyltransferase
2bjb.1.A	17.04	monomer	HHblits	X-ray	1.80Å	0.29	0.94	3-PHOSPHOSHIKIMATE 1-CARBOXYVINYLTRANSFERASE
2o0x.1.A	17.09	monomer	HHblits	X-ray	1.96Å	0.29	0.94	3-phosphoshikimate 1-carboxyvinyltransferase
2o15.1.A	17.09	monomer	HHblits	X-ray	1.95Å	0.29	0.94	3-PHOSPHOSHIKIMATE 1-CARBOXYVINYLTRANSFERASE
3nvs.1.A	19.28	monomer	HHblits	X-ray	1.02Å	0.29	0.78	3-phosphoshikimate 1-carboxyvinyltransferase
4gfp.1.A	19.39	monomer	HHblits	X-ray	2.70Å	0.29	0.78	3-phosphoshikimate 1-carboxyvinyltransferase
3fjz.1.A	18.43	monomer	HHblits	X-ray	1.70Å	0.29	0.78	3-phosphoshikimate 1-carboxyvinyltransferase
2qfs.1.A	18.48	monomer	HHblits	X-ray	1.55Å	0.29	0.78	3-phosphoshikimate 1-carboxyvinyltransferase
3fk1.1.A	18.48	monomer	HHblits	X-ray	1.70Å	0.29	0.78	3-phosphoshikimate 1-carboxyvinyltransferase
2ggd.1.A	18.48	monomer	HHblits	X-ray	1.70Å	0.28	0.78	3-phosphoshikimate 1-carboxyvinyltransferase
5bs5.1.A	20.50	monomer	HHblits	X-ray	2.49Å	0.30	0.76	3-phosphoshikimate 1-carboxyvinyltransferase
5bs5.2.A	20.50	monomer	HHblits	X-ray	2.49Å	0.30	0.76	3-phosphoshikimate 1-carboxyvinyltransferase
2gg6.1.A	18.24	monomer	HHblits	X-ray	1.64Å	0.28	0.78	3-phosphoshikimate 1-carboxyvinyltransferase
2gg4.1.A	18.24	monomer	HHblits	X-ray	2.10Å	0.28	0.78	3-phosphoshikimate 1-carboxyvinyltransferase
5xwb.1.A	17.96	monomer	HHblits	X-ray	2.20Å	0.29	0.76	3-phosphoshikimate 1-carboxyvinyltransferase
5xwb.2.A	17.96	monomer	HHblits	X-ray	2.20Å	0.29	0.76	3-phosphoshikimate 1-carboxyvinyltransferase
3r38.1.A	18.96	homo-dimer	HHblits	X-ray	2.23Å	0.28	0.77	UDP-N-acetylglucosamine 1-carboxyvinyltransferase 1
5buf.1.A	20.25	monomer	HHblits	X-ray	2.37Å	0.30	0.76	3-phosphoshikimate 1-carboxyvinyltransferase
5buf.2.A	20.25	monomer	HHblits	X-ray	2.37Å	0.30	0.76	3-phosphoshikimate 1-carboxyvinyltransferase
2o0x.1.A	19.57	monomer	HHblits	X-ray	1.96Å	0.29	0.76	3-phosphoshikimate 1-carboxyvinyltransferase
2o15.1.A	19.57	monomer	HHblits	X-ray	1.95Å	0.29	0.76	3-PHOSPHOSHIKIMATE 1-CARBOXYVINYLTRANSFERASE
2bjb.1.A	19.25	monomer	HHblits	X-ray	1.80Å	0.29	0.76	3-PHOSPHOSHIKIMATE 1-CARBOXYVINYLTRANSFERASE
2qfu.1.A	18.32	monomer	HHblits	X-ray	1.60Å	0.29	0.76	3-phosphoshikimate 1-carboxyvinyltransferase
2aay.1.A	18.32	monomer	HHblits	X-ray	1.55Å	0.29	0.76	3-phosphoshikimate 1-carboxyvinyltransferase
3tr1.1.A	19.38	monomer	HHblits	X-ray	2.00Å	0.29	0.76	3-phosphoshikimate 1-carboxyvinyltransferase
4egr.1.A	19.38	monomer	HHblits	X-ray	2.50Å	0.29	0.76	3-phosphoshikimate 1-carboxyvinyltransferase
3roi.1.A	19.38	monomer	HHblits	X-ray	2.20Å	0.29	0.76	3-phosphoshikimate 1-carboxyvinyltransferase
3roi.2.A	19.38	monomer	HHblits	X-ray	2.20Å	0.29	0.76	3-phosphoshikimate 1-carboxyvinyltransferase
1mi4.1.A	18.07	monomer	HHblits	X-ray	1.70Å	0.29	0.76	5-enolpyruvylshikimate-3-phosphate synthase
1q36.1.A	18.44	monomer	HHblits	X-ray	1.60Å	0.29	0.76	3-phosphoshikimate 1-carboxyvinyltransferase
3rmt.1.B	20.57	homo-tetramer	HHblits	X-ray	2.80Å	0.30	0.75	3-phosphoshikimate 1-carboxyvinyltransferase 1
3rmt.1.A	20.57	homo-tetramer	HHblits	X-ray	2.80Å	0.30	0.75	3-phosphoshikimate 1-carboxyvinyltransferase 1
3rmt.1.D	20.57	homo-tetramer	HHblits	X-ray	2.80Å	0.30	0.75	3-phosphoshikimate 1-carboxyvinyltransferase 1
3sg1.1.A	17.55	monomer	HHblits	X-ray	2.60Å	0.29	0.75	UDP-N-acetylglucosamine 1-carboxyvinyltransferase 1
5ujs.1.A	18.07	homo-dimer	HHblits	X-ray	2.46Å	0.28	0.76	UDP-N-acetylglucosamine 1-carboxyvinyltransferase
5ujs.1.B	18.07	homo-dimer	HHblits	X-ray	2.46Å	0.28	0.76	UDP-N-acetylglucosamine 1-carboxyvinyltransferase
2pqd.1.A	18.75	monomer	HHblits	X-ray	1.77Å	0.28	0.76	3-phosphoshikimate 1-carboxyvinyltransferase
2pqb.1.A	18.75	monomer	HHblits	X-ray	1.80Å	0.28	0.76	3-phosphoshikimate 1-carboxyvinyltransferase
4fqd.1.A	14.46	homo-dimer	HHblits	X-ray	2.50Å	0.26	0.77	NikO protein
2yvw.1.A	14.91	monomer	HHblits	X-ray	1.81Å	0.27	0.76	UDP-N-acetylglucosamine 1-carboxyvinyltransferase
5bq2.1.A	16.72	homo-tetramer	HHblits	X-ray	1.70Å	0.27	0.74	UDP-N-acetylglucosamine 1-carboxyvinyltransferase
5u4h.1.A	14.34	homo-dimer	HHblits	X-ray	1.05Å	0.29	0.63	UDP-N-acetylglucosamine 1-carboxyvinyltransferase
4r7u.1.A	16.35	homo-tetramer	HHblits	X-ray	2.45Å	0.30	0.62	UDP-N-acetylglucosamine 1-carboxyvinyltransferase
2z2c.1.A	19.16	homo-tetramer	HHblits	X-ray	2.05Å	0.30	0.62	UDP-N-acetylglucosamine 1-carboxyvinyltransferase
4n3p.2.A	21.40	monomer	HHblits	X-ray	2.50Å	0.31	0.61	Serine Hydrolase OSH18
4n3p.1.A	21.40	monomer	HHblits	X-ray	2.50Å	0.31	0.61	Serine Hydrolase OSH18
1rf4.1.A	21.79	monomer	HHblits	X-ray	2.20Å	0.31	0.61	5-enolpyruvylshikimate-3-phosphate synthase
1rf5.2.A	21.79	monomer	HHblits	X-ray	2.30Å	0.31	0.61	5-enolpyruvylshikimate-3-phosphate synthase
1rf5.3.A	21.79	monomer	HHblits	X-ray	2.30Å	0.31	0.61	5-enolpyruvylshikimate-3-phosphate synthase
1rf5.4.A	21.79	monomer	HHblits	X-ray	2.30Å	0.31	0.61	5-enolpyruvylshikimate-3-phosphate synthase
1rf5.1.A	21.79	monomer	HHblits	X-ray	2.30Å	0.31	0.61	5-enolpyruvylshikimate-3-phosphate synthase
1uae.1.A	18.85	homo-trimer	HHblits	X-ray	1.80Å	0.30	0.61	UDP-N-ACETYLGLUCOSAMINE ENOLPYRUVYL TRANSFERASE
1a2n.1.A	19.23	homo-trimer	HHblits	X-ray	2.80Å	0.30	0.61	UDP-N-ACETYLGLUCOSAMINE ENOLPYRUVYL TRANSFERASE
5wi5.1.A	17.94	monomer	HHblits	X-ray	2.00Å	0.29	0.62	UDP-N-acetylglucosamine 1-carboxyvinyltransferase 1
3zh3.1.A	16.73	monomer	HHblits	X-ray	2.90Å	0.28	0.62	UDP-N-ACETYLGLUCOSAMINE 1-CARBOXYVINYLTRANSFERASE
3zh4.1.A	16.41	monomer	HHblits	X-ray	1.80Å	0.28	0.62	UDP-N-ACETYLGLUCOSAMINE 1-CARBOXYVINYLTRANSFERASE
3kr6.1.A	19.22	monomer	HHblits	X-ray	1.70Å	0.30	0.60	UDP-N-acetylglucosamine 1-carboxyvinyltransferase
1naw.1.A	20.00	homo-tetramer	HHblits	X-ray	2.00Å	0.30	0.60	UDP-N-ACETYLGLUCOSAMINE 1-CARBOXYVINYL-TRANSFERASE
1naw.1.B	20.00	homo-tetramer	HHblits	X-ray	2.00Å	0.30	0.60	UDP-N-ACETYLGLUCOSAMINE 1-CARBOXYVINYL-TRANSFERASE
3spb.1.A	19.61	homo-tetramer	HHblits	X-ray	2.30Å	0.30	0.60	UDP-N-acetylglucosamine 1-carboxyvinyltransferase
1eyn.1.A	19.61	monomer	HHblits	X-ray	1.70Å	0.30	0.60	UDP-N-ACETYLGLUCOSAMINE 1-CARBOXYVINYLTRANSFERASE
1ejc.1.A	19.61	monomer	HHblits	X-ray	1.80Å	0.30	0.60	UDP-N-ACETYLGLUCOSAMINE ENOLPYRUVYLTRANSFERASE
3su9.1.A	19.61	monomer	HHblits	X-ray	2.20Å	0.30	0.60	UDP-N-acetylglucosamine 1-carboxyvinyltransferase
1ybg.1.A	19.61	homo-tetramer	HHblits	X-ray	2.60Å	0.30	0.60	UDP-N-acetylglucosamine 1-carboxyvinyltransferase
3spb.1.B	19.61	homo-tetramer	HHblits	X-ray	2.30Å	0.30	0.60	UDP-N-acetylglucosamine 1-carboxyvinyltransferase
3kqa.1.A	19.61	monomer	HHblits	X-ray	2.25Å	0.30	0.60	UDP-N-acetylglucosamine 1-carboxyvinyltransferase
3kqa.4.A	19.61	monomer	HHblits	X-ray	2.25Å	0.30	0.60	UDP-N-acetylglucosamine 1-carboxyvinyltransferase
3lth.1.A	19.61	monomer	HHblits	X-ray	1.75Å	0.30	0.60	UDP-N-acetylglucosamine 1-carboxyvinyltransferase
1ejd.3.B	19.61	homo-tetramer	HHblits	X-ray	1.55Å	0.30	0.60	UDP-N-ACETYLGLUCOSAMINE ENOLPYRUVYLTRANSFERASE
4e7d.1.A	19.61	monomer	HHblits	X-ray	2.50Å	0.30	0.60	UDP-N-acetylglucosamine 1-carboxyvinyltransferase
4e7d.4.A	19.61	monomer	HHblits	X-ray	2.50Å	0.30	0.60	UDP-N-acetylglucosamine 1-carboxyvinyltransferase
4e7b.3.A	19.61	monomer	HHblits	X-ray	2.00Å	0.30	0.60	UDP-N-acetylglucosamine 1-carboxyvinyltransferase
4e7b.2.A	19.61	monomer	HHblits	X-ray	2.00Å	0.30	0.60	UDP-N-acetylglucosamine 1-carboxyvinyltransferase
4e7d.3.A	19.61	monomer	HHblits	X-ray	2.50Å	0.30	0.60	UDP-N-acetylglucosamine 1-carboxyvinyltransferase
4e7b.4.A	19.61	monomer	HHblits	X-ray	2.00Å	0.30	0.60	UDP-N-acetylglucosamine 1-carboxyvinyltransferase
4eii.1.A	19.61	monomer	HHblits	X-ray	1.95Å	0.30	0.60	UDP-N-acetylglucosamine 1-carboxyvinyltransferase
1ryw.1.A	19.61	homo-tetramer	HHblits	X-ray	2.30Å	0.30	0.60	UDP-N-acetylglucosamine 1-carboxyvinyltransferase
1dlg.3.C	19.61	homo-tetramer	HHblits	X-ray	1.90Å	0.30	0.60	UDP-N-ACETYLGLUCOSAMINE ENOLPYRUVYL TRANSFERASE MURA
1dlg.3.B	19.61	homo-tetramer	HHblits	X-ray	1.90Å	0.30	0.60	UDP-N-ACETYLGLUCOSAMINE ENOLPYRUVYL TRANSFERASE MURA
4e7g.1.A	19.61	monomer	HHblits	X-ray	1.60Å	0.30	0.60	UDP-N-acetylglucosamine 1-carboxyvinyltransferase
3swa.1.A	19.61	monomer	HHblits	X-ray	1.90Å	0.30	0.60	UDP-N-acetylglucosamine 1-carboxyvinyltransferase
3swd.1.A	19.29	monomer	HHblits	X-ray	2.50Å	0.30	0.60	UDP-N-acetylglucosamine 1-carboxyvinyltransferase
3v4t.1.A	19.29	homo-tetramer	HHblits	X-ray	2.50Å	0.30	0.60	UDP-N-acetylglucosamine 1-carboxyvinyltransferase
3v5v.1.A	19.29	homo-tetramer	HHblits	X-ray	2.70Å	0.30	0.60	UDP-N-acetylglucosamine 1-carboxyvinyltransferase
3v5v.1.D	19.29	homo-tetramer	HHblits	X-ray	2.70Å	0.30	0.60	UDP-N-acetylglucosamine 1-carboxyvinyltransferase
4e7f.1.A	19.29	monomer	HHblits	X-ray	2.15Å	0.30	0.60	UDP-N-acetylglucosamine 1-carboxyvinyltransferase
4e7f.2.A	19.29	monomer	HHblits	X-ray	2.15Å	0.30	0.60	UDP-N-acetylglucosamine 1-carboxyvinyltransferase
4e7e.2.A	19.29	monomer	HHblits	X-ray	2.30Å	0.30	0.60	UDP-N-acetylglucosamine 1-carboxyvinyltransferase
1q3g.1.A	19.29	homo-tetramer	HHblits	X-ray	2.65Å	0.30	0.60	UDP-N-acetylglucosamine 1-carboxyvinyltransferase
2rl2.1.A	17.65	homo-dimer	HHblits	X-ray	2.30Å	0.30	0.60	UDP-N-acetylglucosamine 1-carboxyvinyltransferase
3vcy.1.A	16.86	monomer	HHblits	X-ray	1.93Å	0.30	0.60	UDP-N-acetylglucosamine 1-carboxyvinyltransferase
3ti2.1.A	18.06	monomer	HHblits	X-ray	1.90Å	0.29	0.51	3-phosphoshikimate 1-carboxyvinyltransferase
1p88.1.A	19.12	monomer	HHblits	NMR	NA	0.29	0.48	3-phosphoshikimate 1-carboxyvinyltransferase
1p89.1.A	19.12	monomer	HHblits	NMR	NA	0.29	0.48	3-phosphoshikimate 1-carboxyvinyltransferase
3ti2.1.A	14.29	monomer	HHblits	X-ray	1.90Å	0.28	0.48	3-phosphoshikimate 1-carboxyvinyltransferase
1p88.1.A	16.84	monomer	HHblits	NMR	NA	0.29	0.46	3-phosphoshikimate 1-carboxyvinyltransferase
1p89.1.A	16.84	monomer	HHblits	NMR	NA	0.29	0.46	3-phosphoshikimate 1-carboxyvinyltransferase
1rf4.1.A	31.93	monomer	BLAST	X-ray	2.20Å	0.36	0.28	5-enolpyruvylshikimate-3-phosphate synthase
1rf5.2.A	31.93	monomer	BLAST	X-ray	2.30Å	0.36	0.28	5-enolpyruvylshikimate-3-phosphate synthase
1rf5.3.A	31.93	monomer	BLAST	X-ray	2.30Å	0.36	0.28	5-enolpyruvylshikimate-3-phosphate synthase
1rf5.4.A	31.93	monomer	BLAST	X-ray	2.30Å	0.36	0.28	5-enolpyruvylshikimate-3-phosphate synthase
1rf5.1.A	31.93	monomer	BLAST	X-ray	2.30Å	0.36	0.28	5-enolpyruvylshikimate-3-phosphate synthase
4n3p.2.A	31.93	monomer	BLAST	X-ray	2.50Å	0.36	0.28	Serine Hydrolase OSH18
4n3p.1.A	31.93	monomer	BLAST	X-ray	2.50Å	0.36	0.28	Serine Hydrolase OSH18
5th5.1.A	13.51	homo-dimer	HHblits	X-ray	2.41Å	0.27	0.09	7-carboxy-7-deazaguanine synthase
5tgs.1.A	13.51	homo-dimer	HHblits	X-ray	2.55Å	0.27	0.09	7-carboxy-7-deazaguanine synthase