SWISS-MODEL | Workspace | Model Results

SWISS-MODEL Homology Modelling Report

Model Building Report

This document lists the results for the homology modelling project "R2P7C4" submitted to SWISS-MODEL workspace on Oct. 26, 2017, 8:43 p.m..The submitted primary amino acid sequence is given in Table T1.

If you use any results in your research, please cite the relevant publications:

Marco Biasini; Stefan Bienert; Andrew Waterhouse; Konstantin Arnold; Gabriel Studer; Tobias Schmidt; Florian Kiefer; Tiziano Gallo Cassarino; Martino Bertoni; Lorenza Bordoli; Torsten Schwede. (2014). SWISS-MODEL: modelling protein tertiary and quaternary structure using evolutionary information. Nucleic Acids Research (1 July 2014) 42 (W1): W252-W258; doi: 10.1093/nar/gku340.
Arnold, K., Bordoli, L., Kopp, J. and Schwede, T. (2006) The SWISS-MODEL workspace: a web-based environment for protein structure homology modelling. Bioinformatics, 22, 195-201.
Benkert, P., Biasini, M. and Schwede, T. (2011) Toward the estimation of the absolute quality of individual protein structure models. Bioinformatics, 27, 343-350

Results

The SWISS-MODEL template library (SMTL version 2017-10-23, PDB release 2017-10-13) was searched with Blast (Altschul et al., 1997) and HHBlits (Remmert, et al., 2011) for evolutionary related structures matching the target sequence in Table T1. For details on the template search, see Materials and Methods. Overall 1127 templates were found (Table T2).

Models

The following model was built (see Materials and Methods "Model Building"):

Model #01	File	Built with	Oligo-State	Ligands	GMQE	QMEAN
	PDB	ProMod3 Version 1.1.0.	MONOMER (matching prediction)	None	0.67	-3.05

QMEAN	-3.05
Cβ	-1.07
All Atom	-1.61
Solvation	-0.67
Torsion	-2.75

Template	Seq Identity	Oligo-state	Found by	Method	Resolution	Seq Similarity	Range	Coverage	Description
1nlm.1.B	33.14	homo-dimer	BLAST	X-ray	2.50Å	0.38		0.93	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase

Ligand	Added to Model	Description
GOL	✕ - Not biologically relevant.	GLYCEROL
GOL	✕ - Not biologically relevant.	GLYCEROL
GOL	✕ - Not biologically relevant.	GLYCEROL
GOL	✕ - Not biologically relevant.	GLYCEROL
UD1	✕ - Binding site not conserved.	URIDINE-DIPHOSPHATE-N-ACETYLGLUCOSAMINE
UD1	✕ - Binding site not conserved.	URIDINE-DIPHOSPHATE-N-ACETYLGLUCOSAMINE

Target    MKILVTGGGTGGHIYPALAFVNYVKTQEPNAEFMYVGAKRGLENKIVPDTGMPFHTLEIQGFKRK-ISMHNIKTIRLFLK
1nlm.1.B  -RLMVMAGGTGGHVFPGLAVAHHLMAQ--GWQVRWLGTADRMEADLVPKHGIEIDFIRISGLRGKGIKALIAAPLRIF-N

Target    SIRQAKKILSDFQPDIVIGTGGYVSGAVVYAAAKMGIPTIIHEQNSVPGVTNKFLSRYVDRIALSFKDAAPFFPENKSVL
1nlm.1.B  AWRQARAIMKAYKPDVVLGMGGYVSGPGGLAAWSLGIPVVLHEQNGIAGLTNKWLAKIATKVMQAFPGA---FPNAE--V

Target    VGNPRAQEVADTKKSDILKTFGLDPEKK--------TVLIFGGSQGALKINQAVSVFLSEYIPSSYQVLYATGERYYEEI
1nlm.1.B  VGNP--------VRTDVLAL--PLPQQRLAGREGPVRVLVVGGSQGARILNQTMPQVAAK-LGDSVTIWHQSGKGSQQSV

Target    LNKINPEIQ-NISVQPYIKNMAEVMASSDLLVGRAGATSIAEFTALGLPAVLVPSPYVTNDHQTKNAMSLVHAGAAKMIA
1nlm.1.B  EQAYAEAGQPQHKVTEFIDDMAAAYAWADVVVCRSGALTVSEIAAAGLPALFVPFQH-KDRQQYWNALPLEKAGAAKIIE

Target    DNELTGESLSQTINEIMDDEELQKQMCRASKEQGIPDASKRLYDVVNQIIKK
1nlm.1.B  QPQLSVDAVANTLAGWSRETLL--TMAERARAASIPDATERVANEVSRVAR-

Materials and Methods

Template Search

Template search with Blast and HHBlits has been performed against the SWISS-MODEL template library (SMTL, last update: 2017-10-23, last included PDB release: 2017-10-13).

The target sequence was searched with BLAST (Altschul et al., 1997) against the primary amino acid sequence contained in the SMTL. A total of 10 templates were found.

An initial HHblits profile has been built using the procedure outlined in (Remmert, et al., 2011), followed by 1 iteration of HHblits against NR20. The obtained profile has then be searched against all profiles of the SMTL. A total of 1119 templates were found.

Template Selection

For each identified template, the template's quality has been predicted from features of the target-template alignment. The templates with the highest quality have then been selected for model building.

Model Building

Models are built based on the target-template alignment using ProMod3. Coordinates which are conserved between the target and the template are copied from the template to the model. Insertions and deletions are remodelled using a fragment library. Side chains are then rebuilt. Finally, the geometry of the resulting model is regularized by using a force field. In case loop modelling with ProMod3 fails, an alternative model is built with PROMOD-II (Guex, et al., 1997).

Model Quality Estimation

The global and per-residue model quality has been assessed using the QMEAN scoring function (Benkert, et al., 2011) . For improved performance, weights of the individual QMEAN terms have been trained specifically for SWISS-MODEL.

Ligand Modelling

Ligands present in the template structure are transferred by homology to the model when the following criteria are met (Gallo -Casserino, to be published): (a) The ligands are annotated as biologically relevant in the template library, (b) the ligand is in contact with the model, (c) the ligand is not clashing with the protein, (d) the residues in contact with the ligand are conserved between the target and the template. If any of these four criteria is not satisfied, a certain ligand will not be included in the model. The model summary includes information on why and which ligand has not been included.

Oligomeric State Conservation

Homo-oligomeric structure of the target protein is predicted based on the analysis of pairwise interfaces of the identified template structures. For each relevant interface between polypeptide chains (interfaces with more than 10 residue-residue interactions), the QscoreOligomer (Mariani et al., 2011) is predicted from features such as similarity to target and frequency of observing this interface in the identified templates (Kiefer, Bertoni, Biasini, to be published). The prediction is performed with a random forest regressor using these features as input parameters to predict the probability of conservation for each interface. The QscoreOligomer of the whole complex is then calculated as the weight-averaged QscoreOligomer of the interfaces. The oligomeric state of the target is predicted to be the same as in the template when QscoreOligomer is predicted to be higher or equal to 0.5.

References

Altschul, S.F., Madden, T.L., Schaffer, A.A., Zhang, J., Zhang, Z., Miller, W. and Lipman, D.J. (1997) Gapped BLAST and PSI-BLAST: a new generation of protein database search programs. Nucleic Acids Res, 25, 3389-3402.
Remmert, M., Biegert, A., Hauser, A. and Soding, J. (2012) HHblits: lightning-fast iterative protein sequence searching by HMM-HMM alignment. Nat Methods, 9, 173-175.
Guex, N. and Peitsch, M.C. (1997) SWISS-MODEL and the Swiss-PdbViewer: an environment for comparative protein modeling. Electrophoresis, 18, 2714-2723.
Sali, A. and Blundell, T.L. (1993) Comparative protein modelling by satisfaction of spatial restraints. J Mol Biol, 234, 779-815.
Benkert, P., Biasini, M. and Schwede, T. (2011) Toward the estimation of the absolute quality of individual protein structure models. Bioinformatics, 27, 343-350.
Mariani, V., Kiefer, F., Schmidt, T., Haas, J. and Schwede, T. (2011) Assessment of template based protein structure predictions in CASP9. Proteins, 79 Suppl 10, 37-58.

Table T1:

Primary amino acid sequence for which templates were searched and models were built.

MKILVTGGGTGGHIYPALAFVNYVKTQEPNAEFMYVGAKRGLENKIVPDTGMPFHTLEIQGFKRKISMHNIKTIRLFLKSIRQAKKILSDFQPDIVIGTG
GYVSGAVVYAAAKMGIPTIIHEQNSVPGVTNKFLSRYVDRIALSFKDAAPFFPENKSVLVGNPRAQEVADTKKSDILKTFGLDPEKKTVLIFGGSQGALK
INQAVSVFLSEYIPSSYQVLYATGERYYEEILNKINPEIQNISVQPYIKNMAEVMASSDLLVGRAGATSIAEFTALGLPAVLVPSPYVTNDHQTKNAMSL
VHAGAAKMIADNELTGESLSQTINEIMDDEELQKQMCRASKEQGIPDASKRLYDVVNQIIKK

Table T2:

Template	Seq Identity	Oligo-state	Found by	Method	Resolution	Seq Similarity	Coverage	Description
3s2u.1.A	32.38	monomer	BLAST	X-ray	2.23Å	0.37	0.96	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase
3s2u.1.A	31.71	monomer	HHblits	X-ray	2.23Å	0.37	0.97	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase
1f0k.1.A	30.55	homo-dimer	HHblits	X-ray	1.90Å	0.36	0.96	UDP-N-ACETYLGLUCOSAMINE-N-ACETYLMURAMYL-(PENTAPEPTIDE) PYROPHOSPHORYL-UNDECAPRENOL N-ACETYLGLUCOSAMINE TRANSFERASE
1f0k.1.B	30.55	homo-dimer	HHblits	X-ray	1.90Å	0.36	0.96	UDP-N-ACETYLGLUCOSAMINE-N-ACETYLMURAMYL-(PENTAPEPTIDE) PYROPHOSPHORYL-UNDECAPRENOL N-ACETYLGLUCOSAMINE TRANSFERASE
1nlm.1.A	30.55	homo-dimer	HHblits	X-ray	2.50Å	0.36	0.96	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase
1nlm.1.B	30.55	homo-dimer	HHblits	X-ray	2.50Å	0.36	0.96	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase
1f0k.1.A	33.14	homo-dimer	BLAST	X-ray	1.90Å	0.38	0.93	UDP-N-ACETYLGLUCOSAMINE-N-ACETYLMURAMYL-(PENTAPEPTIDE) PYROPHOSPHORYL-UNDECAPRENOL N-ACETYLGLUCOSAMINE TRANSFERASE
1f0k.1.B	33.14	homo-dimer	BLAST	X-ray	1.90Å	0.38	0.93	UDP-N-ACETYLGLUCOSAMINE-N-ACETYLMURAMYL-(PENTAPEPTIDE) PYROPHOSPHORYL-UNDECAPRENOL N-ACETYLGLUCOSAMINE TRANSFERASE
1nlm.1.A	33.14	homo-dimer	BLAST	X-ray	2.50Å	0.38	0.93	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase
1nlm.1.B	33.14	homo-dimer	BLAST	X-ray	2.50Å	0.38	0.93	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase
4wyi.1.A	18.16	monomer	HHblits	X-ray	2.50Å	0.29	0.96	Monogalactosyldiacylglycerol synthase 1, chloroplastic
4x1t.1.A	18.16	monomer	HHblits	X-ray	2.25Å	0.29	0.96	Monogalactosyldiacylglycerol synthase 1, chloroplastic
2acw.1.A	16.62	homo-dimer	HHblits	X-ray	2.60Å	0.28	0.96	triterpene UDP-glucosyl transferase UGT71G1
2acw.1.B	16.62	homo-dimer	HHblits	X-ray	2.60Å	0.28	0.96	triterpene UDP-glucosyl transferase UGT71G1
4m83.1.A	18.08	monomer	HHblits	X-ray	1.70Å	0.29	0.95	Oleandomycin glycosyltransferase
4m83.2.A	18.08	monomer	HHblits	X-ray	1.70Å	0.29	0.95	Oleandomycin glycosyltransferase
4m60.1.A	17.78	monomer	HHblits	X-ray	1.77Å	0.29	0.95	Oleandomycin glycosyltransferase
3wc4.1.A	15.03	monomer	HHblits	X-ray	1.85Å	0.28	0.96	UDP-glucose:anthocyanidin 3-O-glucosyltransferase
3otg.1.A	15.79	monomer	HHblits	X-ray	2.08Å	0.29	0.94	CalG1
3oth.1.A	15.79	monomer	HHblits	X-ray	2.30Å	0.29	0.94	CalG1
2c1x.1.A	15.65	monomer	HHblits	X-ray	1.90Å	0.28	0.95	UDP-GLUCOSE FLAVONOID 3-O GLYCOSYLTRANSFERASE
4fzr.1.A	17.94	homo-dimer	HHblits	X-ray	2.40Å	0.29	0.94	SsfS6
4rie.1.A	14.41	homo-dimer	HHblits	X-ray	2.16Å	0.29	0.94	Glycosyl transferase homolog
4rie.1.B	14.41	homo-dimer	HHblits	X-ray	2.16Å	0.29	0.94	Glycosyl transferase homolog
4rif.1.A	14.41	homo-dimer	HHblits	X-ray	1.85Å	0.29	0.94	Glycosyl transferase homolog
4rif.1.B	14.41	homo-dimer	HHblits	X-ray	1.85Å	0.29	0.94	Glycosyl transferase homolog
4g2t.1.A	17.94	homo-dimer	HHblits	X-ray	2.41Å	0.29	0.94	SsfS6
3beo.1.A	18.05	homo-dimer	HHblits	X-ray	1.70Å	0.30	0.93	UDP-N-acetylglucosamine 2-epimerase
4rii.1.A	14.75	homo-dimer	HHblits	X-ray	2.00Å	0.29	0.94	Glycosyl transferase homolog,Glycosyl transferase
4rih.1.A	14.75	homo-dimer	HHblits	X-ray	2.22Å	0.29	0.94	Glycosyl transferase homolog,Glycosyl transferase
4rig.1.B	14.75	homo-dimer	HHblits	X-ray	1.90Å	0.29	0.94	Glycosyl transferase
4rig.1.A	14.75	homo-dimer	HHblits	X-ray	1.90Å	0.29	0.94	Glycosyl transferase
2iyf.1.A	18.69	monomer	HHblits	X-ray	1.70Å	0.29	0.93	OLEANDOMYCIN GLYCOSYLTRANSFERASE
2iyf.2.A	18.69	monomer	HHblits	X-ray	1.70Å	0.29	0.93	OLEANDOMYCIN GLYCOSYLTRANSFERASE
2iya.1.A	17.21	monomer	HHblits	X-ray	1.70Å	0.29	0.93	OLEANDOMYCIN GLYCOSYLTRANSFERASE
5dld.1.A	19.46	monomer	HHblits	X-ray	1.45Å	0.30	0.92	UDP-N-Acetylglucosamine 2-epimerase
1vgv.1.B	16.37	homo-dimer	HHblits	X-ray	2.31Å	0.29	0.93	UDP-N-acetylglucosamine 2-epimerase
1vgv.1.A	16.37	homo-dimer	HHblits	X-ray	2.31Å	0.29	0.93	UDP-N-acetylglucosamine 2-epimerase
1vgv.2.B	16.37	homo-dimer	HHblits	X-ray	2.31Å	0.29	0.93	UDP-N-acetylglucosamine 2-epimerase
5enz.1.A	18.15	homo-dimer	HHblits	X-ray	1.91Å	0.29	0.93	UDP-GlcNAc 2-epimerase
5enz.1.B	18.15	homo-dimer	HHblits	X-ray	1.91Å	0.29	0.93	UDP-GlcNAc 2-epimerase
3ia7.1.A	16.57	homo-dimer	HHblits	X-ray	1.91Å	0.29	0.93	CalG4
3ia7.1.B	16.57	homo-dimer	HHblits	X-ray	1.91Å	0.29	0.93	CalG4
3wad.1.A	13.99	homo-dimer	HHblits	X-ray	2.00Å	0.27	0.95	Glycosyltransferase
1f6d.1.B	16.72	homo-dimer	HHblits	X-ray	2.50Å	0.29	0.93	UDP-N-ACETYLGLUCOSAMINE 2-EPIMERASE
1f6d.1.A	16.72	homo-dimer	HHblits	X-ray	2.50Å	0.29	0.93	UDP-N-ACETYLGLUCOSAMINE 2-EPIMERASE
4lei.1.A	12.61	homo-dimer	HHblits	X-ray	3.15Å	0.28	0.94	NDP-forosamyltransferase
4lei.1.B	12.61	homo-dimer	HHblits	X-ray	3.15Å	0.28	0.94	NDP-forosamyltransferase
2yjn.1.A	13.78	hetero-oligomer	HHblits	X-ray	3.09Å	0.28	0.94	GLYCOSYLTRANSFERASE
4rbn.1.A	13.66	homo-tetramer	HHblits	X-ray	3.05Å	0.27	0.95	Sucrose synthase:Glycosyl transferases group 1
4rbn.1.B	13.66	homo-tetramer	HHblits	X-ray	3.05Å	0.27	0.95	Sucrose synthase:Glycosyl transferases group 1
4rbn.1.C	13.66	homo-tetramer	HHblits	X-ray	3.05Å	0.27	0.95	Sucrose synthase:Glycosyl transferases group 1
4rbn.1.D	13.66	homo-tetramer	HHblits	X-ray	3.05Å	0.27	0.95	Sucrose synthase:Glycosyl transferases group 1
5xvm.1.A	13.74	monomer	HHblits	X-ray	2.77Å	0.27	0.94	Sterol 3-beta-glucosyltransferase
4amb.1.A	14.84	homo-dimer	HHblits	X-ray	2.62Å	0.28	0.93	SNOGD
4amg.1.A	14.84	homo-dimer	HHblits	X-ray	2.59Å	0.28	0.93	SNOGD
4amg.1.B	14.84	homo-dimer	HHblits	X-ray	2.59Å	0.28	0.93	SNOGD
4an4.1.A	14.84	homo-dimer	HHblits	X-ray	2.70Å	0.28	0.93	GLYCOSYL TRANSFERASE
4an4.1.B	14.84	homo-dimer	HHblits	X-ray	2.70Å	0.28	0.93	GLYCOSYL TRANSFERASE
4an4.2.A	14.84	homo-dimer	HHblits	X-ray	2.70Å	0.28	0.93	GLYCOSYL TRANSFERASE
5gl5.1.A	13.74	homo-dimer	HHblits	X-ray	1.90Å	0.27	0.94	Sterol 3-beta-glucosyltransferase
5gl5.1.B	13.74	homo-dimer	HHblits	X-ray	1.90Å	0.27	0.94	Sterol 3-beta-glucosyltransferase
3d1j.1.A	14.24	monomer	HHblits	X-ray	3.00Å	0.26	0.95	Glycogen synthase
3ot5.1.A	14.20	monomer	HHblits	X-ray	2.20Å	0.28	0.93	UDP-N-acetylglucosamine 2-epimerase
3ot5.2.A	14.20	monomer	HHblits	X-ray	2.20Å	0.28	0.93	UDP-N-acetylglucosamine 2-epimerase
3dzc.1.A	16.77	homo-dimer	HHblits	X-ray	2.35Å	0.28	0.92	UDP-N-acetylglucosamine 2-epimerase
3dzc.1.B	16.77	homo-dimer	HHblits	X-ray	2.35Å	0.28	0.92	UDP-N-acetylglucosamine 2-epimerase
1rzu.1.A	13.12	monomer	HHblits	X-ray	2.30Å	0.26	0.95	Glycogen synthase 1
1rzu.2.A	13.12	monomer	HHblits	X-ray	2.30Å	0.26	0.95	Glycogen synthase 1
1v4v.1.A	17.31	homo-dimer	HHblits	X-ray	1.80Å	0.28	0.93	UDP-N-Acetylglucosamine 2-Epimerase
1v4v.1.B	17.31	homo-dimer	HHblits	X-ray	1.80Å	0.28	0.93	UDP-N-Acetylglucosamine 2-Epimerase
3guh.1.A	14.29	monomer	HHblits	X-ray	2.79Å	0.26	0.95	Glycogen synthase
4hwg.1.A	17.52	homo-hexamer	HHblits	X-ray	2.00Å	0.29	0.91	UDP-N-acetylglucosamine 2-epimerase
5du2.1.A	16.02	monomer	HHblits	X-ray	2.70Å	0.28	0.93	EspG2 glycosyltransferase
5du2.2.A	16.02	monomer	HHblits	X-ray	2.70Å	0.28	0.93	EspG2 glycosyltransferase
5d00.1.A	15.38	homo-dimer	HHblits	X-ray	2.15Å	0.27	0.93	N-acetyl-alpha-D-glucosaminyl L-malate synthase
4xsr.1.A	12.65	homo-dimer	HHblits	X-ray	2.39Å	0.27	0.94	Alr3699 protein
4xsp.1.B	12.65	homo-dimer	HHblits	X-ray	2.15Å	0.27	0.94	Alr3699 protein
4xso.1.A	12.65	homo-dimer	HHblits	X-ray	2.01Å	0.27	0.94	Alr3699 protein
3cop.1.A	13.99	monomer	HHblits	X-ray	2.30Å	0.26	0.95	Glycogen synthase
3l01.1.A	12.24	monomer	HHblits	X-ray	2.60Å	0.26	0.95	GlgA glycogen synthase
3iaa.1.A	14.50	homo-dimer	HHblits	X-ray	2.51Å	0.27	0.93	CalG2
3fro.1.A	12.57	homo-trimer	HHblits	X-ray	2.50Å	0.26	0.94	GlgA glycogen synthase
3fro.1.B	12.57	homo-trimer	HHblits	X-ray	2.50Å	0.26	0.94	GlgA glycogen synthase
3fro.1.C	12.57	homo-trimer	HHblits	X-ray	2.50Å	0.26	0.94	GlgA glycogen synthase
1o6c.1.A	15.22	homo-dimer	HHblits	X-ray	2.90Å	0.28	0.93	UDP-N-acetylglucosamine 2-epimerase
1o6c.1.B	15.22	homo-dimer	HHblits	X-ray	2.90Å	0.28	0.93	UDP-N-acetylglucosamine 2-epimerase
4fkz.1.A	15.22	homo-dimer	HHblits	X-ray	1.69Å	0.28	0.93	UDP-N-acetylglucosamine 2-epimerase
3mbo.1.A	13.91	homo-dimer	HHblits	X-ray	3.31Å	0.27	0.93	Glycosyltransferase, group 1 family
3mbo.1.B	13.91	homo-dimer	HHblits	X-ray	3.31Å	0.27	0.93	Glycosyltransferase, group 1 family
3mbo.2.A	13.91	homo-dimer	HHblits	X-ray	3.31Å	0.27	0.93	Glycosyltransferase, group 1 family
3mbo.2.B	13.91	homo-dimer	HHblits	X-ray	3.31Å	0.27	0.93	Glycosyltransferase, group 1 family
3mbo.3.A	13.91	homo-dimer	HHblits	X-ray	3.31Å	0.27	0.93	Glycosyltransferase, group 1 family
3mbo.3.B	13.91	homo-dimer	HHblits	X-ray	3.31Å	0.27	0.93	Glycosyltransferase, group 1 family
3mbo.4.A	13.91	homo-dimer	HHblits	X-ray	3.31Å	0.27	0.93	Glycosyltransferase, group 1 family
3mbo.4.B	13.91	homo-dimer	HHblits	X-ray	3.31Å	0.27	0.93	Glycosyltransferase, group 1 family
2r68.1.A	12.87	monomer	HHblits	X-ray	2.40Å	0.26	0.94	Glycosyl transferase, group 1
3rsc.1.A	14.20	monomer	HHblits	X-ray	2.19Å	0.27	0.93	CalG2
2p6p.1.A	15.36	homo-dimer	HHblits	X-ray	1.88Å	0.28	0.92	Glycosyl transferase
2p6p.1.B	15.36	homo-dimer	HHblits	X-ray	1.88Å	0.28	0.92	Glycosyl transferase
2bis.1.A	12.61	monomer	HHblits	X-ray	2.80Å	0.26	0.94	GLGA GLYCOGEN SYNTHASE
2bis.2.A	12.61	monomer	HHblits	X-ray	2.80Å	0.26	0.94	GLGA GLYCOGEN SYNTHASE
4zht.1.A	14.80	homo-tetramer	HHblits	X-ray	2.69Å	0.28	0.91	Bifunctional UDP-N-acetylglucosamine 2-epimerase/N-acetylmannosamine kinase
3c4q.1.A	9.94	homo-dimer	HHblits	X-ray	2.80Å	0.26	0.94	Predicted glycosyltransferases
3c48.1.A	9.94	homo-dimer	HHblits	X-ray	2.10Å	0.26	0.94	Predicted glycosyltransferases
1iir.1.A	13.95	monomer	HHblits	X-ray	1.80Å	0.27	0.93	glycosyltransferase GtfB
3h4i.1.A	14.88	monomer	HHblits	X-ray	1.30Å	0.27	0.93	Glycosyltransferase GtfA, Glycosyltransferase
2xa9.1.A	14.07	monomer	HHblits	X-ray	2.50Å	0.27	0.92	TREHALOSE-SYNTHASE TRET
1pnv.1.A	12.39	homo-dimer	HHblits	X-ray	2.80Å	0.26	0.94	GLYCOSYLTRANSFERASE GTFA
1pnv.1.B	12.39	homo-dimer	HHblits	X-ray	2.80Å	0.26	0.94	GLYCOSYLTRANSFERASE GTFA
2xa1.1.A	13.77	monomer	HHblits	X-ray	2.47Å	0.27	0.92	TREHALOSE-SYNTHASE TRET
2x6r.1.A	13.77	monomer	HHblits	X-ray	2.20Å	0.27	0.92	TREHALOSE-SYNTHASE TRET
2acv.1.A	17.38	homo-dimer	HHblits	X-ray	2.00Å	0.28	0.91	triterpene UDP-glucosyl transferase UGT71G1
2acv.1.B	17.38	homo-dimer	HHblits	X-ray	2.00Å	0.28	0.91	triterpene UDP-glucosyl transferase UGT71G1
3tsa.1.A	12.61	homo-dimer	HHblits	X-ray	1.70Å	0.27	0.92	NDP-rhamnosyltransferase
3tsa.1.B	12.61	homo-dimer	HHblits	X-ray	1.70Å	0.27	0.92	NDP-rhamnosyltransferase
3oti.1.A	13.76	monomer	HHblits	X-ray	1.60Å	0.28	0.90	CalG3
3d0r.1.B	13.76	homo-dimer	HHblits	X-ray	1.90Å	0.28	0.90	Protein CalG3
3d0r.1.A	13.76	homo-dimer	HHblits	X-ray	1.90Å	0.28	0.90	Protein CalG3
3d0q.1.A	13.76	homo-dimer	HHblits	X-ray	2.79Å	0.28	0.90	Protein CalG3
2vg8.1.A	17.34	monomer	HHblits	X-ray	1.75Å	0.29	0.89	HYDROQUINONE GLUCOSYLTRANSFERASE
2gek.1.A	13.21	monomer	HHblits	X-ray	2.40Å	0.26	0.92	PHOSPHATIDYLINOSITOL MANNOSYLTRANSFERASE (PimA)
2jjm.1.A	13.64	homo-tetramer	HHblits	X-ray	3.10Å	0.27	0.91	GLYCOSYL TRANSFERASE, GROUP 1 FAMILY PROTEIN
1rrv.1.A	12.31	monomer	HHblits	X-ray	2.00Å	0.26	0.92	GLYCOSYLTRANSFERASE GTFD
4nc9.2.A	13.21	monomer	HHblits	X-ray	3.19Å	0.26	0.92	GDP-mannose-dependent alpha-(1-2)-phosphatidylinositol mannosyltransferase
4nc9.1.A	13.21	monomer	HHblits	X-ray	3.19Å	0.26	0.92	GDP-mannose-dependent alpha-(1-2)-phosphatidylinositol mannosyltransferase
4n9w.1.A	13.21	monomer	HHblits	X-ray	1.94Å	0.26	0.92	GDP-mannose-dependent alpha-(1-2)-phosphatidylinositol mannosyltransferase
5u6n.2.A	16.10	monomer	HHblits	X-ray	2.00Å	0.29	0.89	UDP-glycosyltransferase 74F2
5u6n.1.A	16.10	monomer	HHblits	X-ray	2.00Å	0.29	0.89	UDP-glycosyltransferase 74F2
4neq.1.A	15.12	homo-dimer	HHblits	X-ray	2.85Å	0.28	0.90	UDP-N-acetylglucosamine 2-epimerase
4nes.1.A	15.12	homo-dimer	HHblits	X-ray	1.42Å	0.28	0.90	UDP-N-acetylglucosamine 2-epimerase
3uyl.1.A	12.08	homo-dimer	HHblits	X-ray	1.85Å	0.26	0.91	NDP-rhamnosyltransferase
5v2k.1.A	16.10	monomer	HHblits	X-ray	2.00Å	0.28	0.89	UDP-glycosyltransferase 74F2
5v2k.2.A	16.10	monomer	HHblits	X-ray	2.00Å	0.28	0.89	UDP-glycosyltransferase 74F2
5u6m.1.A	16.15	monomer	HHblits	X-ray	2.57Å	0.28	0.89	UDP-glycosyltransferase 74F2
5u6m.2.A	16.15	monomer	HHblits	X-ray	2.57Å	0.28	0.89	UDP-glycosyltransferase 74F2
5u6s.1.A	16.15	monomer	HHblits	X-ray	2.00Å	0.28	0.89	UDP-glycosyltransferase 74F2
5u6s.2.A	16.15	monomer	HHblits	X-ray	2.00Å	0.28	0.89	UDP-glycosyltransferase 74F2
3oka.1.A	12.99	hetero-oligomer	HHblits	X-ray	2.20Å	0.26	0.91	GDP-mannose-dependent alpha-(1-6)-phosphatidylinositol monomannoside mannosyltransferase
3okp.1.A	13.03	monomer	HHblits	X-ray	2.00Å	0.26	0.91	GDP-mannose-dependent alpha-(1-6)-phosphatidylinositol monomannoside mannosyltransferase
5tmd.1.A	15.00	monomer	HHblits	X-ray	2.19Å	0.28	0.88	Glycosyltransferase, Os79
5tmb.1.A	15.00	monomer	HHblits	X-ray	2.34Å	0.28	0.88	Glycosyltransferase, Os79
3oy2.1.A	11.82	homo-dimer	HHblits	X-ray	2.31Å	0.26	0.91	Glycosyltransferase B736L
2iv7.1.A	10.91	monomer	HHblits	X-ray	1.60Å	0.26	0.91	LIPOPOLYSACCHARIDE CORE BIOSYNTHESIS PROTEIN RFAG
2pq6.1.A	15.05	monomer	HHblits	X-ray	2.10Å	0.28	0.88	UDP-glucuronosyl/UDP-glucosyltransferase
2vsn.1.A	10.53	monomer	HHblits	X-ray	2.75Å	0.26	0.89	XCOGT
2xgs.1.A	11.18	monomer	HHblits	X-ray	2.39Å	0.26	0.89	XCOGT
2xgm.2.A	11.18	monomer	HHblits	X-ray	2.55Å	0.26	0.89	XCOGT
2vsy.1.A	11.18	monomer	HHblits	X-ray	2.10Å	0.26	0.89	XCC0866
2vsy.2.A	11.18	monomer	HHblits	X-ray	2.10Å	0.26	0.89	XCC0866
3hbf.1.A	14.29	monomer	HHblits	X-ray	2.10Å	0.27	0.87	Flavonoid 3-O-glucosyltransferase
3hbj.1.A	14.29	monomer	HHblits	X-ray	2.10Å	0.27	0.87	Flavonoid 3-O-glucosyltransferase
4xyw.1.A	15.48	monomer	HHblits	X-ray	2.20Å	0.27	0.86	O-antigen biosynthesis glycosyltransferase WbnH
2h1f.1.A	14.62	monomer	HHblits	X-ray	2.40Å	0.27	0.83	Lipopolysaccharide heptosyltransferase-1
2h1f.2.A	14.62	monomer	HHblits	X-ray	2.40Å	0.27	0.83	Lipopolysaccharide heptosyltransferase-1
2gt1.1.A	14.38	monomer	HHblits	X-ray	1.90Å	0.27	0.83	Lipopolysaccharide heptosyltransferase-1
2gt1.2.A	14.38	monomer	HHblits	X-ray	1.90Å	0.27	0.83	Lipopolysaccharide heptosyltransferase-1
2xci.1.A	12.93	homo-dimer	HHblits	X-ray	2.00Å	0.26	0.81	3-DEOXY-D-MANNO-2-OCTULOSONIC ACID TRANSFERASE
2iv3.1.A	11.76	homo-dimer	HHblits	X-ray	2.30Å	0.26	0.80	GLYCOSYLTRANSFERASE
4w6q.1.A	12.68	homo-tetramer	HHblits	X-ray	2.70Å	0.26	0.78	glucosyltransferase
4w6q.1.B	12.68	homo-tetramer	HHblits	X-ray	2.70Å	0.26	0.78	glucosyltransferase
4w6q.1.C	12.68	homo-tetramer	HHblits	X-ray	2.70Å	0.26	0.78	glucosyltransferase
4w6q.1.D	12.68	homo-tetramer	HHblits	X-ray	2.70Å	0.26	0.78	glucosyltransferase
3rhz.1.A	9.71	homo-tetramer	HHblits	X-ray	1.90Å	0.25	0.77	Nucleotide sugar synthetase-like protein
3qkw.1.A	9.78	homo-tetramer	HHblits	X-ray	2.29Å	0.26	0.76	Nucleotide sugar synthetase-like protein
3q3h.1.A	11.32	monomer	HHblits	X-ray	2.25Å	0.26	0.73	HMW1C-like glycosyltransferase
1psw.1.A	17.37	monomer	HHblits	X-ray	2.00Å	0.28	0.72	ADP-HEPTOSE LPS HEPTOSYLTRANSFERASE II
3tov.1.A	15.44	monomer	HHblits	X-ray	2.98Å	0.28	0.72	Glycosyl transferase family 9
3tov.2.A	15.44	monomer	HHblits	X-ray	2.98Å	0.28	0.72	Glycosyl transferase family 9
3hbm.1.A	15.50	monomer	HHblits	X-ray	1.80Å	0.28	0.71	UDP-sugar hydrolase
3hbn.1.A	15.50	monomer	HHblits	X-ray	1.85Å	0.28	0.71	UDP-sugar hydrolase
3s27.1.A	13.18	homo-tetramer	HHblits	X-ray	2.91Å	0.27	0.71	Sucrose synthase 1
3s27.1.B	13.18	homo-tetramer	HHblits	X-ray	2.91Å	0.27	0.71	Sucrose synthase 1
4wac.1.A	13.18	homo-trimer	HHblits	X-ray	2.40Å	0.27	0.71	Glycosyl transferase, group 1 family protein
4wad.1.A	13.18	homo-trimer	HHblits	X-ray	2.80Å	0.27	0.71	Glycosyl transferase, group 1 family protein
4x7r.1.A	12.79	monomer	HHblits	X-ray	2.15Å	0.27	0.71	TarM
4x7m.2.A	12.79	monomer	HHblits	X-ray	2.40Å	0.27	0.71	Uncharacterized protein
4x7m.1.A	12.79	monomer	HHblits	X-ray	2.40Å	0.27	0.71	Uncharacterized protein
4x6l.1.A	12.79	homo-trimer	HHblits	X-ray	3.19Å	0.27	0.71	TarM
4x7p.1.A	12.79	homo-trimer	HHblits	X-ray	3.40Å	0.27	0.71	TarM
4pqg.1.A	12.20	monomer	HHblits	X-ray	2.00Å	0.26	0.70	Glycosyltransferase Gtf1
4f96.1.A	9.34	homo-dimer	HHblits	X-ray	2.15Å	0.25	0.71	VldE
4f9f.1.A	9.34	homo-dimer	HHblits	X-ray	2.81Å	0.25	0.71	VldE
4f9f.1.B	9.34	homo-dimer	HHblits	X-ray	2.81Å	0.25	0.71	VldE
4f9f.2.A	9.34	homo-dimer	HHblits	X-ray	2.81Å	0.25	0.71	VldE
5djs.1.A	8.98	monomer	HHblits	X-ray	2.80Å	0.26	0.71	Tetratricopeptide TPR_2 repeat protein
5e9t.1.A	11.42	hetero-oligomer	HHblits	X-ray	2.92Å	0.26	0.70	Glycosyltransferase Gtf1
5e9t.1.C	11.42	hetero-oligomer	HHblits	X-ray	2.92Å	0.26	0.70	Glycosyltransferase Gtf1
5e9u.1.A	11.42	hetero-oligomer	HHblits	X-ray	3.84Å	0.26	0.70	Glycosyltransferase Gtf1
5e9u.1.C	11.42	hetero-oligomer	HHblits	X-ray	3.84Å	0.26	0.70	Glycosyltransferase Gtf1
5e9u.2.A	11.42	hetero-oligomer	HHblits	X-ray	3.84Å	0.26	0.70	Glycosyltransferase Gtf1
5e9u.2.C	11.42	hetero-oligomer	HHblits	X-ray	3.84Å	0.26	0.70	Glycosyltransferase Gtf1
5lqd.1.A	9.80	homo-dimer	HHblits	X-ray	1.95Å	0.25	0.70	Alpha,alpha-trehalose-phosphate synthase
5lqd.1.B	9.80	homo-dimer	HHblits	X-ray	1.95Å	0.25	0.70	Alpha,alpha-trehalose-phosphate synthase
3cv3.1.A	12.89	monomer	HHblits	X-ray	2.25Å	0.26	0.62	Glucuronosyltransferase GumK
2q6v.1.A	12.44	monomer	HHblits	X-ray	2.28Å	0.26	0.62	Glucuronosyltransferase GumK
3l7i.1.A	12.38	homo-tetramer	HHblits	X-ray	2.70Å	0.27	0.58	Teichoic acid biosynthesis protein F
3vue.1.A	10.85	monomer	HHblits	X-ray	2.70Å	0.26	0.59	Granule-bound starch synthase 1, chloroplastic/amyloplastic
3l7k.1.A	11.43	homo-tetramer	HHblits	X-ray	3.10Å	0.27	0.58	Teichoic acid biosynthesis protein F
3l7k.1.D	11.43	homo-tetramer	HHblits	X-ray	3.10Å	0.27	0.58	Teichoic acid biosynthesis protein F
4hln.1.A	9.95	monomer	HHblits	X-ray	2.70Å	0.26	0.58	Starch synthase I
3l7m.1.A	12.50	homo-tetramer	HHblits	X-ray	2.85Å	0.27	0.57	Teichoic acid biosynthesis protein F
5i45.1.A	10.75	monomer	HHblits	X-ray	1.35Å	0.27	0.51	Glycosyl transferases group 1 family protein
5jij.1.A	12.37	homo-tetramer	HHblits	X-ray	1.82Å	0.26	0.51	Alpha,alpha-trehalose-phosphate synthase
5jio.1.A	12.37	homo-tetramer	HHblits	X-ray	1.71Å	0.26	0.51	Alpha,alpha-trehalose-phosphate synthase
5l3k.2.D	12.37	homo-tetramer	HHblits	X-ray	2.31Å	0.26	0.51	Alpha,alpha-trehalose-phosphate synthase
3t5t.1.A	10.27	homo-dimer	HHblits	X-ray	1.70Å	0.25	0.51	Putative glycosyltransferase
3t5t.1.B	10.27	homo-dimer	HHblits	X-ray	1.70Å	0.25	0.51	Putative glycosyltransferase
3t7d.1.A	10.27	homo-dimer	HHblits	X-ray	1.70Å	0.25	0.51	Putative glycosyltransferase
1uqu.1.A	7.57	monomer	HHblits	X-ray	2.00Å	0.25	0.51	ALPHA, ALPHA-TREHALOSE-PHOSPHATE SYNTHASE
1uqu.2.A	7.57	monomer	HHblits	X-ray	2.00Å	0.25	0.51	ALPHA, ALPHA-TREHALOSE-PHOSPHATE SYNTHASE
1gz5.1.A	7.57	homo-tetramer	HHblits	X-ray	2.43Å	0.25	0.51	ALPHA-TREHALOSE-PHOSPHATE SYNTHASE
5hxa.1.A	8.11	homo-dimer	HHblits	X-ray	2.00Å	0.24	0.51	Alpha,alpha-trehalose-phosphate synthase (UDP-forming)
5lwv.1.A	14.86	monomer	HHblits	X-ray	1.90Å	0.27	0.48	Host cell factor 1,UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit
5lvv.1.A	14.94	monomer	HHblits	X-ray	2.54Å	0.27	0.48	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit,UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit
4bfc.1.A	11.49	homo-trimer	HHblits	X-ray	1.70Å	0.27	0.48	3-DEOXY-D-MANNO-OCTULOSONIC-ACID TRANSFERASE
4ay5.1.A	14.94	hetero-oligomer	HHblits	X-ray	3.15Å	0.27	0.48	UDP-N-ACETYLGLUCOSAMINE--PEPTIDE N-ACETYLGLUCOSAMINYL TRANSFERASE 110 KDA SUBUNIT
4gyw.1.A	14.94	hetero-oligomer	HHblits	X-ray	1.70Å	0.27	0.48	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit
4n3c.1.A	14.94	hetero-oligomer	HHblits	X-ray	2.55Å	0.27	0.48	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit
5c1d.1.A	14.94	monomer	HHblits	X-ray	2.05Å	0.27	0.48	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit
5hgv.1.A	14.94	hetero-oligomer	HHblits	X-ray	2.05Å	0.27	0.48	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit
5a01.1.A	12.00	monomer	HHblits	X-ray	2.66Å	0.26	0.48	O-GLYCOSYLTRANSFERASE
5huv.1.A	14.81	homo-dimer	HHblits	X-ray	2.00Å	0.27	0.45	Alpha,alpha-trehalose-phosphate synthase [UDP-forming]
5hut.1.A	14.29	homo-dimer	HHblits	X-ray	1.90Å	0.27	0.44	Alpha,alpha-trehalose-phosphate synthase [UDP-forming]
5hvo.1.A	13.04	homo-dimer	HHblits	X-ray	2.47Å	0.27	0.44	Alpha,alpha-trehalose-phosphate synthase (UDP-forming)
5dxf.1.A	12.42	monomer	HHblits	X-ray	2.56Å	0.26	0.44	trehalose-6-phosphate phosphatase
5dxf.2.A	12.42	monomer	HHblits	X-ray	2.56Å	0.26	0.44	trehalose-6-phosphate phosphatase
5hvm.1.A	13.13	homo-dimer	HHblits	X-ray	2.82Å	0.26	0.44	Alpha,alpha-trehalose-phosphate synthase (UDP-forming)
5v0t.1.A	9.94	monomer	HHblits	X-ray	1.95Å	0.25	0.44	Alpha,alpha-trehalose-phosphate synthase (UDP-forming)
5tvg.1.A	9.94	homo-tetramer	HHblits	X-ray	2.30Å	0.24	0.44	Alpha,alpha-trehalose-phosphate synthase (UDP-forming)
5tvg.2.A	9.94	homo-tetramer	HHblits	X-ray	2.30Å	0.24	0.44	Alpha,alpha-trehalose-phosphate synthase (UDP-forming)
5uof.1.A	9.32	homo-dimer	HHblits	X-ray	1.70Å	0.24	0.44	Alpha,alpha-trehalose-phosphate synthase (UDP-forming)
2bfw.1.A	12.26	monomer	HHblits	X-ray	1.80Å	0.27	0.43	GLGA GLYCOGEN SYNTHASE
4s0v.1.A	12.26	monomer	HHblits	X-ray	2.50Å	0.27	0.43	Human Orexin receptor type 2 fusion protein to P. abysii Glycogen Synthase
3qhp.1.A	12.34	monomer	HHblits	X-ray	1.50Å	0.27	0.43	Type 1 capsular polysaccharide biosynthesis protein J (CapJ)
3qhp.2.A	12.34	monomer	HHblits	X-ray	1.50Å	0.27	0.43	Type 1 capsular polysaccharide biosynthesis protein J (CapJ)
5u09.1.A	10.97	monomer	HHblits	X-ray	2.60Å	0.26	0.43	Cannabinoid receptor 1,GlgA glycogen synthase
4zj8.1.A	12.50	monomer	HHblits	X-ray	2.75Å	0.27	0.42	human OX1R fusion protein to P.abysii glycogen synthase
2o6l.1.A	18.06	homo-dimer	HHblits	X-ray	1.80Å	0.31	0.40	UDP-glucuronosyltransferase 2B7
2o6l.1.B	18.06	homo-dimer	HHblits	X-ray	1.80Å	0.31	0.40	UDP-glucuronosyltransferase 2B7
2jzc.1.A	20.44	monomer	HHblits	NMR	NA	0.30	0.38	UDP-N-acetylglucosamine transferase subunit ALG13
2ks6.1.A	19.85	monomer	HHblits	NMR	NA	0.30	0.38	UDP-N-acetylglucosamine transferase subunit ALG13
2x0d.1.A	11.51	homo-dimer	HHblits	X-ray	2.28Å	0.28	0.38	WSAF
2f9f.1.A	9.42	monomer	HHblits	X-ray	1.80Å	0.26	0.38	first mannosyl transferase (wbaZ-1)
5e9t.1.B	6.57	hetero-oligomer	HHblits	X-ray	2.92Å	0.26	0.38	Glycosyltransferase-stabilizing protein Gtf2
5e9t.1.D	6.57	hetero-oligomer	HHblits	X-ray	2.92Å	0.26	0.38	Glycosyltransferase-stabilizing protein Gtf2
2x0f.1.A	11.28	homo-dimer	HHblits	X-ray	2.55Å	0.28	0.37	WSAF
5e9u.1.B	7.69	hetero-oligomer	HHblits	X-ray	3.84Å	0.26	0.36	Glycosyltransferase-stabilizing protein Gtf2
5e9u.1.D	7.69	hetero-oligomer	HHblits	X-ray	3.84Å	0.26	0.36	Glycosyltransferase-stabilizing protein Gtf2
5e9u.2.B	7.69	hetero-oligomer	HHblits	X-ray	3.84Å	0.26	0.36	Glycosyltransferase-stabilizing protein Gtf2
5e9u.2.D	7.69	hetero-oligomer	HHblits	X-ray	3.84Å	0.26	0.36	Glycosyltransferase-stabilizing protein Gtf2
4m60.1.A	28.57	monomer	BLAST	X-ray	1.77Å	0.35	0.31	Oleandomycin glycosyltransferase
4m83.1.A	28.57	monomer	BLAST	X-ray	1.70Å	0.35	0.31	Oleandomycin glycosyltransferase
4m83.2.A	28.57	monomer	BLAST	X-ray	1.70Å	0.35	0.31	Oleandomycin glycosyltransferase
2iyf.1.A	28.57	monomer	BLAST	X-ray	1.70Å	0.35	0.31	OLEANDOMYCIN GLYCOSYLTRANSFERASE
2iyf.2.A	28.57	monomer	BLAST	X-ray	1.70Å	0.35	0.31	OLEANDOMYCIN GLYCOSYLTRANSFERASE
6pfk.1.A	12.17	homo-tetramer	HHblits	X-ray	2.60Å	0.26	0.32	PHOSPHOFRUCTOKINASE
3u39.1.A	12.17	homo-tetramer	HHblits	X-ray	2.79Å	0.26	0.32	6-phosphofructokinase
3pfk.1.A	12.17	homo-tetramer	HHblits	X-ray	2.40Å	0.25	0.32	PHOSPHOFRUCTOKINASE
4a3s.1.A	14.29	homo-tetramer	HHblits	X-ray	2.30Å	0.27	0.31	6-PHOSPHOFRUCTOKINASE
2pfk.1.A	19.82	homo-tetramer	HHblits	X-ray	2.40Å	0.27	0.31	6-PHOSPHOFRUCTOKINASE ISOZYME I
1pfk.1.A	19.82	homo-tetramer	HHblits	X-ray	2.40Å	0.27	0.31	PHOSPHOFRUCTOKINASE
1zxx.1.A	15.18	homo-tetramer	HHblits	X-ray	1.85Å	0.27	0.31	6-phosphofructokinase
4kq1.1.B	13.64	homo-tetramer	HHblits	X-ray	2.66Å	0.28	0.30	Gsy2p
4kq1.1.A	13.64	homo-tetramer	HHblits	X-ray	2.66Å	0.28	0.30	Gsy2p
4kq1.1.C	13.64	homo-tetramer	HHblits	X-ray	2.66Å	0.28	0.30	Gsy2p
3rt1.1.A	13.64	homo-tetramer	HHblits	X-ray	2.80Å	0.28	0.30	PROTEIN (Glycogen [starch] synthase isoform 2)
3rt1.1.B	13.64	homo-tetramer	HHblits	X-ray	2.80Å	0.28	0.30	PROTEIN (Glycogen [starch] synthase isoform 2)
3rt1.1.C	13.64	homo-tetramer	HHblits	X-ray	2.80Å	0.28	0.30	PROTEIN (Glycogen [starch] synthase isoform 2)
5sul.1.B	13.64	homo-tetramer	HHblits	X-ray	3.30Å	0.28	0.30	Glycogen [starch] synthase isoform 2
5sul.1.C	13.64	homo-tetramer	HHblits	X-ray	3.30Å	0.28	0.30	Glycogen [starch] synthase isoform 2
3opy.1.A	11.71	hetero-oligomer	HHblits	X-ray	3.05Å	0.27	0.31	6-phosphofructo-1-kinase alpha-subunit
3o8l.1.A	14.55	monomer	HHblits	X-ray	3.20Å	0.28	0.30	6-phosphofructokinase, muscle type
3o8l.2.A	14.55	monomer	HHblits	X-ray	3.20Å	0.28	0.30	6-phosphofructokinase, muscle type
3o8n.1.A	14.55	monomer	HHblits	X-ray	3.20Å	0.28	0.30	6-phosphofructokinase, muscle type
3o8n.2.A	14.55	monomer	HHblits	X-ray	3.20Å	0.28	0.30	6-phosphofructokinase, muscle type
1mto.1.A	14.29	homo-tetramer	HHblits	X-ray	3.20Å	0.26	0.31	6-phosphofructokinase
4i36.1.A	14.29	homo-tetramer	HHblits	X-ray	2.30Å	0.26	0.31	6-phosphofructokinase
4i7e.1.B	14.29	homo-tetramer	HHblits	X-ray	2.00Å	0.26	0.31	6-phosphofructokinase
4xyj.1.A	10.00	homo-tetramer	HHblits	X-ray	3.10Å	0.28	0.30	ATP-dependent 6-phosphofructokinase, platelet type
4xyk.1.A	10.00	homo-tetramer	HHblits	X-ray	3.40Å	0.28	0.30	ATP-dependent 6-phosphofructokinase, platelet type
4qlb.1.A	12.73	hetero-oligomer	HHblits	X-ray	2.60Å	0.27	0.30	Probable glycogen [starch] synthase
4qlb.1.B	12.73	hetero-oligomer	HHblits	X-ray	2.60Å	0.27	0.30	Probable glycogen [starch] synthase
4i4i.1.A	13.39	homo-tetramer	HHblits	X-ray	2.49Å	0.26	0.31	6-phosphofructokinase
4kqm.1.B	11.82	homo-tetramer	HHblits	X-ray	2.77Å	0.27	0.30	Gsy2p
4kqm.1.A	11.82	homo-tetramer	HHblits	X-ray	2.77Å	0.27	0.30	Gsy2p
4kqm.1.C	11.82	homo-tetramer	HHblits	X-ray	2.77Å	0.27	0.30	Gsy2p
5suk.1.A	11.82	homo-tetramer	HHblits	X-ray	2.88Å	0.27	0.30	Glycogen [starch] synthase isoform 2
5suk.1.B	11.82	homo-tetramer	HHblits	X-ray	2.88Å	0.27	0.30	Glycogen [starch] synthase isoform 2
5suk.1.C	11.82	homo-tetramer	HHblits	X-ray	2.88Å	0.27	0.30	Glycogen [starch] synthase isoform 2
3o8o.1.A	10.81	hetero-oligomer	HHblits	X-ray	2.90Å	0.26	0.31	6-phosphofructokinase subunit alpha
4rh3.1.A	9.09	homo-tetramer	HHblits	X-ray	3.02Å	0.27	0.30	ATP-dependent 6-phosphofructokinase, platelet type
4u1r.1.B	9.09	homo-tetramer	HHblits	X-ray	2.80Å	0.27	0.30	ATP-dependent 6-phosphofructokinase, platelet type
3rsz.1.A	12.84	homo-tetramer	HHblits	X-ray	3.01Å	0.27	0.30	Glycogen [starch] synthase isoform 2
1cqi.1.A	13.59	hetero-oligomer	HHblits	X-ray	3.30Å	0.26	0.28	PROTEIN (SUCCINYL-COA SYNTHETASE ALPHA CHAIN)
3o8o.1.A	18.81	hetero-oligomer	HHblits	X-ray	2.90Å	0.28	0.28	6-phosphofructokinase subunit alpha
2wtx.1.A	10.68	homo-dimer	HHblits	X-ray	2.20Å	0.26	0.28	ALPHA, ALPHA-TREHALOSE-PHOSPHATE SYNTHASE [UDP-FORMING]
2wtx.1.B	10.68	homo-dimer	HHblits	X-ray	2.20Å	0.26	0.28	ALPHA, ALPHA-TREHALOSE-PHOSPHATE SYNTHASE [UDP-FORMING]
2yvq.1.A	15.00	monomer	HHblits	X-ray	1.98Å	0.27	0.28	Carbamoyl-phosphate synthase
4hnv.1.A	13.00	homo-tetramer	HHblits	X-ray	2.80Å	0.27	0.28	Pyruvate carboxylase
4hnv.1.B	13.00	homo-tetramer	HHblits	X-ray	2.80Å	0.27	0.28	Pyruvate carboxylase
4hnv.1.C	13.00	homo-tetramer	HHblits	X-ray	2.80Å	0.27	0.28	Pyruvate carboxylase
4hnv.1.D	13.00	homo-tetramer	HHblits	X-ray	2.80Å	0.27	0.28	Pyruvate carboxylase
2dzd.1.A	15.00	homo-dimer	HHblits	X-ray	2.40Å	0.27	0.28	pyruvate carboxylase
3bg5.1.A	13.00	homo-tetramer	HHblits	X-ray	2.80Å	0.26	0.28	Pyruvate carboxylase
3bg5.1.B	13.00	homo-tetramer	HHblits	X-ray	2.80Å	0.26	0.28	Pyruvate carboxylase
3bg5.1.C	13.00	homo-tetramer	HHblits	X-ray	2.80Å	0.26	0.28	Pyruvate carboxylase
3bg5.1.D	13.00	homo-tetramer	HHblits	X-ray	2.80Å	0.26	0.28	Pyruvate carboxylase
3opy.1.A	16.00	hetero-oligomer	HHblits	X-ray	3.05Å	0.26	0.28	6-phosphofructo-1-kinase alpha-subunit
3hbl.1.A	13.00	homo-tetramer	HHblits	X-ray	2.71Å	0.26	0.28	Pyruvate carboxylase
3hbl.1.B	13.00	homo-tetramer	HHblits	X-ray	2.71Å	0.26	0.28	Pyruvate carboxylase
3hbl.1.C	13.00	homo-tetramer	HHblits	X-ray	2.71Å	0.26	0.28	Pyruvate carboxylase
3hbl.1.D	13.00	homo-tetramer	HHblits	X-ray	2.71Å	0.26	0.28	Pyruvate carboxylase
5vz0.1.A	13.00	homo-tetramer	HHblits	X-ray	2.00Å	0.26	0.28	Pyruvate carboxylase
5vz0.1.D	13.00	homo-tetramer	HHblits	X-ray	2.00Å	0.26	0.28	Pyruvate carboxylase
5vyz.1.A	13.00	homo-tetramer	HHblits	X-ray	2.30Å	0.26	0.28	Pyruvate carboxylase
5vyz.1.B	13.00	homo-tetramer	HHblits	X-ray	2.30Å	0.26	0.28	Pyruvate carboxylase
5vyw.1.A	13.00	homo-tetramer	HHblits	X-ray	3.10Å	0.26	0.28	Pyruvate carboxylase
5vyw.1.C	13.00	homo-tetramer	HHblits	X-ray	3.10Å	0.26	0.28	Pyruvate carboxylase
3o8l.1.A	14.85	monomer	HHblits	X-ray	3.20Å	0.25	0.28	6-phosphofructokinase, muscle type
3o8l.2.A	14.85	monomer	HHblits	X-ray	3.20Å	0.25	0.28	6-phosphofructokinase, muscle type
3o8n.1.A	14.85	monomer	HHblits	X-ray	3.20Å	0.25	0.28	6-phosphofructokinase, muscle type
3o8n.2.A	14.85	monomer	HHblits	X-ray	3.20Å	0.25	0.28	6-phosphofructokinase, muscle type
3jzi.1.A	15.15	homo-dimer	HHblits	X-ray	2.31Å	0.26	0.27	Biotin carboxylase
5c4r.1.A	21.28	monomer	HHblits	X-ray	3.17Å	0.30	0.26	Precorrin-6A reductase
5dou.1.A	15.63	homo-dimer	HHblits	X-ray	2.60Å	0.28	0.27	Carbamoyl-phosphate synthase [ammonia], mitochondrial
5dot.1.A	15.63	homo-dimer	HHblits	X-ray	2.40Å	0.28	0.27	Carbamoyl-phosphate synthase [ammonia], mitochondrial
1kzh.1.A	13.40	homo-dimer	HHblits	X-ray	2.55Å	0.27	0.27	phosphofructokinase
1kzh.1.B	13.40	homo-dimer	HHblits	X-ray	2.55Å	0.27	0.27	phosphofructokinase
2f48.1.B	13.40	homo-dimer	HHblits	X-ray	2.11Å	0.27	0.27	diphosphate--fructose-6-phosphate 1-phosphotransferase
4xyj.1.A	15.15	homo-tetramer	HHblits	X-ray	3.10Å	0.25	0.27	ATP-dependent 6-phosphofructokinase, platelet type
4xyk.1.A	15.15	homo-tetramer	HHblits	X-ray	3.40Å	0.25	0.27	ATP-dependent 6-phosphofructokinase, platelet type
4rh3.1.A	15.15	homo-tetramer	HHblits	X-ray	3.02Å	0.25	0.27	ATP-dependent 6-phosphofructokinase, platelet type
4u1r.1.B	15.15	homo-tetramer	HHblits	X-ray	2.80Å	0.25	0.27	ATP-dependent 6-phosphofructokinase, platelet type
3f5m.1.A	9.90	homo-tetramer	HHblits	X-ray	2.70Å	0.23	0.28	6-phospho-1-fructokinase (ATP-dependent phosphofructokinase)
2hig.1.A	9.90	homo-tetramer	HHblits	X-ray	2.40Å	0.23	0.28	6-phospho-1-fructokinase
4l8v.1.A	21.35	homo-tetramer	HHblits	X-ray	2.09Å	0.30	0.25	Inositol 2-dehydrogenase/D-chiro-inositol 3-dehydrogenase
4mie.1.A	20.22	homo-tetramer	HHblits	X-ray	2.00Å	0.28	0.25	Inositol 2-dehydrogenase/D-chiro-inositol 3-dehydrogenase
4mie.1.D	20.22	homo-tetramer	HHblits	X-ray	2.00Å	0.28	0.25	Inositol 2-dehydrogenase/D-chiro-inositol 3-dehydrogenase
1cde.1.A	22.35	monomer	HHblits	X-ray	2.50Å	0.31	0.23	PHOSPHORIBOSYL-GLYCINAMIDE FORMYLTRANSFERASE
1gar.1.B	22.35	homo-dimer	HHblits	X-ray	1.96Å	0.31	0.23	GLYCINAMIDE RIBONUCLEOTIDE TRANSFORMYLASE
1grc.1.A	22.35	homo-dimer	HHblits	X-ray	3.00Å	0.31	0.23	GLYCINAMIDE RIBONUCLEOTIDE TRANSFORMYLASE
1grc.1.B	22.35	homo-dimer	HHblits	X-ray	3.00Å	0.31	0.23	GLYCINAMIDE RIBONUCLEOTIDE TRANSFORMYLASE
1gar.1.A	22.35	homo-dimer	HHblits	X-ray	1.96Å	0.31	0.23	GLYCINAMIDE RIBONUCLEOTIDE TRANSFORMYLASE
1c2t.1.A	22.35	homo-dimer	HHblits	X-ray	2.10Å	0.31	0.23	GLYCINAMIDE RIBONUCLEOTIDE TRANSFORMYLASE
1jkx.1.A	22.35	homo-dimer	HHblits	X-ray	1.60Å	0.31	0.23	PHOSPHORIBOSYLGLYCINAMIDE FORMYLTRANSFERASE
1cdd.2.B	22.35	homo-dimer	HHblits	X-ray	2.80Å	0.31	0.23	PHOSPHORIBOSYL-GLYCINAMIDE FORMYLTRANSFERASE
1cdd.2.A	22.35	homo-dimer	HHblits	X-ray	2.80Å	0.31	0.23	PHOSPHORIBOSYL-GLYCINAMIDE FORMYLTRANSFERASE
3gar.1.A	22.35	homo-dimer	HHblits	X-ray	1.90Å	0.31	0.23	GLYCINAMIDE RIBONUCLEOTIDE TRANSFORMYLASE
2gar.1.A	22.35	monomer	HHblits	X-ray	1.80Å	0.31	0.23	GLYCINAMIDE RIBONUCLEOTIDE TRANSFORMYLASE
1c3e.1.A	22.35	homo-dimer	HHblits	X-ray	2.10Å	0.31	0.23	GLYCINAMIDE RIBONUCLEOTIDE TRANSFORMYLASE
1zly.1.A	18.82	monomer	HHblits	X-ray	2.07Å	0.30	0.23	Phosphoribosylglycinamide formyltransferase
1rc0.1.A	18.82	monomer	HHblits	X-ray	2.05Å	0.30	0.23	PHOSPHORIBOSYLGLYCINAMIDE FORMYLTRANSFERASE
1meo.1.A	18.82	monomer	HHblits	X-ray	1.72Å	0.30	0.23	Phosphoribosylglycinamide formyltransferase
1mej.1.A	18.82	monomer	HHblits	X-ray	2.00Å	0.30	0.23	Phosphoribosylglycinamide formyltransferase
1men.3.A	18.82	monomer	HHblits	X-ray	2.23Å	0.30	0.23	Phosphoribosylglycinamide formyltransferase
1ez1.1.A	7.95	homo-dimer	HHblits	X-ray	1.75Å	0.27	0.24	PHOSPHORIBOSYLGLYCINAMIDE FORMYLTRANSFERASE 2
1ez1.1.B	7.95	homo-dimer	HHblits	X-ray	1.75Å	0.27	0.24	PHOSPHORIBOSYLGLYCINAMIDE FORMYLTRANSFERASE 2
2dwc.1.A	13.64	homo-dimer	HHblits	X-ray	1.70Å	0.27	0.24	433aa long hypothetical phosphoribosylglycinamide formyl transferase
2czg.1.B	13.64	homo-dimer	HHblits	X-ray	2.35Å	0.27	0.24	phosphoribosylglycinamide formyl transferase
1kji.1.A	7.95	homo-dimer	HHblits	X-ray	1.60Å	0.27	0.24	phosphoribosylglycinamide formyltransferase 2
1kji.1.B	7.95	homo-dimer	HHblits	X-ray	1.60Å	0.27	0.24	phosphoribosylglycinamide formyltransferase 2
3tqr.1.A	17.86	monomer	HHblits	X-ray	1.97Å	0.30	0.23	Phosphoribosylglycinamide formyltransferase
4zyt.1.A	19.05	monomer	HHblits	X-ray	1.70Å	0.30	0.23	Trifunctional purine biosynthetic protein adenosine-3
5j9f.1.A	19.05	monomer	HHblits	X-ray	2.10Å	0.30	0.23	Trifunctional purine biosynthetic protein adenosine-3
2ixd.1.A	11.49	homo-hexamer	HHblits	X-ray	1.80Å	0.27	0.24	LMBE-RELATED PROTEIN
3da8.1.A	19.51	homo-dimer	HHblits	X-ray	1.30Å	0.31	0.23	Probable 5'-phosphoribosylglycinamide formyltransferase purN
3dcj.1.B	19.51	homo-dimer	HHblits	X-ray	2.20Å	0.31	0.23	Probable 5'-phosphoribosylglycinamide formyltransferase purN
4ds3.1.A	16.47	homo-dimer	HHblits	X-ray	1.85Å	0.29	0.23	Phosphoribosylglycinamide formyltransferase
3nrb.1.A	16.67	homo-tetramer	HHblits	X-ray	2.05Å	0.29	0.23	Formyltetrahydrofolate deformylase
3p9x.1.A	17.65	homo-dimer	HHblits	X-ray	1.90Å	0.28	0.23	phosphoribosylglycinamide formyltransferase
3av3.1.A	16.47	monomer	HHblits	X-ray	1.70Å	0.27	0.23	Phosphoribosylglycinamide formyltransferase
3o1l.1.A	9.52	homo-dimer	HHblits	X-ray	2.20Å	0.28	0.23	Formyltetrahydrofolate deformylase
3w7b.1.A	13.10	homo-tetramer	HHblits	X-ray	2.71Å	0.28	0.23	Formyltetrahydrofolate deformylase
3lou.1.A	15.48	homo-tetramer	HHblits	X-ray	1.90Å	0.28	0.23	Formyltetrahydrofolate deformylase
3lou.1.B	15.48	homo-tetramer	HHblits	X-ray	1.90Å	0.28	0.23	Formyltetrahydrofolate deformylase
5cjj.1.A	9.41	homo-dimer	HHblits	X-ray	2.42Å	0.26	0.23	Phosphoribosylglycinamide formyltransferase
5cjj.1.B	9.41	homo-dimer	HHblits	X-ray	2.42Å	0.26	0.23	Phosphoribosylglycinamide formyltransferase
2ywr.1.A	15.66	monomer	HHblits	X-ray	1.77Å	0.27	0.23	Phosphoribosylglycinamide formyltransferase
3n0v.1.A	8.33	homo-tetramer	HHblits	X-ray	2.25Å	0.26	0.23	Formyltetrahydrofolate deformylase
9atc.1.A	17.07	hetero-oligomer	HHblits	X-ray	2.40Å	0.28	0.23	ASPARTATE TRANSCARBAMOYLASE
1r0b.1.A	17.07	hetero-oligomer	HHblits	X-ray	2.90Å	0.28	0.23	Aspartate carbamoyltransferase catalytic chain
1za2.1.A	17.07	hetero-oligomer	HHblits	X-ray	2.50Å	0.28	0.23	Aspartate carbamoyltransferase catalytic chain
1za2.1.C	17.07	hetero-oligomer	HHblits	X-ray	2.50Å	0.28	0.23	Aspartate carbamoyltransferase catalytic chain
1za1.1.A	17.07	hetero-oligomer	HHblits	X-ray	2.20Å	0.28	0.23	Aspartate carbamoyltransferase catalytic chain
1za1.1.C	17.07	hetero-oligomer	HHblits	X-ray	2.20Å	0.28	0.23	Aspartate carbamoyltransferase catalytic chain
3d7s.1.A	17.07	hetero-oligomer	HHblits	X-ray	2.80Å	0.28	0.23	Aspartate carbamoyltransferase catalytic chain
3d7s.1.C	17.07	hetero-oligomer	HHblits	X-ray	2.80Å	0.28	0.23	Aspartate carbamoyltransferase catalytic chain
3csu.1.A	17.07	homo-trimer	HHblits	X-ray	1.88Å	0.28	0.23	PROTEIN (ASPARTATE CARBAMOYLTRANSFERASE)
3csu.1.B	17.07	homo-trimer	HHblits	X-ray	1.88Å	0.28	0.23	PROTEIN (ASPARTATE CARBAMOYLTRANSFERASE)
2qg9.1.A	17.07	hetero-oligomer	HHblits	X-ray	2.70Å	0.28	0.23	Aspartate carbamoyltransferase catalytic chain
2qg9.1.C	17.07	hetero-oligomer	HHblits	X-ray	2.70Å	0.28	0.23	Aspartate carbamoyltransferase catalytic chain
2qgf.1.A	17.07	hetero-oligomer	HHblits	X-ray	2.20Å	0.28	0.23	Aspartate carbamoyltransferase catalytic chain
2qgf.1.C	17.07	hetero-oligomer	HHblits	X-ray	2.20Å	0.28	0.23	Aspartate carbamoyltransferase catalytic chain
2air.1.A	17.07	hetero-oligomer	HHblits	X-ray	2.00Å	0.28	0.23	Aspartate carbamoyltransferase catalytic chain
4fyv.1.C	17.07	hetero-oligomer	HHblits	X-ray	2.10Å	0.28	0.23	Aspartate carbamoyltransferase catalytic chain
4fyv.1.A	17.07	hetero-oligomer	HHblits	X-ray	2.10Å	0.28	0.23	Aspartate carbamoyltransferase catalytic chain
2fzg.1.A	17.07	hetero-oligomer	HHblits	X-ray	2.25Å	0.28	0.23	Aspartate carbamoyltransferase catalytic chain
2fzg.1.C	17.07	hetero-oligomer	HHblits	X-ray	2.25Å	0.28	0.23	Aspartate carbamoyltransferase catalytic chain
1rac.1.A	17.07	hetero-oligomer	HHblits	X-ray	2.50Å	0.28	0.23	Aspartate carbamoyltransferase catalytic chain
1raf.1.C	17.07	hetero-oligomer	HHblits	X-ray	2.50Å	0.28	0.23	Aspartate carbamoyltransferase catalytic chain
1i5o.1.A	17.07	hetero-oligomer	HHblits	X-ray	2.80Å	0.28	0.23	ASPARTATE TRANSCARBAMOYLASE CATALYTIC CHAIN
1i5o.1.C	17.07	hetero-oligomer	HHblits	X-ray	2.80Å	0.28	0.23	ASPARTATE TRANSCARBAMOYLASE CATALYTIC CHAIN
5vmq.1.B	17.07	homo-trimer	HHblits	X-ray	2.01Å	0.28	0.23	Aspartate carbamoyltransferase
5vmq.1.C	17.07	homo-trimer	HHblits	X-ray	2.01Å	0.28	0.23	Aspartate carbamoyltransferase
5vmq.1.A	17.07	homo-trimer	HHblits	X-ray	2.01Å	0.28	0.23	Aspartate carbamoyltransferase
3auf.1.A	14.46	homo-dimer	HHblits	X-ray	2.07Å	0.26	0.23	Glycinamide ribonucleotide transformylase 1
2ywx.1.A	17.72	homo-octamer	HHblits	X-ray	2.31Å	0.29	0.22	Phosphoribosylaminoimidazole carboxylase catalytic subunit
3kcq.1.A	17.95	homo-dimer	HHblits	X-ray	2.20Å	0.29	0.22	Phosphoribosylglycinamide formyltransferase
3kcq.1.B	17.95	homo-dimer	HHblits	X-ray	2.20Å	0.29	0.22	Phosphoribosylglycinamide formyltransferase
4npa.1.A	16.46	homo-tetramer	HHblits	X-ray	2.10Å	0.28	0.22	Putative uncharacterized protein
3gh1.1.A	15.19	homo-tetramer	HHblits	X-ray	1.90Å	0.28	0.22	Predicted nucleotide-binding protein
3gh1.1.B	15.19	homo-tetramer	HHblits	X-ray	1.90Å	0.28	0.22	Predicted nucleotide-binding protein
4e2f.1.A	16.22	hetero-oligomer	HHblits	X-ray	2.80Å	0.28	0.20	Aspartate carbamoyltransferase catalytic chain
1acm.1.A	17.57	hetero-oligomer	HHblits	X-ray	2.80Å	0.28	0.20	ASPARTATE CARBAMOYLTRANSFERASE, CATALYTIC CHAIN
1sku.1.A	16.22	hetero-oligomer	HHblits	X-ray	2.60Å	0.28	0.20	Aspartate carbamoyltransferase catalytic chain
1sku.1.C	16.22	hetero-oligomer	HHblits	X-ray	2.60Å	0.28	0.20	Aspartate carbamoyltransferase catalytic chain
2hse.1.A	16.22	hetero-oligomer	HHblits	X-ray	2.60Å	0.28	0.20	Aspartate carbamoyltransferase catalytic chain
2a0f.1.C	16.22	hetero-oligomer	HHblits	X-ray	2.90Å	0.28	0.20	Aspartate carbamoyltransferase catalytic chain
2a0f.1.A	16.22	hetero-oligomer	HHblits	X-ray	2.90Å	0.28	0.20	Aspartate carbamoyltransferase catalytic chain
2iz6.1.A	13.04	homo-tetramer	HHblits	X-ray	1.60Å	0.26	0.19	MOLYBDENUM COFACTOR CARRIER PROTEIN
2iz5.1.A	13.04	homo-tetramer	HHblits	X-ray	2.29Å	0.26	0.19	MOCO CARRIER PROTEIN
2iz5.1.C	13.04	homo-tetramer	HHblits	X-ray	2.29Å	0.26	0.19	MOCO CARRIER PROTEIN
3ngl.1.A	12.31	homo-dimer	HHblits	X-ray	2.40Å	0.26	0.18	Bifunctional protein folD
3ceh.1.A	14.52	homo-dimer	HHblits	X-ray	2.80Å	0.27	0.17	Glycogen phosphorylase, liver form
2qip.1.A	10.17	homo-dimer	HHblits	X-ray	1.48Å	0.27	0.16	Protein of unknown function VPA0982
3afo.1.A	14.04	homo-tetramer	HHblits	X-ray	2.00Å	0.29	0.16	NADH kinase POS5
3afo.1.B	14.04	homo-tetramer	HHblits	X-ray	2.00Å	0.29	0.16	NADH kinase POS5
3pfn.1.A	6.90	homo-tetramer	HHblits	X-ray	2.70Å	0.28	0.16	NAD kinase
3mcu.1.A	16.95	homo-hexamer	HHblits	X-ray	2.30Å	0.26	0.16	Dipicolinate synthase, B chain
3mcu.1.E	16.95	homo-hexamer	HHblits	X-ray	2.30Å	0.26	0.16	Dipicolinate synthase, B chain
4ldz.1.A	17.24	homo-dimer	HHblits	X-ray	2.31Å	0.27	0.16	Transcriptional regulatory protein DesR
4ldz.1.B	17.24	homo-dimer	HHblits	X-ray	2.31Å	0.27	0.16	Transcriptional regulatory protein DesR
1yt5.1.B	15.38	homo-dimer	HHblits	X-ray	2.30Å	0.29	0.14	inorganic polyphosphate/ATP-NAD kinase
1yt5.1.A	15.38	homo-dimer	HHblits	X-ray	2.30Å	0.29	0.14	inorganic polyphosphate/ATP-NAD kinase
1yt5.2.B	15.38	homo-dimer	HHblits	X-ray	2.30Å	0.29	0.14	inorganic polyphosphate/ATP-NAD kinase
3io5.1.A	15.69	homo-dimer	HHblits	X-ray	2.40Å	0.28	0.14	Recombination and repair protein
4cjx.1.A	19.57	homo-dimer	HHblits	X-ray	2.05Å	0.32	0.13	C-1-TETRAHYDROFOLATE SYNTHASE, CYTOPLASMIC, PUTATIVE
4cjx.1.B	19.57	homo-dimer	HHblits	X-ray	2.05Å	0.32	0.13	C-1-TETRAHYDROFOLATE SYNTHASE, CYTOPLASMIC, PUTATIVE
4a5o.1.A	17.39	homo-dimer	HHblits	X-ray	2.20Å	0.30	0.13	BIFUNCTIONAL PROTEIN FOLD
4a5o.2.B	17.39	homo-dimer	HHblits	X-ray	2.20Å	0.30	0.13	BIFUNCTIONAL PROTEIN FOLD
2c2y.1.A	10.87	homo-dimer	HHblits	X-ray	2.30Å	0.28	0.13	METHYLENETETRAHYDROFOLATE DEHYDROGENASE-METHENYLTETRAHYDROFOLATE CYCLOHYDROLASE
2c2x.1.B	10.87	homo-dimer	HHblits	X-ray	2.00Å	0.28	0.13	METHYLENETETRAHYDROFOLATE DEHYDROGENASE-METHENYLTETRAHYDROFOLATE CYCLOHYDROLASE
3q7s.1.A	14.89	homo-dimer	HHblits	X-ray	2.10Å	0.26	0.13	Transcriptional regulatory protein
3q7s.1.B	14.89	homo-dimer	HHblits	X-ray	2.10Å	0.26	0.13	Transcriptional regulatory protein
3q7t.1.A	14.89	homo-dimer	HHblits	X-ray	2.15Å	0.26	0.13	Transcriptional regulatory protein
3q7t.1.B	14.89	homo-dimer	HHblits	X-ray	2.15Å	0.26	0.13	Transcriptional regulatory protein
1dia.1.A	13.04	homo-dimer	HHblits	X-ray	2.20Å	0.27	0.13	METHYLENETETRAHYDROFOLATE DEHYDROGENASE/CYCLOHYDROLASE
1dia.1.B	13.04	homo-dimer	HHblits	X-ray	2.20Å	0.27	0.13	METHYLENETETRAHYDROFOLATE DEHYDROGENASE/CYCLOHYDROLASE
4x7g.1.A	20.93	monomer	HHblits	X-ray	1.22Å	0.29	0.12	Precorrin-6A reductase
5c4n.1.A	20.93	monomer	HHblits	X-ray	1.63Å	0.29	0.12	Precorrin-6A reductase
5h98.1.A	16.28	monomer	HHblits	X-ray	2.04Å	0.28	0.12	Geobacter metallireducens SMUG1
5h99.1.A	16.28	monomer	HHblits	X-ray	2.50Å	0.28	0.12	Geobacter metallireducens SMUG1
5h93.1.A	16.28	monomer	HHblits	X-ray	2.18Å	0.28	0.12	Geobacter metallireducens SMUG1
5h9i.1.A	16.28	monomer	HHblits	X-ray	1.50Å	0.28	0.12	Geobacter metallireducens SMUG1
1u6k.1.A	24.39	homo-hexamer	HHblits	X-ray	1.55Å	0.32	0.11	F420-dependent methylenetetrahydromethanopterin dehydrogenase
2asv.1.A	13.95	homo-dimer	HHblits	X-ray	1.95Å	0.28	0.12	Maltodextrin phosphorylase
2azd.1.A	13.95	homo-dimer	HHblits	X-ray	2.16Å	0.28	0.12	Maltodextrin phosphorylase
5c4r.1.A	21.95	monomer	HHblits	X-ray	3.17Å	0.32	0.11	Precorrin-6A reductase
4x7g.1.A	21.95	monomer	HHblits	X-ray	1.22Å	0.32	0.11	Precorrin-6A reductase
5c4n.1.A	21.95	monomer	HHblits	X-ray	1.63Å	0.32	0.11	Precorrin-6A reductase
3h5t.1.A	19.51	monomer	HHblits	X-ray	2.53Å	0.31	0.11	Transcriptional regulator, LacI family
1u6k.1.A	17.07	homo-hexamer	HHblits	X-ray	1.55Å	0.30	0.11	F420-dependent methylenetetrahydromethanopterin dehydrogenase
3ket.1.A	18.60	homo-dimer	HHblits	X-ray	2.40Å	0.26	0.12	Redox-sensing transcriptional repressor rex
3keo.1.B	18.60	homo-dimer	HHblits	X-ray	1.50Å	0.26	0.12	Redox-sensing transcriptional repressor rex
3keo.1.A	18.60	homo-dimer	HHblits	X-ray	1.50Å	0.26	0.12	Redox-sensing transcriptional repressor rex
3keq.1.A	18.60	homo-dimer	HHblits	X-ray	2.40Å	0.26	0.12	Redox-sensing transcriptional repressor rex
3keq.1.B	18.60	homo-dimer	HHblits	X-ray	2.40Å	0.26	0.12	Redox-sensing transcriptional repressor rex
2ahd.1.A	27.50	monomer	HHblits	X-ray	3.00Å	0.32	0.11	Phosphodiesterase MJ0936
4rap.1.A	11.90	homo-12-mer	HHblits	X-ray	2.88Å	0.27	0.12	Glycosyltransferase TibC
3bil.1.A	14.63	homo-dimer	HHblits	X-ray	2.50Å	0.29	0.11	Probable LacI-family transcriptional regulator
3k4h.1.A	9.52	homo-dimer	HHblits	X-ray	2.80Å	0.27	0.12	putative transcriptional regulator
3k4h.1.B	9.52	homo-dimer	HHblits	X-ray	2.80Å	0.27	0.12	putative transcriptional regulator
1rzr.1.C	20.00	hetero-oligomer	HHblits	X-ray	2.80Å	0.29	0.11	Glucose-resistance amylase regulator
1rzr.1.D	20.00	hetero-oligomer	HHblits	X-ray	2.80Å	0.29	0.11	Glucose-resistance amylase regulator
1rzr.2.C	20.00	hetero-oligomer	HHblits	X-ray	2.80Å	0.29	0.11	Glucose-resistance amylase regulator
1rzr.2.D	20.00	hetero-oligomer	HHblits	X-ray	2.80Å	0.29	0.11	Glucose-resistance amylase regulator
2hsg.1.A	20.00	monomer	HHblits	X-ray	2.50Å	0.29	0.11	Glucose-resistance amylase regulator
3hcw.1.A	12.20	homo-dimer	HHblits	X-ray	2.20Å	0.26	0.11	Maltose operon transcriptional repressor
3hcw.1.B	12.20	homo-dimer	HHblits	X-ray	2.20Å	0.26	0.11	Maltose operon transcriptional repressor
1c30.1.A	27.03	hetero-oligomer	HHblits	X-ray	2.00Å	0.34	0.10	CARBAMOYL PHOSPHATE SYNTHETASE: LARGE SUBUNIT
1bxr.1.A	27.03	hetero-oligomer	HHblits	X-ray	2.10Å	0.34	0.10	CARBAMOYL-PHOSPHATE SYNTHASE
1a9x.1.A	27.03	hetero-oligomer	HHblits	X-ray	1.80Å	0.34	0.10	CARBAMOYL PHOSPHATE SYNTHETASE (LARGE CHAIN)
1m6v.1.A	27.03	hetero-oligomer	HHblits	X-ray	2.10Å	0.34	0.10	carbamoyl phosphate synthetase large chain
2oen.1.A	20.51	hetero-oligomer	HHblits	X-ray	3.17Å	0.29	0.11	Catabolite control protein
1sxi.1.B	20.51	homo-dimer	HHblits	X-ray	3.00Å	0.29	0.11	Glucose-resistance amylase regulator
1sxi.2.A	20.51	homo-dimer	HHblits	X-ray	3.00Å	0.29	0.11	Glucose-resistance amylase regulator
1sxi.2.B	20.51	homo-dimer	HHblits	X-ray	3.00Å	0.29	0.11	Glucose-resistance amylase regulator
1sxi.3.A	20.51	homo-dimer	HHblits	X-ray	3.00Å	0.29	0.11	Glucose-resistance amylase regulator
1sxi.3.B	20.51	homo-dimer	HHblits	X-ray	3.00Å	0.29	0.11	Glucose-resistance amylase regulator
1sxi.4.A	20.51	homo-dimer	HHblits	X-ray	3.00Å	0.29	0.11	Glucose-resistance amylase regulator
1sxi.4.B	20.51	homo-dimer	HHblits	X-ray	3.00Å	0.29	0.11	Glucose-resistance amylase regulator
1sxi.5.A	20.51	homo-dimer	HHblits	X-ray	3.00Å	0.29	0.11	Glucose-resistance amylase regulator
1sxi.5.B	20.51	homo-dimer	HHblits	X-ray	3.00Å	0.29	0.11	Glucose-resistance amylase regulator
1sxi.6.A	20.51	homo-dimer	HHblits	X-ray	3.00Å	0.29	0.11	Glucose-resistance amylase regulator
1sxi.6.B	20.51	homo-dimer	HHblits	X-ray	3.00Å	0.29	0.11	Glucose-resistance amylase regulator
1sxh.1.A	20.51	homo-dimer	HHblits	X-ray	2.75Å	0.29	0.11	Glucose-resistance amylase regulator
1sxh.1.B	20.51	homo-dimer	HHblits	X-ray	2.75Å	0.29	0.11	Glucose-resistance amylase regulator
1sxg.1.A	20.51	homo-dimer	HHblits	X-ray	2.75Å	0.29	0.11	Glucose-resistance amylase regulator
1sxg.1.B	20.51	homo-dimer	HHblits	X-ray	2.75Å	0.29	0.11	Glucose-resistance amylase regulator
1sxg.2.A	20.51	homo-dimer	HHblits	X-ray	2.75Å	0.29	0.11	Glucose-resistance amylase regulator
1sxg.2.B	20.51	homo-dimer	HHblits	X-ray	2.75Å	0.29	0.11	Glucose-resistance amylase regulator
1sxg.3.A	20.51	homo-dimer	HHblits	X-ray	2.75Å	0.29	0.11	Glucose-resistance amylase regulator
1sxg.3.B	20.51	homo-dimer	HHblits	X-ray	2.75Å	0.29	0.11	Glucose-resistance amylase regulator
1sxi.1.A	20.51	homo-dimer	HHblits	X-ray	3.00Å	0.29	0.11	Glucose-resistance amylase regulator
2nzu.1.A	20.51	hetero-oligomer	HHblits	X-ray	2.50Å	0.29	0.11	Catabolite control protein
3huu.1.A	12.50	homo-dimer	HHblits	X-ray	1.95Å	0.27	0.11	Transcription regulator like protein
3aer.1.B	22.22	hetero-oligomer	HHblits	X-ray	2.80Å	0.35	0.10	Light-independent protochlorophyllide reductase subunit B
3aeq.1.B	22.22	hetero-oligomer	HHblits	X-ray	2.90Å	0.35	0.10	Light-independent protochlorophyllide reductase subunit B
3aek.1.B	22.22	hetero-oligomer	HHblits	X-ray	2.30Å	0.35	0.10	Light-independent protochlorophyllide reductase subunit B
3aeu.1.B	22.22	hetero-oligomer	HHblits	X-ray	2.90Å	0.35	0.10	Light-independent protochlorophyllide reductase subunit B
3aet.1.B	22.22	hetero-oligomer	HHblits	X-ray	2.91Å	0.35	0.10	Light-independent protochlorophyllide reductase subunit B
3kke.1.B	17.95	homo-dimer	HHblits	X-ray	2.20Å	0.29	0.11	LacI family Transcriptional regulator
3kke.1.A	17.95	homo-dimer	HHblits	X-ray	2.20Å	0.29	0.11	LacI family Transcriptional regulator
1z2w.1.A	15.00	monomer	HHblits	X-ray	2.00Å	0.27	0.11	Vacuolar protein sorting 29
1z2w.2.A	15.00	monomer	HHblits	X-ray	2.00Å	0.27	0.11	Vacuolar protein sorting 29
3pso.1.A	15.00	monomer	HHblits	X-ray	3.20Å	0.27	0.11	Vacuolar protein sorting-associated protein 29
1w24.1.A	15.00	monomer	HHblits	X-ray	2.10Å	0.27	0.11	VACUOLAR PROTEIN SORTING PROTEIN 29
3gv0.1.A	20.51	monomer	HHblits	X-ray	2.35Å	0.28	0.11	Transcriptional regulator, LacI family
3bbl.1.A	10.00	homo-dimer	HHblits	X-ray	2.35Å	0.26	0.11	Regulatory protein of LacI family
1d3a.1.D	9.76	homo-tetramer	HHblits	X-ray	2.94Å	0.24	0.11	HALOPHILIC MALATE DEHYDROGENASE
1hlp.1.A	9.76	homo-dimer	HHblits	X-ray	3.20Å	0.24	0.11	MALATE DEHYDROGENASE
3qk7.1.A	10.00	homo-dimer	HHblits	X-ray	2.70Å	0.26	0.11	Transcriptional regulators
3qk7.2.A	10.00	homo-dimer	HHblits	X-ray	2.70Å	0.26	0.11	Transcriptional regulators
3qk7.2.B	10.00	homo-dimer	HHblits	X-ray	2.70Å	0.26	0.11	Transcriptional regulators
5dou.1.A	25.00	homo-dimer	HHblits	X-ray	2.60Å	0.34	0.10	Carbamoyl-phosphate synthase [ammonia], mitochondrial
5dot.1.A	25.00	homo-dimer	HHblits	X-ray	2.40Å	0.34	0.10	Carbamoyl-phosphate synthase [ammonia], mitochondrial
3wgi.1.B	15.00	homo-dimer	HHblits	X-ray	3.25Å	0.26	0.11	Redox-sensing transcriptional repressor rex
3wg9.2.A	15.00	homo-dimer	HHblits	X-ray	1.97Å	0.26	0.11	Redox-sensing transcriptional repressor rex
3wg9.2.B	15.00	homo-dimer	HHblits	X-ray	1.97Å	0.26	0.11	Redox-sensing transcriptional repressor rex
3wgh.1.B	15.00	homo-dimer	HHblits	X-ray	2.05Å	0.26	0.11	Redox-sensing transcriptional repressor rex
3wgg.1.A	15.00	homo-dimer	HHblits	X-ray	2.10Å	0.26	0.11	Redox-sensing transcriptional repressor rex
3wgg.1.B	15.00	homo-dimer	HHblits	X-ray	2.10Å	0.26	0.11	Redox-sensing transcriptional repressor rex
4la4.1.A	21.05	homo-tetramer	HHblits	X-ray	2.07Å	0.30	0.10	NAD(P)H dehydrogenase (quinone)
4laf.1.D	21.05	homo-tetramer	HHblits	X-ray	1.76Å	0.30	0.10	NAD(P)H dehydrogenase (quinone)
5b51.1.A	18.42	monomer	HHblits	X-ray	1.30Å	0.30	0.10	ABC-type transporter, periplasmic component
5b4z.1.A	18.42	monomer	HHblits	X-ray	1.30Å	0.30	0.10	ABC-type transporter, periplasmic component
5b50.1.A	18.42	monomer	HHblits	X-ray	1.65Å	0.30	0.10	ABC-type transporter, periplasmic component
1vdm.1.B	21.05	homo-12-mer	HHblits	X-ray	2.50Å	0.29	0.10	purine phosphoribosyltransferase
1vdm.1.A	21.05	homo-12-mer	HHblits	X-ray	2.50Å	0.29	0.10	purine phosphoribosyltransferase
1vdm.1.E	21.05	homo-12-mer	HHblits	X-ray	2.50Å	0.29	0.10	purine phosphoribosyltransferase
1c30.1.A	18.92	hetero-oligomer	HHblits	X-ray	2.00Å	0.32	0.10	CARBAMOYL PHOSPHATE SYNTHETASE: LARGE SUBUNIT
1bxr.1.A	18.92	hetero-oligomer	HHblits	X-ray	2.10Å	0.32	0.10	CARBAMOYL-PHOSPHATE SYNTHASE
1a9x.1.A	18.92	hetero-oligomer	HHblits	X-ray	1.80Å	0.32	0.10	CARBAMOYL PHOSPHATE SYNTHETASE (LARGE CHAIN)
1m6v.1.A	18.92	hetero-oligomer	HHblits	X-ray	2.10Å	0.31	0.10	carbamoyl phosphate synthetase large chain
2fxv.1.A	10.26	homo-dimer	HHblits	X-ray	2.05Å	0.27	0.11	Xanthine phosphoribosyltransferase
2fxv.1.B	10.26	homo-dimer	HHblits	X-ray	2.05Å	0.27	0.11	Xanthine phosphoribosyltransferase
4dy4.1.A	23.68	homo-tetramer	HHblits	X-ray	1.20Å	0.29	0.10	Flavoprotein wrbA
5f12.1.B	23.68	homo-tetramer	HHblits	X-ray	1.50Å	0.29	0.10	NAD(P)H dehydrogenase (quinone)
3b6k.1.A	23.68	homo-tetramer	HHblits	X-ray	1.99Å	0.29	0.10	Flavoprotein wrbA
3b6m.1.A	23.68	homo-tetramer	HHblits	X-ray	1.85Å	0.29	0.10	Flavoprotein wrbA
2r97.1.A	23.68	homo-tetramer	HHblits	X-ray	2.00Å	0.29	0.10	Flavoprotein WrbA
2r97.1.B	23.68	homo-tetramer	HHblits	X-ray	2.00Å	0.29	0.10	Flavoprotein WrbA
2rg1.1.A	23.68	homo-tetramer	HHblits	X-ray	1.85Å	0.29	0.10	Flavoprotein WrbA
2rg1.1.B	23.68	homo-tetramer	HHblits	X-ray	1.85Å	0.29	0.10	Flavoprotein WrbA
4rb4.1.A	10.26	homo-12-mer	HHblits	X-ray	3.88Å	0.27	0.11	Glycosyltransferase tibC
4l9r.1.A	23.68	homo-tetramer	HHblits	X-ray	1.95Å	0.29	0.10	Inositol 2-dehydrogenase/D-chiro-inositol 3-dehydrogenase
3i12.1.A	13.51	homo-dimer	HHblits	X-ray	2.20Å	0.31	0.10	D-alanine-D-alanine ligase A
3i12.1.B	13.51	homo-dimer	HHblits	X-ray	2.20Å	0.31	0.10	D-alanine-D-alanine ligase A
3i12.2.A	13.51	homo-dimer	HHblits	X-ray	2.20Å	0.31	0.10	D-alanine-D-alanine ligase A
4rap.1.A	10.26	homo-12-mer	HHblits	X-ray	2.88Å	0.27	0.11	Glycosyltransferase TibC
1jhz.1.A	7.69	homo-dimer	HHblits	X-ray	2.40Å	0.27	0.11	PURINE NUCLEOTIDE SYNTHESIS REPRESSOR
1jhz.1.B	7.69	homo-dimer	HHblits	X-ray	2.40Å	0.27	0.11	PURINE NUCLEOTIDE SYNTHESIS REPRESSOR
1o6z.1.A	10.00	homo-tetramer	HHblits	X-ray	1.95Å	0.25	0.11	MALATE DEHYDROGENASE
5ax7.1.A	25.00	homo-dimer	HHblits	X-ray	2.46Å	0.33	0.10	Pyruvyl transferase 1
3gid.1.A	15.38	monomer	HHblits	X-ray	2.30Å	0.26	0.11	Acetyl-CoA carboxylase 2
3gid.2.A	15.38	monomer	HHblits	X-ray	2.30Å	0.26	0.11	Acetyl-CoA carboxylase 2
3glk.1.A	15.38	monomer	HHblits	X-ray	2.10Å	0.26	0.11	Acetyl-CoA carboxylase 2
5kkn.2.A	15.38	monomer	HHblits	X-ray	2.60Å	0.26	0.11	Acetyl-CoA carboxylase 2
5kkn.1.A	15.38	monomer	HHblits	X-ray	2.60Å	0.26	0.11	Acetyl-CoA carboxylase 2
2jky.1.A	18.92	homo-dimer	HHblits	X-ray	2.30Å	0.30	0.10	HYPOXANTHINE-GUANINE PHOSPHORIBOSYLTRANSFERASE
2jky.1.B	18.92	homo-dimer	HHblits	X-ray	2.30Å	0.30	0.10	HYPOXANTHINE-GUANINE PHOSPHORIBOSYLTRANSFERASE
1rcu.1.A	25.00	homo-tetramer	HHblits	X-ray	2.50Å	0.32	0.10	conserved hypothetical protein VT76
5xcj.1.A	10.00	monomer	HHblits	X-ray	1.86Å	0.24	0.11	Vacuolar protein sorting-associated protein 29
5xcj.2.A	10.00	monomer	HHblits	X-ray	1.86Å	0.24	0.11	Vacuolar protein sorting-associated protein 29
3r5f.1.A	13.51	homo-dimer	HHblits	X-ray	2.07Å	0.30	0.10	D-alanine--D-alanine ligase 1
5az3.1.A	18.92	monomer	HHblits	X-ray	1.42Å	0.30	0.10	ABC-type transporter, periplasmic component
3e5n.1.A	13.51	homo-dimer	HHblits	X-ray	2.00Å	0.29	0.10	D-alanine-D-alanine ligase A
2a33.1.A	22.22	homo-dimer	HHblits	X-ray	1.95Å	0.31	0.10	hypothetical protein
2q4o.1.B	22.22	homo-dimer	HHblits	X-ray	1.95Å	0.31	0.10	Uncharacterized protein At2g37210/T2N18.3
1dbq.1.A	7.89	homo-dimer	HHblits	X-ray	2.20Å	0.27	0.10	PURINE REPRESSOR
1dbq.1.B	7.89	homo-dimer	HHblits	X-ray	2.20Å	0.27	0.10	PURINE REPRESSOR
4fdc.1.A	26.47	monomer	HHblits	X-ray	2.40Å	0.36	0.09	Apoptosis-inducing factor 1, mitochondrial
5fs7.1.A	26.47	monomer	HHblits	X-ray	1.85Å	0.36	0.09	APOPTOSIS-INDUCING FACTOR 1, MITOCHONDRIAL
5fs9.1.A	26.47	monomer	HHblits	X-ray	1.75Å	0.36	0.09	APOPTOSIS-INDUCING FACTOR 1, MITOCHONDRIAL
3gd3.1.A	26.47	monomer	HHblits	X-ray	2.95Å	0.36	0.09	Apoptosis-inducing factor 1, mitochondrial
3gd3.2.A	26.47	monomer	HHblits	X-ray	2.95Å	0.36	0.09	Apoptosis-inducing factor 1, mitochondrial
3gd3.4.A	26.47	monomer	HHblits	X-ray	2.95Å	0.36	0.09	Apoptosis-inducing factor 1, mitochondrial
5fs8.1.A	26.47	monomer	HHblits	X-ray	1.40Å	0.36	0.09	APOPTOSIS-INDUCING FACTOR 1, MITOCHONDRIAL
3gd4.1.A	26.47	homo-dimer	HHblits	X-ray	2.24Å	0.36	0.09	Apoptosis-inducing factor 1, mitochondrial
3gd4.1.B	26.47	homo-dimer	HHblits	X-ray	2.24Å	0.36	0.09	Apoptosis-inducing factor 1, mitochondrial
5fmh.1.A	26.47	monomer	HHblits	X-ray	1.80Å	0.36	0.09	APOPTOSIS-INDUCING FACTOR 1, MITOCHONDRIAL
1gv4.1.A	26.47	monomer	HHblits	X-ray	2.00Å	0.36	0.09	PROGRAMED CELL DEATH PROTEIN 8
5miu.1.A	26.47	monomer	HHblits	X-ray	3.50Å	0.36	0.09	Apoptosis-inducing factor 1, mitochondrial
5miv.1.A	26.47	homo-dimer	HHblits	X-ray	3.10Å	0.36	0.09	Apoptosis-inducing factor 1, mitochondrial
5miv.1.B	26.47	homo-dimer	HHblits	X-ray	3.10Å	0.36	0.09	Apoptosis-inducing factor 1, mitochondrial
1akq.1.A	21.62	monomer	HHblits	X-ray	1.90Å	0.29	0.10	FLAVODOXIN
1f4p.1.A	21.62	monomer	HHblits	X-ray	1.30Å	0.29	0.10	FLAVODOXIN
4lza.1.A	13.16	homo-dimer	HHblits	X-ray	1.84Å	0.27	0.10	Adenine phosphoribosyltransferase
1ker.1.A	32.35	homo-dimer	HHblits	X-ray	2.20Å	0.35	0.09	dTDP-D-glucose 4,6-dehydratase
4rie.1.A	31.43	homo-dimer	HHblits	X-ray	2.16Å	0.33	0.10	Glycosyl transferase homolog
4rie.1.B	31.43	homo-dimer	HHblits	X-ray	2.16Å	0.33	0.10	Glycosyl transferase homolog
4rif.1.A	31.43	homo-dimer	HHblits	X-ray	1.85Å	0.33	0.10	Glycosyl transferase homolog
4rif.1.B	31.43	homo-dimer	HHblits	X-ray	1.85Å	0.33	0.10	Glycosyl transferase homolog
5m29.1.A	25.00	monomer	HHblits	X-ray	1.50Å	0.31	0.10	Vitamin B12-binding protein
5m2q.1.A	25.00	monomer	HHblits	X-ray	1.70Å	0.31	0.10	Outer membrane protein A,Vitamin B12-binding protein
2q5c.1.A	18.42	monomer	HHblits	X-ray	1.49Å	0.26	0.10	NtrC family transcriptional regulator
2v4n.1.A	19.44	homo-dimer	HHblits	X-ray	1.70Å	0.31	0.10	MULTIFUNCTIONAL PROTEIN SUR E
3koy.1.A	19.44	hetero-oligomer	HHblits	X-ray	2.80Å	0.31	0.10	D-ornithine aminomutase E component
3kp0.4.A	19.44	hetero-oligomer	HHblits	X-ray	2.80Å	0.31	0.10	D-ornithine aminomutase E component
2qk4.1.A	10.53	monomer	HHblits	X-ray	2.45Å	0.26	0.10	Trifunctional purine biosynthetic protein adenosine-3
1akt.1.A	18.92	monomer	HHblits	X-ray	1.80Å	0.28	0.10	FLAVODOXIN
4bur.1.A	23.53	monomer	HHblits	X-ray	2.88Å	0.35	0.09	APOPTOSIS INDUCING FACTOR 1, MITOCHONDRIAL
4bur.3.A	23.53	monomer	HHblits	X-ray	2.88Å	0.35	0.09	APOPTOSIS INDUCING FACTOR 1, MITOCHONDRIAL
4lii.1.A	23.53	monomer	HHblits	X-ray	1.88Å	0.35	0.09	Apoptosis-inducing factor 1, mitochondrial
5b6h.1.A	15.79	homo-dimer	HHblits	X-ray	1.90Å	0.26	0.10	Adenine phosphoribosyltransferase
4mb6.1.A	15.79	homo-dimer	HHblits	X-ray	1.81Å	0.26	0.10	Adenine phosphoribosyltransferase
3bq9.1.A	25.71	homo-tetramer	HHblits	X-ray	1.80Å	0.32	0.10	Predicted Rossmann fold nucleotide-binding domain-containing protein
4rk6.1.A	12.82	homo-dimer	HHblits	X-ray	1.76Å	0.24	0.11	Glucose-resistance amylase regulator
1l1q.1.A	13.16	homo-dimer	HHblits	X-ray	1.85Å	0.26	0.10	Adenine phosphoribosyltransferase
2wqk.1.A	22.86	homo-tetramer	HHblits	X-ray	1.50Å	0.32	0.10	5'-NUCLEOTIDASE SURE
3cwc.1.A	17.14	homo-dimer	HHblits	X-ray	2.23Å	0.32	0.10	Putative glycerate kinase 2
3cwc.1.B	17.14	homo-dimer	HHblits	X-ray	2.23Å	0.32	0.10	Putative glycerate kinase 2
5gj3.1.A	20.00	monomer	HHblits	X-ray	2.00Å	0.32	0.10	Periplasmic binding protein
5y8b.1.A	20.00	monomer	HHblits	X-ray	2.40Å	0.32	0.10	Periplasmic binding protein
1ydh.1.A	10.81	homo-dimer	HHblits	X-ray	2.15Å	0.27	0.10	At5g11950
2q4d.1.B	10.81	homo-dimer	HHblits	X-ray	2.15Å	0.27	0.10	Lysine decarboxylase-like protein At5g11950
5b58.1.E	14.29	hetero-oligomer	HHblits	X-ray	3.21Å	0.31	0.10	Putative hemin transport system, substrate-binding protein
5giz.2.A	14.29	monomer	HHblits	X-ray	1.50Å	0.31	0.10	Putative hemin transport system, substrate-binding protein
5y89.2.A	14.29	monomer	HHblits	X-ray	2.40Å	0.31	0.10	Putative hemin transport system, substrate-binding protein
5y8a.2.A	14.29	monomer	HHblits	X-ray	2.00Å	0.31	0.10	Putative hemin transport system, substrate-binding protein
5y8a.1.A	14.29	monomer	HHblits	X-ray	2.00Å	0.31	0.10	Putative hemin transport system, substrate-binding protein
4xh8.1.A	20.00	homo-dimer	HHblits	X-ray	3.56Å	0.31	0.10	5'/3'-nucleotidase SurE
4xep.1.A	20.00	homo-dimer	HHblits	X-ray	1.50Å	0.31	0.10	5'/3'-nucleotidase SurE
4xer.1.A	20.00	homo-dimer	HHblits	X-ray	1.97Å	0.31	0.10	5'/3'-nucleotidase SurE
2v4o.1.A	20.00	homo-dimer	HHblits	X-ray	2.71Å	0.31	0.10	MULTIFUNCTIONAL PROTEIN SUR E
2v4o.1.B	20.00	homo-dimer	HHblits	X-ray	2.71Å	0.31	0.10	MULTIFUNCTIONAL PROTEIN SUR E
2v4o.2.A	20.00	homo-dimer	HHblits	X-ray	2.71Å	0.31	0.10	MULTIFUNCTIONAL PROTEIN SUR E
2v4o.2.B	20.00	homo-dimer	HHblits	X-ray	2.71Å	0.31	0.10	MULTIFUNCTIONAL PROTEIN SUR E
2khz.1.A	20.00	homo-dimer	HHblits	NMR	NA	0.31	0.10	c-Myc-responsive protein Rcl
1n4a.2.A	25.71	monomer	HHblits	X-ray	2.00Å	0.31	0.10	Vitamin B12 transport protein btuF
1n4d.1.A	25.71	monomer	HHblits	X-ray	3.00Å	0.31	0.10	Vitamin B12 transport protein btuF
1n4d.2.A	25.71	monomer	HHblits	X-ray	3.00Å	0.31	0.10	Vitamin B12 transport protein btuF
4dbl.1.E	25.71	hetero-oligomer	HHblits	X-ray	3.49Å	0.31	0.10	Vitamin B12-binding protein
4fi3.1.E	25.71	hetero-oligomer	HHblits	X-ray	3.47Å	0.31	0.10	Vitamin B12-binding protein
1n2z.3.A	25.71	homo-dimer	HHblits	X-ray	2.00Å	0.31	0.10	Vitamin B12 transport protein btuF
2qi9.1.E	25.71	hetero-oligomer	HHblits	X-ray	2.60Å	0.31	0.10	Vitamin B12-binding protein btuF
1n2z.3.B	25.71	homo-dimer	HHblits	X-ray	2.00Å	0.31	0.10	Vitamin B12 transport protein btuF
5m3b.1.A	25.71	monomer	HHblits	X-ray	1.50Å	0.31	0.10	Vitamin B12-binding protein
5m34.1.A	25.71	monomer	HHblits	X-ray	1.60Å	0.31	0.10	Vitamin B12-binding protein
5m34.2.A	25.71	monomer	HHblits	X-ray	1.60Å	0.31	0.10	Vitamin B12-binding protein
4zg5.1.A	16.67	homo-tetramer	HHblits	X-ray	1.90Å	0.29	0.10	5'-nucleotidase SurE
1gso.1.A	13.16	monomer	HHblits	X-ray	1.60Å	0.25	0.10	PROTEIN (GLYCINAMIDE RIBONUCLEOTIDE SYNTHETASE)
3mjf.1.A	13.16	monomer	HHblits	X-ray	1.47Å	0.25	0.10	Phosphoribosylamine--glycine ligase
1j9l.1.A	22.86	homo-dimer	HHblits	X-ray	1.90Å	0.31	0.10	STATIONARY PHASE SURVIVAL PROTEIN
1j9l.1.B	22.86	homo-dimer	HHblits	X-ray	1.90Å	0.31	0.10	STATIONARY PHASE SURVIVAL PROTEIN
1ilv.3.C	22.86	homo-tetramer	HHblits	X-ray	2.00Å	0.31	0.10	STATIONARY-PHASE SURVIVAL PROTEIN SURE HOMOLOG
1l5x.1.A	25.71	homo-dimer	HHblits	X-ray	2.00Å	0.31	0.10	Survival protein E
1l5x.1.B	25.71	homo-dimer	HHblits	X-ray	2.00Å	0.31	0.10	Survival protein E
1ykg.1.A	16.22	monomer	HHblits	NMR	NA	0.27	0.10	Sulfite reductase [NADPH] flavoprotein alpha-component
3nt5.1.A	26.47	homo-tetramer	HHblits	X-ray	2.90Å	0.33	0.09	Inositol 2-dehydrogenase/D-chiro-inositol 3-dehydrogenase
1s2l.1.A	22.86	homo-hexamer	HHblits	X-ray	2.10Å	0.31	0.10	purine trans deoxyribosylase
4m0k.1.A	7.69	homo-dimer	HHblits	X-ray	1.40Å	0.22	0.11	Adenine phosphoribosyltransferase
4m0k.2.B	7.69	homo-dimer	HHblits	X-ray	1.40Å	0.22	0.11	Adenine phosphoribosyltransferase
5n6y.1.B	27.27	hetero-oligomer	HHblits	X-ray	1.35Å	0.35	0.09	Nitrogenase vanadium-iron protein beta chain
5ea2.1.A	13.51	homo-dimer	HHblits	X-ray	2.01Å	0.26	0.10	NAD(P)H dehydrogenase [quinone] 1
5ea2.1.B	13.51	homo-dimer	HHblits	X-ray	2.01Å	0.26	0.10	NAD(P)H dehydrogenase [quinone] 1
5k5z.1.A	8.11	homo-dimer	HHblits	X-ray	2.37Å	0.26	0.10	ParA
5k5z.2.A	8.11	homo-dimer	HHblits	X-ray	2.37Å	0.26	0.10	ParA
5k5z.2.B	8.11	homo-dimer	HHblits	X-ray	2.37Å	0.26	0.10	ParA
3ics.1.A	26.47	homo-dimer	HHblits	X-ray	1.94Å	0.32	0.09	Coenzyme A-Disulfide Reductase
5khl.1.A	16.67	monomer	HHblits	X-ray	2.40Å	0.28	0.10	Hemin ABC transporter, periplasmic hemin-binding protein HutB
3pdi.1.B	21.21	hetero-oligomer	HHblits	X-ray	2.40Å	0.35	0.09	Nitrogenase MoFe cofactor biosynthesis protein NifN
2ark.1.A	13.51	homo-tetramer	HHblits	X-ray	2.40Å	0.25	0.10	Flavodoxin
3hyv.1.A	24.24	homo-trimer	HHblits	X-ray	2.30Å	0.34	0.09	Sulfide-quinone reductase
1dxq.1.A	13.51	homo-dimer	HHblits	X-ray	2.80Å	0.25	0.10	QUINONE REDUCTASE
2r79.1.A	22.86	homo-hexamer	HHblits	X-ray	2.40Å	0.30	0.10	Periplasmic binding protein
4eqw.1.A	17.65	homo-dimer	HHblits	X-ray	1.50Å	0.31	0.09	Coenzyme A disulfide reductase
4emw.1.A	17.65	homo-dimer	HHblits	X-ray	2.39Å	0.31	0.09	Coenzyme A disulfide reductase
5ig8.1.A	8.33	homo-dimer	HHblits	X-ray	2.28Å	0.27	0.10	ATP grasp ligase
5ig8.2.A	8.33	homo-dimer	HHblits	X-ray	2.28Å	0.27	0.10	ATP grasp ligase
2dy0.1.A	13.51	homo-dimer	HHblits	X-ray	1.25Å	0.25	0.10	Adenine phosphoribosyltransferase
4jgi.3.A	16.67	homo-dimer	HHblits	X-ray	1.50Å	0.27	0.10	Putative uncharacterized protein
3mcu.1.A	16.67	homo-hexamer	HHblits	X-ray	2.30Å	0.27	0.10	Dipicolinate synthase, B chain
3mcu.1.E	16.67	homo-hexamer	HHblits	X-ray	2.30Å	0.27	0.10	Dipicolinate synthase, B chain
4rb4.1.A	14.29	homo-12-mer	HHblits	X-ray	3.88Å	0.29	0.10	Glycosyltransferase tibC
2ip4.1.A	7.89	monomer	HHblits	X-ray	2.80Å	0.22	0.10	Phosphoribosylamine--glycine ligase
2ip4.2.A	7.89	monomer	HHblits	X-ray	2.80Å	0.22	0.10	Phosphoribosylamine--glycine ligase
3ty2.1.A	14.29	homo-dimer	HHblits	X-ray	1.88Å	0.29	0.10	5'-nucleotidase surE
3ty2.1.B	14.29	homo-dimer	HHblits	X-ray	1.88Å	0.29	0.10	5'-nucleotidase surE
1xjc.1.A	13.51	monomer	HHblits	X-ray	2.10Å	0.24	0.10	MobB protein homolog
3d8u.1.A	13.89	homo-dimer	HHblits	X-ray	2.88Å	0.26	0.10	PurR transcriptional regulator
3d8u.1.B	13.89	homo-dimer	HHblits	X-ray	2.88Å	0.26	0.10	PurR transcriptional regulator
3md9.1.A	11.43	monomer	HHblits	X-ray	1.50Å	0.28	0.10	Hemin-binding periplasmic protein hmuT
3md9.2.A	11.43	monomer	HHblits	X-ray	1.50Å	0.28	0.10	Hemin-binding periplasmic protein hmuT
3nu1.1.A	11.43	monomer	HHblits	X-ray	2.50Å	0.28	0.10	Hemin-binding periplasmic protein
5jb3.1.G	28.13	hetero-oligomer	HHblits	EM	NA	0.35	0.09	30S ribosomal protein S2
4v4n.12.A	28.13	monomer	HHblits	EM	NA	0.35	0.09	30S ribosomal protein S2P
3o73.1.A	8.11	homo-dimer	HHblits	X-ray	2.00Å	0.24	0.10	Ribosyldihydronicotinamide dehydrogenase [quinone]
3o73.1.B	8.11	homo-dimer	HHblits	X-ray	2.00Å	0.24	0.10	Ribosyldihydronicotinamide dehydrogenase [quinone]
5lbt.1.A	8.11	homo-dimer	HHblits	X-ray	1.75Å	0.24	0.10	Ribosyldihydronicotinamide dehydrogenase [quinone]
1be1.1.A	11.11	monomer	HHblits	NMR	NA	0.26	0.10	GLUTAMATE MUTASE
1id8.1.A	11.11	monomer	HHblits	NMR	NA	0.26	0.10	METHYLASPARTATE MUTASE S CHAIN
1fmf.1.A	11.11	monomer	HHblits	NMR	NA	0.26	0.10	METHYLASPARTATE MUTASE S CHAIN
1fye.1.A	8.57	monomer	HHblits	X-ray	1.20Å	0.28	0.10	ASPARTYL DIPEPTIDASE
2rg7.1.B	14.29	homo-dimer	HHblits	X-ray	2.05Å	0.27	0.10	Periplasmic HEME binding protein
2rg7.1.A	14.29	homo-dimer	HHblits	X-ray	2.05Å	0.27	0.10	Periplasmic HEME binding protein
2r7a.2.B	14.29	homo-dimer	HHblits	X-ray	2.05Å	0.27	0.10	Bacterial heme binding protein
2c1x.1.A	17.65	monomer	HHblits	X-ray	1.90Å	0.29	0.09	UDP-GLUCOSE FLAVONOID 3-O GLYCOSYLTRANSFERASE
5l78.1.A	24.24	homo-dimer	HHblits	X-ray	2.68Å	0.32	0.09	Alpha-aminoadipic semialdehyde synthase, mitochondrial
5l78.1.B	24.24	homo-dimer	HHblits	X-ray	2.68Å	0.32	0.09	Alpha-aminoadipic semialdehyde synthase, mitochondrial
3u3x.1.A	24.24	homo-dimer	HHblits	X-ray	2.79Å	0.31	0.09	Oxidoreductase
1y80.1.A	11.11	monomer	HHblits	X-ray	1.70Å	0.24	0.10	Predicted cobalamin binding protein
3m1l.1.A	15.15	homo-dimer	HHblits	X-ray	2.52Å	0.31	0.09	3-oxoacyl-(Acyl-carrier-protein) reductase
3q6i.1.A	15.15	homo-dimer	HHblits	X-ray	2.59Å	0.31	0.09	3-oxoacyl-(Acyl-carrier-protein) reductase
3q6i.1.B	15.15	homo-dimer	HHblits	X-ray	2.59Å	0.31	0.09	3-oxoacyl-(Acyl-carrier-protein) reductase
3lls.1.A	15.15	homo-dimer	HHblits	X-ray	2.40Å	0.31	0.09	3-ketoacyl-(Acyl-carrier-protein) reductase
4v88.1.A	24.24	monomer	HHblits	X-ray	3.00Å	0.31	0.09	40S ribosomal protein S0-A
3j77.46.A	24.24	monomer	HHblits	EM	NA	0.31	0.09	40S ribosomal protein S0
4v7r.1.A	24.24	monomer	HHblits	X-ray	4.00Å	0.31	0.09	40S ribosomal protein S0-A
4v6i.2.A	24.24	monomer	HHblits	EM	NA	0.31	0.09	40S ribosomal protein rpS0 (S2p)
3j78.46.A	24.24	monomer	HHblits	EM	NA	0.31	0.09	40S ribosomal protein S0
3j6y.43.A	24.24	monomer	HHblits	EM	NA	0.31	0.09	40S ribosomal protein S0
3j6x.43.A	24.24	monomer	HHblits	EM	NA	0.31	0.09	40S ribosomal protein S0
4v88.76.A	24.24	monomer	HHblits	X-ray	3.00Å	0.31	0.09	40S ribosomal protein S0-A
5mc6.16.A	24.24	monomer	HHblits	EM	NA	0.31	0.09	40S ribosomal protein S0-A
5ll6.1.B	24.24	hetero-oligomer	HHblits	EM	NA	0.31	0.09	40S ribosomal protein S0-A
5jut.46.A	24.24	monomer	HHblits	EM	NA	0.31	0.09	uS2 (yeast S0)
5juo.46.A	24.24	monomer	HHblits	EM	NA	0.31	0.09	uS2 (yeast S0)
5juu.46.A	24.24	monomer	HHblits	EM	NA	0.31	0.09	uS2 (yeast S0)
5jup.46.A	24.24	monomer	HHblits	EM	NA	0.31	0.09	uS2 (yeast S0)
5jus.46.A	24.24	monomer	HHblits	EM	NA	0.31	0.09	uS2 (yeast S0)
4u6f.1.A	24.24	monomer	HHblits	X-ray	3.10Å	0.31	0.09	40S ribosomal protein S0-A
4u3n.76.A	24.24	monomer	HHblits	X-ray	3.20Å	0.31	0.09	40S ribosomal protein S0-A
4v8m.11.A	21.21	monomer	HHblits	EM	5.57Å	0.31	0.09	40S RIBOSOMAL PROTEIN SA, PUTATIVE
1yo6.1.A	17.65	homo-dimer	HHblits	X-ray	2.60Å	0.29	0.09	Putative Carbonyl Reductase Sniffer
1yo6.3.B	17.65	homo-dimer	HHblits	X-ray	2.60Å	0.29	0.09	Putative Carbonyl Reductase Sniffer
5t2a.50.A	21.21	monomer	HHblits	EM	NA	0.31	0.09	uS2
3vdr.1.A	27.27	homo-tetramer	HHblits	X-ray	3.00Å	0.31	0.09	D-3-hydroxybutyrate dehydrogenase
2yz7.1.A	27.27	homo-tetramer	HHblits	X-ray	2.19Å	0.31	0.09	D-3-hydroxybutyrate dehydrogenase
5xxu.1.B	21.21	hetero-oligomer	HHblits	EM	3.35Å	0.31	0.09	Ribosomal protein uS2
3jaq.1.D	21.21	hetero-oligomer	HHblits	EM	NA	0.31	0.09	uS2
3j80.1.B	21.21	hetero-oligomer	HHblits	EM	NA	0.31	0.09	uS2
3j81.1.B	21.21	hetero-oligomer	HHblits	EM	NA	0.31	0.09	uS2
4v6w.16.A	18.18	monomer	HHblits	EM	NA	0.31	0.09	40S ribosomal protein SA
5xyi.1.B	24.24	hetero-oligomer	HHblits	EM	NA	0.30	0.09	40S ribosomal protein SA
2p2s.1.A	21.21	homo-dimer	HHblits	X-ray	1.25Å	0.30	0.09	Putative oxidoreductase
4v7e.25.A	24.24	monomer	HHblits	EM	NA	0.30	0.09	40S ribosomal protein S2
4v3p.2.A	24.24	monomer	HHblits	EM	34.00Å	0.30	0.09	40S ribosomal protein SA
1vi5.1.A	21.88	monomer	HHblits	X-ray	2.65Å	0.33	0.09	30S ribosomal protein S2P
1vi5.2.A	21.88	monomer	HHblits	X-ray	2.65Å	0.33	0.09	30S ribosomal protein S2P
1vi5.4.A	21.88	monomer	HHblits	X-ray	2.65Å	0.33	0.09	30S ribosomal protein S2P
2acw.1.A	14.71	homo-dimer	HHblits	X-ray	2.60Å	0.28	0.09	triterpene UDP-glucosyl transferase UGT71G1
2acw.1.B	14.71	homo-dimer	HHblits	X-ray	2.60Å	0.28	0.09	triterpene UDP-glucosyl transferase UGT71G1
3j7a.1.C	24.24	hetero-oligomer	HHblits	EM	NA	0.30	0.09	40S ribosomal protein uS2
4koa.1.A	12.12	homo-dimer	HHblits	X-ray	1.93Å	0.30	0.09	1,5-anhydro-D-fructose reductase
3hbf.1.A	21.21	monomer	HHblits	X-ray	2.10Å	0.30	0.09	Flavonoid 3-O-glucosyltransferase
3hbj.1.A	21.21	monomer	HHblits	X-ray	2.10Å	0.30	0.09	Flavonoid 3-O-glucosyltransferase
3k2e.1.A	17.65	homo-tetramer	HHblits	X-ray	1.90Å	0.27	0.09	Enoyl-(Acyl-carrier-protein) reductase
2wwv.1.D	8.57	hetero-oligomer	HHblits	NMR	NA	0.25	0.10	N\,N'-DIACETYLCHITOBIOSE-SPECIFIC PHOSPHOTRANSFERASE ENZYME IIB COMPONENT
3lyu.1.A	21.21	homo-hexamer	HHblits	X-ray	2.30Å	0.29	0.09	Putative hydrogenase
3lrx.1.A	21.21	homo-hexamer	HHblits	X-ray	2.60Å	0.29	0.09	Putative hydrogenase
4v5o.1.K	21.21	hetero-oligomer	HHblits	X-ray	3.93Å	0.29	0.09	RPS0E
4kzx.1.A	18.18	hetero-oligomer	HHblits	X-ray	7.81Å	0.29	0.09	40S ribosomal protein SA
4ujc.45.A	18.18	monomer	HHblits	EM	9.50Å	0.29	0.09	40S RIBOSOMAL PROTEIN US2
3j7p.46.A	18.18	monomer	HHblits	EM	NA	0.29	0.09	Ribosomal protein uS2
4v5z.2.A	18.18	monomer	HHblits	EM	NA	0.29	0.09	40S Ribosomal protein SA
4ug0.44.A	18.18	monomer	HHblits	EM	NA	0.29	0.09	40S RIBOSOMAL PROTEIN SA
5aj0.46.A	18.18	monomer	HHblits	EM	3.50Å	0.29	0.09	40S ribosomal protein SA
5t2c.66.A	18.18	monomer	HHblits	EM	NA	0.29	0.09	40S ribosomal protein SA
4ujd.45.A	18.18	monomer	HHblits	EM	8.90Å	0.29	0.09	40S RIBOSOMAL PROTEIN US2
4v6x.16.A	18.18	monomer	HHblits	EM	NA	0.29	0.09	40S ribosomal protein SA
5a2q.1.C	18.18	hetero-oligomer	HHblits	EM	3.90Å	0.29	0.09	RIBOSOMAL PROTEIN US2
5lks.44.A	18.18	monomer	HHblits	EM	NA	0.29	0.09	40S ribosomal protein SA
5lzz.45.A	18.18	monomer	HHblits	EM	3.47Å	0.29	0.09	uS2
5o5j.1.U	27.27	hetero-oligomer	HHblits	EM	3.45Å	0.29	0.09	30S ribosomal protein S2
4v61.1.B	31.25	hetero-oligomer	HHblits	EM	NA	0.32	0.09	Ribosomal Protein S2
5mmj.1.D	31.25	hetero-oligomer	HHblits	EM	3.65Å	0.32	0.09	30S ribosomal protein S2, chloroplastic
5x8r.1.A	31.25	hetero-oligomer	HHblits	EM	NA	0.32	0.09	30S ribosomal protein S2, chloroplastic
2e37.1.A	21.88	homo-tetramer	HHblits	X-ray	2.30Å	0.31	0.09	L-lactate dehydrogenase
2v6m.1.C	21.88	homo-tetramer	HHblits	X-ray	2.20Å	0.31	0.09	L-LACTATE DEHYDROGENASE
2v6m.1.D	21.88	homo-tetramer	HHblits	X-ray	2.20Å	0.31	0.09	L-LACTATE DEHYDROGENASE
2v7p.1.A	21.88	homo-tetramer	HHblits	X-ray	2.10Å	0.31	0.09	L-LACTATE DEHYDROGENASE
2v7p.1.B	21.88	homo-tetramer	HHblits	X-ray	2.10Å	0.31	0.09	L-LACTATE DEHYDROGENASE
2v6m.1.A	21.88	homo-tetramer	HHblits	X-ray	2.20Å	0.31	0.09	L-LACTATE DEHYDROGENASE
2e37.1.B	21.88	homo-tetramer	HHblits	X-ray	2.30Å	0.31	0.09	L-lactate dehydrogenase
3l4b.1.C	12.50	hetero-oligomer	HHblits	X-ray	3.45Å	0.31	0.09	TrkA K+ Channel protien TM1088B
1i01.1.D	18.18	homo-tetramer	HHblits	X-ray	2.60Å	0.29	0.09	BETA-KETOACYL [ACP] REDUCTASE
1q7b.1.A	18.18	homo-tetramer	HHblits	X-ray	2.05Å	0.29	0.09	3-oxoacyl-[acyl-carrier protein] reductase
1i01.1.A	18.18	homo-tetramer	HHblits	X-ray	2.60Å	0.29	0.09	BETA-KETOACYL [ACP] REDUCTASE
5myj.1.B	21.88	hetero-oligomer	HHblits	EM	5.60Å	0.31	0.09	30S ribosomal protein S2
5mrc.41.A	21.88	monomer	HHblits	EM	NA	0.31	0.09	uS2m
4v4b.1.C	25.00	hetero-oligomer	HHblits	EM	NA	0.31	0.09	40S ribosomal protein S0-A
5m1j.2.A	25.00	monomer	HHblits	EM	3.30Å	0.31	0.09	40S ribosomal protein S0-A
4v7h.1.B	25.00	hetero-oligomer	HHblits	EM	8.90Å	0.31	0.09	40S ribosomal protein S0(A)
5lyb.1.A	25.00	monomer	HHblits	X-ray	3.25Å	0.31	0.09	40S ribosomal protein S0-A
5tga.76.A	25.00	monomer	HHblits	X-ray	3.30Å	0.31	0.09	40S ribosomal protein S0-A
4v92.1.C	25.00	hetero-oligomer	HHblits	EM	3.70Å	0.31	0.09	US2
1iib.1.A	11.76	monomer	HHblits	X-ray	1.80Å	0.26	0.09	ENZYME IIB OF THE CELLOBIOSE-SPECIFIC PHOSPHOTRANSFERASE SYSTEM
1e2b.1.A	11.76	monomer	HHblits	NMR	NA	0.26	0.09	ENZYME IIB-CELLOBIOSE
1z7e.1.B	15.15	homo-hexamer	HHblits	X-ray	3.00Å	0.28	0.09	protein ArnA
1z7e.1.A	15.15	homo-hexamer	HHblits	X-ray	3.00Å	0.28	0.09	protein ArnA
1z7e.1.F	15.15	homo-hexamer	HHblits	X-ray	3.00Å	0.28	0.09	protein ArnA
4wkg.1.D	15.15	homo-hexamer	HHblits	X-ray	2.70Å	0.28	0.09	Bifunctional polymyxin resistance protein ArnA
4wkg.1.E	15.15	homo-hexamer	HHblits	X-ray	2.70Å	0.28	0.09	Bifunctional polymyxin resistance protein ArnA
4wkg.1.F	15.15	homo-hexamer	HHblits	X-ray	2.70Å	0.28	0.09	Bifunctional polymyxin resistance protein ArnA
4wkg.1.B	15.15	homo-hexamer	HHblits	X-ray	2.70Å	0.28	0.09	Bifunctional polymyxin resistance protein ArnA
4wkg.1.C	15.15	homo-hexamer	HHblits	X-ray	2.70Å	0.28	0.09	Bifunctional polymyxin resistance protein ArnA
5it7.45.A	21.88	monomer	HHblits	EM	NA	0.31	0.09	40S ribosomal protein S0
3ezy.1.A	25.00	homo-tetramer	HHblits	X-ray	2.04Å	0.30	0.09	Dehydrogenase
2nm0.1.A	15.15	homo-tetramer	HHblits	X-ray	1.99Å	0.28	0.09	Probable 3-oxacyl-(Acyl-carrier-protein) reductase
3kzv.1.A	15.15	homo-tetramer	HHblits	X-ray	2.00Å	0.28	0.09	Uncharacterized oxidoreductase YIR035C
4nkr.1.A	8.57	homo-dimer	HHblits	X-ray	2.41Å	0.23	0.10	Molybdopterin-guanine dinucleotide biosynthesis protein B
4nkr.2.A	8.57	homo-dimer	HHblits	X-ray	2.41Å	0.23	0.10	Molybdopterin-guanine dinucleotide biosynthesis protein B
4nkr.2.B	8.57	homo-dimer	HHblits	X-ray	2.41Å	0.23	0.10	Molybdopterin-guanine dinucleotide biosynthesis protein B
4nkr.3.A	8.57	homo-dimer	HHblits	X-ray	2.41Å	0.23	0.10	Molybdopterin-guanine dinucleotide biosynthesis protein B
4nkr.3.B	8.57	homo-dimer	HHblits	X-ray	2.41Å	0.23	0.10	Molybdopterin-guanine dinucleotide biosynthesis protein B
5ffq.1.A	11.76	homo-dimer	HHblits	X-ray	2.00Å	0.25	0.09	ShuY-like protein
4v9l.2.A	25.00	hetero-oligomer	HHblits	X-ray	3.50Å	0.30	0.09	30S ribosomal protein S2
4v68.1.B	25.00	hetero-oligomer	HHblits	EM	NA	0.30	0.09	30S ribosomal protein S2
4w29.2.A	25.00	hetero-oligomer	HHblits	X-ray	3.80Å	0.30	0.09	30S ribosomal protein S2
4w29.1.A	25.00	hetero-oligomer	HHblits	X-ray	3.80Å	0.30	0.09	30S ribosomal protein S2
4k0k.1.B	25.00	hetero-oligomer	HHblits	X-ray	3.40Å	0.30	0.09	30S ribosomal protein S2
4v9j.2.A	25.00	hetero-oligomer	HHblits	X-ray	3.86Å	0.30	0.09	30S ribosomal protein S2
4v9k.2.A	25.00	hetero-oligomer	HHblits	X-ray	3.50Å	0.30	0.09	30S ribosomal protein S2
1fjg.1.B	25.00	hetero-oligomer	HHblits	X-ray	3.00Å	0.30	0.09	30S RIBOSOMAL PROTEIN S2
2om7.1.N	25.00	hetero-oligomer	HHblits	EM	NA	0.30	0.09	30S ribosomal protein S2
3t1h.1.B	25.00	hetero-oligomer	HHblits	X-ray	3.11Å	0.30	0.09	30S ribosomal protein S2
3oto.1.B	25.00	hetero-oligomer	HHblits	X-ray	3.69Å	0.30	0.09	30S RIBOSOMAL PROTEIN S2
4dr2.1.B	25.00	hetero-oligomer	HHblits	X-ray	3.25Å	0.30	0.09	30S ribosomal protein S2
4kvb.1.B	25.00	hetero-oligomer	HHblits	X-ray	4.20Å	0.30	0.09	30S ribosomal protein S2
4lfa.1.B	25.00	hetero-oligomer	HHblits	X-ray	3.65Å	0.30	0.09	ribosomal protein S2
4lf7.1.B	25.00	hetero-oligomer	HHblits	X-ray	3.15Å	0.30	0.09	ribosomal protein S2
4lfz.2.B	25.00	hetero-oligomer	HHblits	X-ray	3.92Å	0.30	0.09	30S ribosomal protein S2
4v8n.2.B	25.00	hetero-oligomer	HHblits	X-ray	3.10Å	0.30	0.09	30S RIBOSOMAL PROTEIN S2
4v5q.1.B	25.00	hetero-oligomer	HHblits	X-ray	3.10Å	0.30	0.09	30S RIBOSOMAL PROTEIN S2
4v9s.1.B	25.00	hetero-oligomer	HHblits	X-ray	3.10Å	0.30	0.09	30S Ribosomal Protein S2
4v5c.2.B	25.00	hetero-oligomer	HHblits	X-ray	3.30Å	0.30	0.09	30S RIBOSOMAL PROTEIN S2
4v8c.2.5	25.00	hetero-oligomer	HHblits	X-ray	3.30Å	0.30	0.09	30S RIBOSOMAL PROTEIN S2
4v8h.2.B	25.00	hetero-oligomer	HHblits	X-ray	3.10Å	0.30	0.09	30S Ribosomal Protein S2
4v4i.1.8	25.00	hetero-oligomer	HHblits	X-ray	3.71Å	0.30	0.09	30S ribosomal protein S2
4v67.1.E	25.00	hetero-oligomer	HHblits	X-ray	3.00Å	0.30	0.09	30S ribosomal protein S2
4v4p.1.c	25.00	hetero-oligomer	HHblits	X-ray	5.50Å	0.30	0.09	30S ribosomal protein S2
4v4x.1.D	25.00	hetero-oligomer	HHblits	X-ray	5.00Å	0.30	0.09	30S ribosomal protein S2
4v9a.1.B	25.00	hetero-oligomer	HHblits	X-ray	3.30Å	0.30	0.09	30S RIBOSOMAL PROTEIN S2
4v90.1.B	25.00	hetero-oligomer	HHblits	X-ray	2.95Å	0.30	0.09	30S RIBOSOMAL PROTEIN S2
4v9s.2.B	25.00	hetero-oligomer	HHblits	X-ray	3.10Å	0.30	0.09	30S Ribosomal Protein S2
4v8f.1.5	25.00	hetero-oligomer	HHblits	X-ray	3.30Å	0.30	0.09	30S RIBOSOMAL PROTEIN S2
4v9b.1.B	25.00	hetero-oligomer	HHblits	X-ray	3.10Å	0.30	0.09	30S RIBOSOMAL PROTEIN S2
4v5k.2.B	25.00	hetero-oligomer	HHblits	X-ray	3.20Å	0.30	0.09	30S RIBOSOMAL PROTEIN S2
4v5l.1.B	25.00	hetero-oligomer	HHblits	X-ray	3.10Å	0.30	0.09	30S RIBOSOMAL PROTEIN S2
4v95.2.B	25.00	hetero-oligomer	HHblits	X-ray	3.20Å	0.30	0.09	30S Ribosomal Protein S2
4v63.1.E	25.00	hetero-oligomer	HHblits	X-ray	3.21Å	0.30	0.09	30S ribosomal protein S2
4v9a.2.B	25.00	hetero-oligomer	HHblits	X-ray	3.30Å	0.30	0.09	30S RIBOSOMAL PROTEIN S2
4v9b.2.B	25.00	hetero-oligomer	HHblits	X-ray	3.10Å	0.30	0.09	30S RIBOSOMAL PROTEIN S2
4v8u.1.B	25.00	hetero-oligomer	HHblits	X-ray	3.70Å	0.30	0.09	30S RIBOSOMAL PROTEIN S2
4v95.1.B	25.00	hetero-oligomer	HHblits	X-ray	3.20Å	0.30	0.09	30S Ribosomal Protein S2
4v4j.1.8	25.00	hetero-oligomer	HHblits	X-ray	3.83Å	0.30	0.09	30S ribosomal protein S2
4v6g.1.B	25.00	hetero-oligomer	HHblits	X-ray	3.50Å	0.30	0.09	30S RIBOSOMAL PROTEIN S2
4v5e.2.B	25.00	hetero-oligomer	HHblits	X-ray	3.45Å	0.30	0.09	30S RIBOSOMAL PROTEIN S2
4v8f.2.B	25.00	hetero-oligomer	HHblits	X-ray	3.30Å	0.30	0.09	30S RIBOSOMAL PROTEIN S2
5j8b.1.8	25.00	hetero-oligomer	HHblits	X-ray	2.60Å	0.30	0.09	30S ribosomal protein S2
4y4p.2.6	25.00	hetero-oligomer	HHblits	X-ray	2.50Å	0.30	0.09	30S ribosomal protein S2
4wzd.2.B	25.00	hetero-oligomer	HHblits	X-ray	3.10Å	0.30	0.09	30S ribosomal protein S2
4wzo.2.B	25.00	hetero-oligomer	HHblits	X-ray	3.30Å	0.30	0.09	30S ribosomal protein S2
4wzo.1.B	25.00	hetero-oligomer	HHblits	X-ray	3.30Å	0.30	0.09	30S ribosomal protein S2
4wr6.1.B	25.00	hetero-oligomer	HHblits	X-ray	3.05Å	0.30	0.09	30S ribosomal protein S2
4wr6.2.B	25.00	hetero-oligomer	HHblits	X-ray	3.05Å	0.30	0.09	30S ribosomal protein S2
4wsm.2.B	25.00	hetero-oligomer	HHblits	X-ray	3.30Å	0.30	0.09	30S ribosomal protein S2
4wqr.2.B	25.00	hetero-oligomer	HHblits	X-ray	3.15Å	0.30	0.09	30S ribosomal protein S2
5el5.2.B	25.00	hetero-oligomer	HHblits	X-ray	3.15Å	0.30	0.09	30S ribosomal protein S2
5el4.1.B	25.00	hetero-oligomer	HHblits	X-ray	3.15Å	0.30	0.09	30S ribosomal protein S2
5el6.1.B	25.00	hetero-oligomer	HHblits	X-ray	3.10Å	0.30	0.09	30S ribosomal protein S2
5el6.2.B	25.00	hetero-oligomer	HHblits	X-ray	3.10Å	0.30	0.09	30S ribosomal protein S2
5el4.2.B	25.00	hetero-oligomer	HHblits	X-ray	3.15Å	0.30	0.09	30S ribosomal protein S2
5e81.2.B	25.00	hetero-oligomer	HHblits	X-ray	2.95Å	0.30	0.09	30S ribosomal protein S2
5el7.2.B	25.00	hetero-oligomer	HHblits	X-ray	3.15Å	0.30	0.09	30S ribosomal protein S2
5e7k.2.B	25.00	hetero-oligomer	HHblits	X-ray	3.20Å	0.30	0.09	30S ribosomal protein S2
4wu1.1.B	25.00	hetero-oligomer	HHblits	X-ray	3.20Å	0.30	0.09	30S ribosomal protein S2
5el5.1.B	25.00	hetero-oligomer	HHblits	X-ray	3.15Å	0.30	0.09	30S ribosomal protein S2
4wqu.2.8	25.00	hetero-oligomer	HHblits	X-ray	2.80Å	0.30	0.09	30S ribosomal protein S2
5imq.1.I	25.00	hetero-oligomer	HHblits	EM	NA	0.30	0.09	30S ribosomal protein S2
5imr.1.B	25.00	hetero-oligomer	HHblits	EM	NA	0.30	0.09	30S ribosomal protein S2
5ibb.1.B	25.00	hetero-oligomer	HHblits	X-ray	2.96Å	0.30	0.09	30S ribosomal protein S2
5ibb.2.B	25.00	hetero-oligomer	HHblits	X-ray	2.96Å	0.30	0.09	30S ribosomal protein S2
4v5a.2.B	25.00	hetero-oligomer	HHblits	X-ray	3.50Å	0.30	0.09	30S RIBOSOMAL PROTEIN S2
2uua.1.B	25.00	hetero-oligomer	HHblits	X-ray	2.90Å	0.30	0.09	30S RIBOSOMAL PROTEIN S2
2vqe.1.B	25.00	hetero-oligomer	HHblits	X-ray	2.50Å	0.30	0.09	30S RIBOSOMAL PROTEIN S2
5lmr.1.B	25.00	hetero-oligomer	HHblits	EM	NA	0.30	0.09	30S ribosomal protein S2
5lmp.1.B	25.00	hetero-oligomer	HHblits	EM	NA	0.30	0.09	30S ribosomal protein S2
5lmn.1.B	25.00	hetero-oligomer	HHblits	EM	NA	0.30	0.09	30S ribosomal protein S2
5lmu.1.B	25.00	hetero-oligomer	HHblits	EM	NA	0.30	0.09	30S ribosomal protein S2
5lmt.1.B	25.00	hetero-oligomer	HHblits	EM	NA	0.30	0.09	30S ribosomal protein S2
5lms.1.B	25.00	hetero-oligomer	HHblits	EM	NA	0.30	0.09	30S ribosomal protein S2
5lmq.1.B	25.00	hetero-oligomer	HHblits	EM	NA	0.30	0.09	30S ribosomal protein S2
5j4d.1.a	25.00	hetero-oligomer	HHblits	X-ray	3.10Å	0.30	0.09	30S ribosomal protein S2
5w4k.2.6	25.00	hetero-oligomer	HHblits	X-ray	2.70Å	0.30	0.09	30S ribosomal protein S2
5dox.1.6	25.00	hetero-oligomer	HHblits	X-ray	3.10Å	0.30	0.09	30S ribosomal protein S2
4z8c.2.6	25.00	hetero-oligomer	HHblits	X-ray	2.90Å	0.30	0.09	30S ribosomal protein S2
5dox.2.6	25.00	hetero-oligomer	HHblits	X-ray	3.10Å	0.30	0.09	30S ribosomal protein S2
4zer.1.6	25.00	hetero-oligomer	HHblits	X-ray	3.10Å	0.30	0.09	30S ribosomal protein S2
4zer.2.6	25.00	hetero-oligomer	HHblits	X-ray	3.10Å	0.30	0.09	30S ribosomal protein S2
4v7p.2.6	25.00	hetero-oligomer	HHblits	X-ray	3.62Å	0.30	0.09	30S ribosomal protein S2
4gkk.1.B	25.00	hetero-oligomer	HHblits	X-ray	3.20Å	0.30	0.09	30S ribosomal protein S2
4gkj.1.B	25.00	hetero-oligomer	HHblits	X-ray	3.30Å	0.30	0.09	30S ribosomal protein S2
4v4g.2.B	25.00	hetero-oligomer	HHblits	X-ray	11.50Å	0.30	0.09	30S ribosomal protein S2
4v9q.2.5	25.00	hetero-oligomer	HHblits	X-ray	3.40Å	0.30	0.09	30S ribosomal protein S2
4v9i.2.B	25.00	hetero-oligomer	HHblits	X-ray	3.30Å	0.30	0.09	30S Ribosomal protein S2
4jv5.1.B	25.00	hetero-oligomer	HHblits	X-ray	3.16Å	0.30	0.09	30S ribosomal protein S2
4v9h.1.O	25.00	hetero-oligomer	HHblits	X-ray	2.86Å	0.30	0.09	30S ribosomal protein S2
4wt8.2.D	25.00	hetero-oligomer	HHblits	X-ray	3.40Å	0.30	0.09	30S ribosomal protein S2
4v4a.1.B	25.00	hetero-oligomer	HHblits	X-ray	9.50Å	0.30	0.09	30S ribosomal protein S2
4xej.2.2	25.00	hetero-oligomer	HHblits	X-ray	3.80Å	0.30	0.09	30S ribosomal protein S2
5aa0.1.8	25.00	hetero-oligomer	HHblits	EM	5.00Å	0.30	0.09	30S ribosomal protein S2
4x62.1.B	25.00	hetero-oligomer	HHblits	X-ray	3.45Å	0.30	0.09	30S ribosomal protein S2
2e5l.1.B	25.00	hetero-oligomer	HHblits	X-ray	3.30Å	0.30	0.09	30S ribosomal protein S2
4yhh.1.B	25.00	hetero-oligomer	HHblits	X-ray	3.42Å	0.30	0.09	30S ribosomal protein S2
5iwa.1.A	25.00	hetero-oligomer	HHblits	X-ray	3.50Å	0.30	0.09	30S ribosomal protein S2
1i94.1.B	25.00	hetero-oligomer	HHblits	X-ray	3.20Å	0.30	0.09	30S RIBOSOMAL PROTEIN S2
2zm6.1.B	25.00	hetero-oligomer	HHblits	X-ray	3.30Å	0.30	0.09	30S ribosomal protein S2
3lk7.1.A	25.00	monomer	HHblits	X-ray	1.50Å	0.30	0.09	UDP-N-acetylmuramoylalanine--D-glutamate ligase
3jbo.18.A	25.00	monomer	HHblits	EM	NA	0.30	0.09	40S ribosomal protein uS2
3jbp.31.A	25.00	monomer	HHblits	EM	NA	0.30	0.09	40S ribosomal protein uS2
3jbn.31.A	25.00	monomer	HHblits	EM	NA	0.30	0.09	40S ribosomal protein uS2
2acv.1.A	15.15	homo-dimer	HHblits	X-ray	2.00Å	0.27	0.09	triterpene UDP-glucosyl transferase UGT71G1
2acv.1.B	15.15	homo-dimer	HHblits	X-ray	2.00Å	0.27	0.09	triterpene UDP-glucosyl transferase UGT71G1
3a28.1.A	12.12	homo-tetramer	HHblits	X-ray	2.00Å	0.27	0.09	L-2.3-butanediol dehydrogenase
3bch.1.A	18.75	monomer	HHblits	X-ray	2.15Å	0.30	0.09	40S ribosomal protein SA
3jag.45.A	18.75	monomer	HHblits	EM	NA	0.30	0.09	uS2
5k0y.1.1	18.75	hetero-oligomer	HHblits	EM	NA	0.30	0.09	ribosomal protein uS2
3j9w.1.B	25.00	hetero-oligomer	HHblits	EM	NA	0.29	0.09	30S ribosomal protein uS2
5njt.1.B	25.00	hetero-oligomer	HHblits	EM	NA	0.29	0.09	30S ribosomal protein S2
3sj7.1.A	15.15	homo-tetramer	HHblits	X-ray	2.50Å	0.27	0.09	3-oxoacyl-(Acyl-carrier-protein) reductase
3sj7.1.B	15.15	homo-tetramer	HHblits	X-ray	2.50Å	0.27	0.09	3-oxoacyl-(Acyl-carrier-protein) reductase
2pq6.1.A	15.15	monomer	HHblits	X-ray	2.10Å	0.27	0.09	UDP-glucuronosyl/UDP-glucosyltransferase
4yqy.1.A	25.00	homo-tetramer	HHblits	X-ray	1.38Å	0.29	0.09	Putative Dehydrogenase
4dim.1.A	19.35	monomer	HHblits	X-ray	2.61Å	0.32	0.09	Phosphoribosylglycinamide synthetase
3sju.1.A	15.15	homo-tetramer	HHblits	X-ray	2.40Å	0.26	0.09	Keto reductase
3sju.1.B	15.15	homo-tetramer	HHblits	X-ray	2.40Å	0.26	0.09	Keto reductase
1djq.1.A	12.50	homo-dimer	HHblits	X-ray	2.20Å	0.29	0.09	TRIMETHYLAMINE DEHYDROGENASE
4v9d.2.B	18.75	hetero-oligomer	HHblits	X-ray	3.00Å	0.29	0.09	30S ribosomal protein S2
4v7s.2.B	18.75	hetero-oligomer	HHblits	X-ray	3.25Å	0.29	0.09	30S ribosomal protein S2
4v9d.1.B	18.75	hetero-oligomer	HHblits	X-ray	3.00Å	0.29	0.09	30S ribosomal protein S2
4v7u.1.B	18.75	hetero-oligomer	HHblits	X-ray	3.10Å	0.29	0.09	30S ribosomal protein S2
4u24.1.B	18.75	hetero-oligomer	HHblits	X-ray	2.90Å	0.29	0.09	30S ribosomal protein S2
4v69.1.M	18.75	hetero-oligomer	HHblits	EM	NA	0.29	0.09	30S ribosomal protein S2
5mgp.1.6	18.75	hetero-oligomer	HHblits	EM	NA	0.29	0.09	30S ribosomal protein S2
4v5h.1.B	18.75	hetero-oligomer	HHblits	EM	5.80Å	0.29	0.09	30S RIBOSOMAL PROTEIN S2
5np6.1.E	18.75	hetero-oligomer	HHblits	EM	NA	0.29	0.09	30S ribosomal protein S2
4a2i.1.B	18.75	hetero-oligomer	HHblits	EM	16.50Å	0.29	0.09	30S RIBOSOMAL PROTEIN S2
5lze.1.B	18.75	hetero-oligomer	HHblits	EM	NA	0.29	0.09	30S ribosomal protein S2
5lzb.1.B	18.75	hetero-oligomer	HHblits	EM	NA	0.29	0.09	30S ribosomal protein S2
5lzc.1.B	18.75	hetero-oligomer	HHblits	EM	NA	0.29	0.09	30S ribosomal protein S2
2ykr.1.B	18.75	hetero-oligomer	HHblits	EM	9.80Å	0.29	0.09	30S RIBOSOMAL PROTEIN S2
5lzf.1.B	18.75	hetero-oligomer	HHblits	EM	NA	0.29	0.09	30S ribosomal protein S2
5uyl.1.5	18.75	hetero-oligomer	HHblits	EM	NA	0.29	0.09	30S ribosomal protein S2
5uyn.1.5	18.75	hetero-oligomer	HHblits	EM	NA	0.29	0.09	30S ribosomal protein S2
5uyk.1.5	18.75	hetero-oligomer	HHblits	EM	NA	0.29	0.09	30S ribosomal protein S2
5uyp.1.5	18.75	hetero-oligomer	HHblits	EM	NA	0.29	0.09	30S ribosomal protein S2
5uyq.1.5	18.75	hetero-oligomer	HHblits	EM	NA	0.29	0.09	30S ribosomal protein S2
5o2r.1.8	18.75	hetero-oligomer	HHblits	EM	NA	0.29	0.09	30S ribosomal protein S2
6awd.1.G	18.75	hetero-oligomer	HHblits	EM	NA	0.29	0.09	30S ribosomal protein S2
6awc.1.H	18.75	hetero-oligomer	HHblits	EM	NA	0.29	0.09	30S ribosomal protein S2
6awb.1.H	18.75	hetero-oligomer	HHblits	EM	NA	0.29	0.09	30S ribosomal protein S2
4v4v.1.E	18.75	hetero-oligomer	HHblits	EM	NA	0.29	0.09	30S ribosomal subunit protein S2
5nwy.1.9	18.75	hetero-oligomer	HHblits	EM	2.93Å	0.29	0.09	30S ribosomal protein S2
4ybb.1.B	18.75	hetero-oligomer	HHblits	X-ray	2.10Å	0.29	0.09	30S ribosomal protein S2
5no3.1.B	18.75	hetero-oligomer	HHblits	EM	NA	0.29	0.09	30S ribosomal protein S2
4v75.1.A	18.75	hetero-oligomer	HHblits	EM	NA	0.29	0.09	30S ribosomal protein S2
4v72.1.A	18.75	hetero-oligomer	HHblits	EM	NA	0.29	0.09	30S ribosomal protein S2
4v70.1.A	18.75	hetero-oligomer	HHblits	EM	NA	0.29	0.09	30S ribosomal protein S2
4v73.1.A	18.75	hetero-oligomer	HHblits	EM	NA	0.29	0.09	30S ribosomal protein S2
4v6y.1.A	18.75	hetero-oligomer	HHblits	EM	NA	0.29	0.09	30S ribosomal protein S2
4v71.1.A	18.75	hetero-oligomer	HHblits	EM	NA	0.29	0.09	30S ribosomal protein S2
4v6z.1.A	18.75	hetero-oligomer	HHblits	EM	NA	0.29	0.09	30S ribosomal protein S2
4v74.1.A	18.75	hetero-oligomer	HHblits	EM	NA	0.29	0.09	30S ribosomal protein S2
4v77.1.A	18.75	hetero-oligomer	HHblits	EM	NA	0.29	0.09	30S ribosomal protein S2
4v76.1.A	18.75	hetero-oligomer	HHblits	EM	NA	0.29	0.09	30S ribosomal protein S2
4v7a.1.A	18.75	hetero-oligomer	HHblits	EM	NA	0.29	0.09	30S ribosomal protein S2
4v79.1.A	18.75	hetero-oligomer	HHblits	EM	NA	0.29	0.09	30S ribosomal protein S2
4v78.1.A	18.75	hetero-oligomer	HHblits	EM	NA	0.29	0.09	30S ribosomal protein S2
4v5y.1.T	18.75	hetero-oligomer	HHblits	X-ray	4.45Å	0.29	0.09	30S ribosomal protein S2
4v4q.1.T	18.75	hetero-oligomer	HHblits	X-ray	3.46Å	0.29	0.09	30S ribosomal protein S2
4v50.2.C	18.75	hetero-oligomer	HHblits	X-ray	3.22Å	0.29	0.09	30S ribosomal protein S2
4v5b.1.7	18.75	hetero-oligomer	HHblits	X-ray	3.74Å	0.29	0.09	30S RIBOSOMAL PROTEIN S2
4v54.2.S	18.75	hetero-oligomer	HHblits	X-ray	3.30Å	0.29	0.09	30S ribosomal protein S2
4v4q.2.T	18.75	hetero-oligomer	HHblits	X-ray	3.46Å	0.29	0.09	30S ribosomal protein S2
4v64.2.T	18.75	hetero-oligomer	HHblits	X-ray	3.50Å	0.29	0.09	30S ribosomal protein S2
4v57.1.R	18.75	hetero-oligomer	HHblits	X-ray	3.50Å	0.29	0.09	30S ribosomal protein S2
4v5b.2.6	18.75	hetero-oligomer	HHblits	X-ray	3.74Å	0.29	0.09	30S RIBOSOMAL PROTEIN S2
4v57.2.T	18.75	hetero-oligomer	HHblits	X-ray	3.50Å	0.29	0.09	30S ribosomal protein S2
4v50.1.C	18.75	hetero-oligomer	HHblits	X-ray	3.22Å	0.29	0.09	30S ribosomal protein S2
4v56.1.R	18.75	hetero-oligomer	HHblits	X-ray	3.93Å	0.29	0.09	30S ribosomal protein S2
4v56.2.T	18.75	hetero-oligomer	HHblits	X-ray	3.93Å	0.29	0.09	30S ribosomal protein S2
4v6q.1.E	18.75	hetero-oligomer	HHblits	EM	NA	0.29	0.09	30S ribosomal protein S2
4v6s.1.b	18.75	hetero-oligomer	HHblits	EM	NA	0.29	0.09	30S ribosomal protein S2
4v6p.1.E	18.75	hetero-oligomer	HHblits	EM	NA	0.29	0.09	30S ribosomal protein S2
4v6r.1.E	18.75	hetero-oligomer	HHblits	EM	NA	0.29	0.09	30S ribosomal protein S2
4v6o.1.E	18.75	hetero-oligomer	HHblits	EM	NA	0.29	0.09	30S ribosomal protein S2
4v6v.1.K	18.75	hetero-oligomer	HHblits	EM	NA	0.29	0.09	30S ribosomal protein S2
4v6m.1.G	18.75	hetero-oligomer	HHblits	EM	NA	0.29	0.09	30S ribosomal protein S2
4v6n.1.c	18.75	hetero-oligomer	HHblits	EM	NA	0.29	0.09	30S ribosomal protein S2
4v7d.1.9	18.75	hetero-oligomer	HHblits	EM	NA	0.29	0.09	30S ribosomal protein S2
3j9z.1.N	18.75	hetero-oligomer	HHblits	EM	NA	0.29	0.09	30S ribosomal protein S2
3ja1.1.R	18.75	hetero-oligomer	HHblits	EM	NA	0.29	0.09	30S ribosomal protein S2
5h5u.1.c	18.75	hetero-oligomer	HHblits	EM	3.00Å	0.29	0.09	30S ribosomal protein S2
4v6c.1.A	18.75	hetero-oligomer	HHblits	X-ray	3.19Å	0.29	0.09	30S ribosomal protein S2
4v4h.2.T	18.75	hetero-oligomer	HHblits	X-ray	3.46Å	0.29	0.09	30S RIBOSOMAL PROTEIN S2
4v4h.1.T	18.75	hetero-oligomer	HHblits	X-ray	3.46Å	0.29	0.09	30S RIBOSOMAL PROTEIN S2
4v6c.2.A	18.75	hetero-oligomer	HHblits	X-ray	3.19Å	0.29	0.09	30S ribosomal protein S2
4v9o.1.7	18.75	hetero-oligomer	HHblits	X-ray	2.90Å	0.29	0.09	30S ribosomal protein S2
4v9c.1.B	18.75	hetero-oligomer	HHblits	X-ray	3.30Å	0.29	0.09	30S ribosomal protein S2
4v9c.2.B	18.75	hetero-oligomer	HHblits	X-ray	3.30Å	0.29	0.09	30S ribosomal protein S2
4v9p.3.7	18.75	hetero-oligomer	HHblits	X-ray	2.90Å	0.29	0.09	30S ribosomal protein S2
4v9p.2.6	18.75	hetero-oligomer	HHblits	X-ray	2.90Å	0.29	0.09	30S ribosomal protein S2
4v9o.2.7	18.75	hetero-oligomer	HHblits	X-ray	2.90Å	0.29	0.09	30S ribosomal protein S2
4v9o.4.6	18.75	hetero-oligomer	HHblits	X-ray	2.90Å	0.29	0.09	30S ribosomal protein S2
4v9o.3.7	18.75	hetero-oligomer	HHblits	X-ray	2.90Å	0.29	0.09	30S ribosomal protein S2
4v9p.4.6	18.75	hetero-oligomer	HHblits	X-ray	2.90Å	0.29	0.09	30S ribosomal protein S2
4v66.1.F	18.75	hetero-oligomer	HHblits	EM	NA	0.29	0.09	30S ribosomal protein S2
4v6k.1.c	18.75	hetero-oligomer	HHblits	EM	NA	0.29	0.09	30S ribosomal protein S2
4v6l.1.F	18.75	hetero-oligomer	HHblits	EM	NA	0.29	0.09	30S ribosomal protein S2
4v7i.1.a	18.75	hetero-oligomer	HHblits	EM	NA	0.29	0.09	30S ribosomal protein S2
5kcs.1.9	18.75	hetero-oligomer	HHblits	EM	NA	0.29	0.09	30S ribosomal protein S2
5kcr.1.7	18.75	hetero-oligomer	HHblits	EM	NA	0.29	0.09	30S ribosomal protein S2
5iqr.1.5	18.75	hetero-oligomer	HHblits	EM	3.00Å	0.29	0.09	30S ribosomal protein S2
3jcn.1.8	18.75	hetero-oligomer	HHblits	EM	NA	0.29	0.09	30S ribosomal protein S2
5mdz.1.a	18.75	hetero-oligomer	HHblits	EM	3.10Å	0.29	0.09	30S ribosomal protein S2
3jbv.1.B	18.75	hetero-oligomer	HHblits	EM	NA	0.29	0.09	30S ribosomal protein S2
3jbu.1.A	18.75	hetero-oligomer	HHblits	EM	3.64Å	0.29	0.09	30S ribosomal protein S2
5u4i.1.6	18.75	hetero-oligomer	HHblits	EM	3.50Å	0.29	0.09	30S ribosomal protein S2
3jce.1.U	18.75	hetero-oligomer	HHblits	EM	3.20Å	0.29	0.09	30S ribosomal protein S2
3jcd.1.A	18.75	hetero-oligomer	HHblits	EM	NA	0.29	0.09	30S ribosomal protein S2
5u9g.1.e	18.75	hetero-oligomer	HHblits	EM	NA	0.29	0.09	30S ribosomal protein S2
5u9f.1.e	18.75	hetero-oligomer	HHblits	EM	NA	0.29	0.09	30S ribosomal protein S2
5uz4.1.T	18.75	hetero-oligomer	HHblits	EM	NA	0.29	0.09	30S ribosomal protein S2
5kps.1.6	18.75	hetero-oligomer	HHblits	EM	NA	0.29	0.09	30S ribosomal protein S2
5kpv.1.5	18.75	hetero-oligomer	HHblits	EM	NA	0.29	0.09	30S ribosomal protein S2
5kpw.1.5	18.75	hetero-oligomer	HHblits	EM	NA	0.29	0.09	30S ribosomal protein S2
5kpx.1.5	18.75	hetero-oligomer	HHblits	EM	NA	0.29	0.09	30S ribosomal protein S2
4woi.1.B	18.75	hetero-oligomer	HHblits	X-ray	3.00Å	0.29	0.09	30S ribosomal protein S2
4woi.2.6	18.75	hetero-oligomer	HHblits	X-ray	3.00Å	0.29	0.09	30S ribosomal protein S2
3j9y.1.B	18.75	hetero-oligomer	HHblits	EM	NA	0.29	0.09	30S ribosomal protein S2
5ju8.1.B	18.75	hetero-oligomer	HHblits	EM	NA	0.29	0.09	30S ribosomal protein S2
3c85.1.A	12.50	homo-dimer	HHblits	X-ray	1.90Å	0.29	0.09	Putative glutathione-regulated potassium-efflux system protein KefB
3c85.1.B	12.50	homo-dimer	HHblits	X-ray	1.90Å	0.29	0.09	Putative glutathione-regulated potassium-efflux system protein KefB
3c85.2.A	12.50	homo-dimer	HHblits	X-ray	1.90Å	0.29	0.09	Putative glutathione-regulated potassium-efflux system protein KefB
3c85.2.B	12.50	homo-dimer	HHblits	X-ray	1.90Å	0.29	0.09	Putative glutathione-regulated potassium-efflux system protein KefB
5li0.1.B	15.63	hetero-oligomer	HHblits	EM	NA	0.29	0.09	30S ribosomal protein S2
5nd8.1.B	15.63	hetero-oligomer	HHblits	EM	NA	0.29	0.09	30S ribosomal protein S2
5nd9.1.B	15.63	hetero-oligomer	HHblits	EM	NA	0.29	0.09	30S ribosomal protein S2
5ngm.1.B	15.63	hetero-oligomer	HHblits	EM	NA	0.29	0.09	30S ribosomal protein S2
5ng8.1.A	15.63	monomer	HHblits	EM	NA	0.29	0.09	30S ribosomal protein S2
5cej.1.A	18.75	homo-tetramer	HHblits	X-ray	2.50Å	0.28	0.09	3-oxoacyl-[acyl-carrier protein] reductase
5cdy.1.C	18.75	homo-tetramer	HHblits	X-ray	2.85Å	0.28	0.09	3-oxoacyl-[acyl-carrier protein] reductase
5cdy.1.A	18.75	homo-tetramer	HHblits	X-ray	2.85Å	0.28	0.09	3-oxoacyl-[acyl-carrier protein] reductase
2q5c.1.A	9.68	monomer	HHblits	X-ray	1.49Å	0.31	0.09	NtrC family transcriptional regulator
5jyd.1.A	18.75	homo-tetramer	HHblits	X-ray	1.65Å	0.28	0.09	Short chain dehydrogenase
3fbs.1.A	16.13	homo-dimer	HHblits	X-ray	2.15Å	0.30	0.09	Oxidoreductase
1uls.1.A	12.50	homo-tetramer	HHblits	X-ray	2.40Å	0.27	0.09	putative 3-oxoacyl-acyl carrier protein reductase
1djn.1.A	12.90	homo-dimer	HHblits	X-ray	2.20Å	0.29	0.09	TRIMETHYLAMINE DEHYDROGENASE
5tej.1.B	19.35	homo-tetramer	HHblits	X-ray	2.50Å	0.29	0.09	4-hydroxy-tetrahydrodipicolinate reductase
5tej.1.A	19.35	homo-tetramer	HHblits	X-ray	2.50Å	0.29	0.09	4-hydroxy-tetrahydrodipicolinate reductase
3guy.1.A	12.90	homo-tetramer	HHblits	X-ray	1.90Å	0.28	0.09	Short-chain dehydrogenase/reductase SDR
3h7a.1.A	6.06	homo-tetramer	HHblits	X-ray	1.87Å	0.23	0.09	short chain dehydrogenase
3ksu.1.A	9.68	homo-dimer	HHblits	X-ray	2.30Å	0.27	0.09	3-oxoacyl-acyl carrier protein reductase
5l76.1.A	24.14	monomer	HHblits	X-ray	2.57Å	0.31	0.08	Alpha-aminoadipic semialdehyde synthase, mitochondrial
5o1o.1.A	24.14	homo-dimer	HHblits	X-ray	2.48Å	0.31	0.08	Alpha-aminoadipic semialdehyde synthase, mitochondrial
3otg.1.A	17.24	monomer	HHblits	X-ray	2.08Å	0.29	0.08	CalG1
3oth.1.A	17.24	monomer	HHblits	X-ray	2.30Å	0.29	0.08	CalG1
3wc4.1.A	17.86	monomer	HHblits	X-ray	1.85Å	0.30	0.08	UDP-glucose:anthocyanidin 3-O-glucosyltransferase
3ia7.1.A	13.79	homo-dimer	HHblits	X-ray	1.91Å	0.28	0.08	CalG4
3ia7.1.B	13.79	homo-dimer	HHblits	X-ray	1.91Å	0.28	0.08	CalG4
1pnv.1.A	21.43	homo-dimer	HHblits	X-ray	2.80Å	0.30	0.08	GLYCOSYLTRANSFERASE GTFA
1pnv.1.B	21.43	homo-dimer	HHblits	X-ray	2.80Å	0.30	0.08	GLYCOSYLTRANSFERASE GTFA
5du2.1.A	23.08	monomer	HHblits	X-ray	2.70Å	0.32	0.07	EspG2 glycosyltransferase
5du2.2.A	23.08	monomer	HHblits	X-ray	2.70Å	0.32	0.07	EspG2 glycosyltransferase
1l5x.1.A	20.00	homo-dimer	HHblits	X-ray	2.00Å	0.31	0.07	Survival protein E
1l5x.1.B	20.00	homo-dimer	HHblits	X-ray	2.00Å	0.31	0.07	Survival protein E
2e6h.1.A	20.00	homo-tetramer	HHblits	X-ray	2.10Å	0.31	0.07	5'-nucleotidase surE
2e6h.1.B	20.00	homo-tetramer	HHblits	X-ray	2.10Å	0.31	0.07	5'-nucleotidase surE
2e6h.1.C	20.00	homo-tetramer	HHblits	X-ray	2.10Å	0.31	0.07	5'-nucleotidase surE
2e6h.1.D	20.00	homo-tetramer	HHblits	X-ray	2.10Å	0.31	0.07	5'-nucleotidase surE
2e6g.1.A	20.00	homo-12-mer	HHblits	X-ray	2.60Å	0.31	0.07	5'-nucleotidase surE
2e6c.1.B	20.00	homo-tetramer	HHblits	X-ray	2.05Å	0.31	0.07	5'-nucleotidase surE
2e6c.1.D	20.00	homo-tetramer	HHblits	X-ray	2.05Å	0.31	0.07	5'-nucleotidase surE
2e69.1.C	20.00	homo-tetramer	HHblits	X-ray	2.20Å	0.31	0.07	5'-nucleotidase surE
2e6e.1.A	20.00	homo-tetramer	HHblits	X-ray	2.50Å	0.31	0.07	5'-nucleotidase surE
2e6e.1.B	20.00	homo-tetramer	HHblits	X-ray	2.50Å	0.31	0.07	5'-nucleotidase surE
2e6e.1.C	20.00	homo-tetramer	HHblits	X-ray	2.50Å	0.31	0.07	5'-nucleotidase surE
2e6e.1.D	20.00	homo-tetramer	HHblits	X-ray	2.50Å	0.31	0.07	5'-nucleotidase surE
2e6c.1.A	20.00	homo-tetramer	HHblits	X-ray	2.05Å	0.31	0.07	5'-nucleotidase surE
2e6g.1.D	20.00	homo-12-mer	HHblits	X-ray	2.60Å	0.31	0.07	5'-nucleotidase surE
1j9l.1.A	16.67	homo-dimer	HHblits	X-ray	1.90Å	0.33	0.07	STATIONARY PHASE SURVIVAL PROTEIN
1j9l.1.B	16.67	homo-dimer	HHblits	X-ray	1.90Å	0.33	0.07	STATIONARY PHASE SURVIVAL PROTEIN
1ilv.3.C	16.67	homo-tetramer	HHblits	X-ray	2.00Å	0.33	0.07	STATIONARY-PHASE SURVIVAL PROTEIN SURE HOMOLOG
2wqk.1.A	20.83	homo-tetramer	HHblits	X-ray	1.50Å	0.32	0.07	5'-NUCLEOTIDASE SURE
3ty2.1.A	34.78	homo-dimer	HHblits	X-ray	1.88Å	0.34	0.06	5'-nucleotidase surE
3ty2.1.B	34.78	homo-dimer	HHblits	X-ray	1.88Å	0.34	0.06	5'-nucleotidase surE
2v4n.1.A	30.43	homo-dimer	HHblits	X-ray	1.70Å	0.33	0.06	MULTIFUNCTIONAL PROTEIN SUR E
4ryt.1.A	26.09	homo-dimer	HHblits	X-ray	2.09Å	0.31	0.06	5'/3'-nucleotidase SurE
4xh8.1.A	26.09	homo-dimer	HHblits	X-ray	3.56Å	0.31	0.06	5'/3'-nucleotidase SurE
4gad.1.A	31.82	homo-dimer	HHblits	X-ray	2.35Å	0.34	0.06	5'/3'-nucleotidase SurE
4gad.1.B	31.82	homo-dimer	HHblits	X-ray	2.35Å	0.34	0.06	5'/3'-nucleotidase SurE
4g9o.1.A	31.82	homo-dimer	HHblits	X-ray	2.12Å	0.34	0.06	5'/3'-nucleotidase SurE
4g9o.1.B	31.82	homo-dimer	HHblits	X-ray	2.12Å	0.34	0.06	5'/3'-nucleotidase SurE
2v4o.1.A	31.82	homo-dimer	HHblits	X-ray	2.71Å	0.34	0.06	MULTIFUNCTIONAL PROTEIN SUR E
2v4o.1.B	31.82	homo-dimer	HHblits	X-ray	2.71Å	0.34	0.06	MULTIFUNCTIONAL PROTEIN SUR E
2v4o.2.A	31.82	homo-dimer	HHblits	X-ray	2.71Å	0.34	0.06	MULTIFUNCTIONAL PROTEIN SUR E
2v4o.2.B	31.82	homo-dimer	HHblits	X-ray	2.71Å	0.34	0.06	MULTIFUNCTIONAL PROTEIN SUR E
4zg5.1.A	27.27	homo-tetramer	HHblits	X-ray	1.90Å	0.34	0.06	5'-nucleotidase SurE
4xep.1.A	27.27	homo-dimer	HHblits	X-ray	1.50Å	0.32	0.06	5'/3'-nucleotidase SurE
4xer.1.A	27.27	homo-dimer	HHblits	X-ray	1.97Å	0.32	0.06	5'/3'-nucleotidase SurE
3dfk.1.A	20.00	monomer	HHblits	X-ray	1.80Å	0.34	0.06	Teicoplanin pseudoaglycone deacetylase Orf2
1q74.2.A	15.00	monomer	HHblits	X-ray	1.70Å	0.32	0.06	1D-myo-inositol 2-acetamido-2-deoxy-alpha-D-glucopyranoside Deacetylase (MshB)
1q74.1.A	15.00	monomer	HHblits	X-ray	1.70Å	0.32	0.06	1D-myo-inositol 2-acetamido-2-deoxy-alpha-D-glucopyranoside Deacetylase (MshB)
4ewl.1.A	15.00	homo-dimer	HHblits	X-ray	1.85Å	0.32	0.06	1D-myo-inositol 2-acetamido-2-deoxy-alpha-D-glucopyranoside deacetylase
4ps2.1.A	15.79	monomer	HHblits	X-ray	2.00Å	0.32	0.05	Putative type VI secretion protein
1uan.1.A	15.79	homo-hexamer	HHblits	X-ray	2.00Å	0.29	0.05	hypothetical protein TT1542
1z7e.1.B	11.11	homo-hexamer	HHblits	X-ray	3.00Å	0.30	0.05	protein ArnA
1z7e.1.A	11.11	homo-hexamer	HHblits	X-ray	3.00Å	0.30	0.05	protein ArnA
1z7e.1.F	11.11	homo-hexamer	HHblits	X-ray	3.00Å	0.30	0.05	protein ArnA
4wkg.1.D	11.11	homo-hexamer	HHblits	X-ray	2.70Å	0.30	0.05	Bifunctional polymyxin resistance protein ArnA
4wkg.1.E	11.11	homo-hexamer	HHblits	X-ray	2.70Å	0.30	0.05	Bifunctional polymyxin resistance protein ArnA
4wkg.1.F	11.11	homo-hexamer	HHblits	X-ray	2.70Å	0.30	0.05	Bifunctional polymyxin resistance protein ArnA
4wkg.1.B	11.11	homo-hexamer	HHblits	X-ray	2.70Å	0.30	0.05	Bifunctional polymyxin resistance protein ArnA
4wkg.1.C	11.11	homo-hexamer	HHblits	X-ray	2.70Å	0.30	0.05	Bifunctional polymyxin resistance protein ArnA