SWISS-MODEL | Workspace | Model Results

SWISS-MODEL Homology Modelling Report

Model Building Report

This document lists the results for the homology modelling project "Q6GGZ0" submitted to SWISS-MODEL workspace on Oct. 26, 2017, 8:37 p.m..The submitted primary amino acid sequence is given in Table T1.

If you use any results in your research, please cite the relevant publications:

Marco Biasini; Stefan Bienert; Andrew Waterhouse; Konstantin Arnold; Gabriel Studer; Tobias Schmidt; Florian Kiefer; Tiziano Gallo Cassarino; Martino Bertoni; Lorenza Bordoli; Torsten Schwede. (2014). SWISS-MODEL: modelling protein tertiary and quaternary structure using evolutionary information. Nucleic Acids Research (1 July 2014) 42 (W1): W252-W258; doi: 10.1093/nar/gku340.
Arnold, K., Bordoli, L., Kopp, J. and Schwede, T. (2006) The SWISS-MODEL workspace: a web-based environment for protein structure homology modelling. Bioinformatics, 22, 195-201.
Benkert, P., Biasini, M. and Schwede, T. (2011) Toward the estimation of the absolute quality of individual protein structure models. Bioinformatics, 27, 343-350

Results

The SWISS-MODEL template library (SMTL version 2017-10-23, PDB release 2017-10-13) was searched with Blast (Altschul et al., 1997) and HHBlits (Remmert, et al., 2011) for evolutionary related structures matching the target sequence in Table T1. For details on the template search, see Materials and Methods. Overall 1574 templates were found (Table T2).

Models

The following model was built (see Materials and Methods "Model Building"):

Model #01	File	Built with	Oligo-State	Ligands	GMQE	QMEAN
	PDB	ProMod3 Version 1.1.0.	MONOMER (matching prediction)	None	0.63	-3.22

QMEAN	-3.22
Cβ	-1.71
All Atom	-1.33
Solvation	-0.83
Torsion	-2.73

Template	Seq Identity	Oligo-state	Found by	Method	Resolution	Seq Similarity	Range	Coverage	Description
1f0k.1.B	25.74	homo-dimer	HHblits	X-ray	1.90Å	0.33		0.95	UDP-N-ACETYLGLUCOSAMINE-N-ACETYLMURAMYL-(PENTAPEPTIDE) PYROPHOSPHORYL-UNDECAPRENOL N-ACETYLGLUCOSAMINE TRANSFERASE

Ligand	Added to Model	Description
SO4	✕ - Not biologically relevant.	SULFATE ION

Target    MTKIAFTGGGTVGHVSVNLSLIPTALSQGYEVLYIGSKNGIEREMIESQLPEIKYYPISSGKLRRYISLENAKDVFKVLK
1f0k.1.B  -KRLMVMAGGTGGHVFPGLAVAHHLMAQGWQVRWLGTADRMEADLVPKH--GIEIDFIRISGLRGKGIKALIAAPLRIFN

Target    GILDARKVLKKEKPDLLFSKGGFVSVPVVIAAKSLNIPTIIHESDLTPGLANKIALKFAKKIYTTFEETLNYLPKEKADF
1f0k.1.B  AWRQARAIMKAYKPDVVLGMGGYVSGPGGLAAWSLGIPVVLHEQNGIAGLTNKWLAKIATKVMQAFPGA---FPNA--EV

Target    IGATIREDLKNGNAHNGYQLTGFNENKKVLLVMGGSLGSKKLNSIIRENLDALLQQYQVIHLTGKGLKDAQVK-K-----
1f0k.1.B  VGNPVRTDVLALP--LPQQRLAGREGPVRVLVVGGSQGARILNQTMPQVAAKLGDSVTIWHQSGKGSQQSVEQAYAEAGQ

Target    SGYIQYEFVKEDLTDLLAITDTVISRAGSNAIYEFLTLRIPMLLVPLGLDQSRGDQIDNANHFADKGYAKTIDEEQLTAQ
1f0k.1.B  PQHKVTEFI-DDMAAAYAWADVVVCRSGALTVSEIAAAGLPALFVPFQ--HKDRQQYWNALPLEKAGAAKIIEQPQLSVD

Target    ILLQELNKMEQERTR---IINNMKSYEQSYTKEALFDKMIKDALN
1f0k.1.B  AVANTLAGW--SRETLLTMAERARAASIPDATERVAN-EVSRV--

Materials and Methods

Template Search

Template search with Blast and HHBlits has been performed against the SWISS-MODEL template library (SMTL, last update: 2017-10-23, last included PDB release: 2017-10-13).

The target sequence was searched with BLAST (Altschul et al., 1997) against the primary amino acid sequence contained in the SMTL. A total of 5 templates were found.

An initial HHblits profile has been built using the procedure outlined in (Remmert, et al., 2011), followed by 1 iteration of HHblits against NR20. The obtained profile has then be searched against all profiles of the SMTL. A total of 1572 templates were found.

Template Selection

For each identified template, the template's quality has been predicted from features of the target-template alignment. The templates with the highest quality have then been selected for model building.

Model Building

Models are built based on the target-template alignment using ProMod3. Coordinates which are conserved between the target and the template are copied from the template to the model. Insertions and deletions are remodelled using a fragment library. Side chains are then rebuilt. Finally, the geometry of the resulting model is regularized by using a force field. In case loop modelling with ProMod3 fails, an alternative model is built with PROMOD-II (Guex, et al., 1997).

Model Quality Estimation

The global and per-residue model quality has been assessed using the QMEAN scoring function (Benkert, et al., 2011) . For improved performance, weights of the individual QMEAN terms have been trained specifically for SWISS-MODEL.

Ligand Modelling

Ligands present in the template structure are transferred by homology to the model when the following criteria are met (Gallo -Casserino, to be published): (a) The ligands are annotated as biologically relevant in the template library, (b) the ligand is in contact with the model, (c) the ligand is not clashing with the protein, (d) the residues in contact with the ligand are conserved between the target and the template. If any of these four criteria is not satisfied, a certain ligand will not be included in the model. The model summary includes information on why and which ligand has not been included.

Oligomeric State Conservation

Homo-oligomeric structure of the target protein is predicted based on the analysis of pairwise interfaces of the identified template structures. For each relevant interface between polypeptide chains (interfaces with more than 10 residue-residue interactions), the QscoreOligomer (Mariani et al., 2011) is predicted from features such as similarity to target and frequency of observing this interface in the identified templates (Kiefer, Bertoni, Biasini, to be published). The prediction is performed with a random forest regressor using these features as input parameters to predict the probability of conservation for each interface. The QscoreOligomer of the whole complex is then calculated as the weight-averaged QscoreOligomer of the interfaces. The oligomeric state of the target is predicted to be the same as in the template when QscoreOligomer is predicted to be higher or equal to 0.5.

References

Altschul, S.F., Madden, T.L., Schaffer, A.A., Zhang, J., Zhang, Z., Miller, W. and Lipman, D.J. (1997) Gapped BLAST and PSI-BLAST: a new generation of protein database search programs. Nucleic Acids Res, 25, 3389-3402.
Remmert, M., Biegert, A., Hauser, A. and Soding, J. (2012) HHblits: lightning-fast iterative protein sequence searching by HMM-HMM alignment. Nat Methods, 9, 173-175.
Guex, N. and Peitsch, M.C. (1997) SWISS-MODEL and the Swiss-PdbViewer: an environment for comparative protein modeling. Electrophoresis, 18, 2714-2723.
Sali, A. and Blundell, T.L. (1993) Comparative protein modelling by satisfaction of spatial restraints. J Mol Biol, 234, 779-815.
Benkert, P., Biasini, M. and Schwede, T. (2011) Toward the estimation of the absolute quality of individual protein structure models. Bioinformatics, 27, 343-350.
Mariani, V., Kiefer, F., Schmidt, T., Haas, J. and Schwede, T. (2011) Assessment of template based protein structure predictions in CASP9. Proteins, 79 Suppl 10, 37-58.

Table T1:

Primary amino acid sequence for which templates were searched and models were built.

MTKIAFTGGGTVGHVSVNLSLIPTALSQGYEVLYIGSKNGIEREMIESQLPEIKYYPISSGKLRRYISLENAKDVFKVLKGILDARKVLKKEKPDLLFSK
GGFVSVPVVIAAKSLNIPTIIHESDLTPGLANKIALKFAKKIYTTFEETLNYLPKEKADFIGATIREDLKNGNAHNGYQLTGFNENKKVLLVMGGSLGSK
KLNSIIRENLDALLQQYQVIHLTGKGLKDAQVKKSGYIQYEFVKEDLTDLLAITDTVISRAGSNAIYEFLTLRIPMLLVPLGLDQSRGDQIDNANHFADK
GYAKTIDEEQLTAQILLQELNKMEQERTRIINNMKSYEQSYTKEALFDKMIKDALN

Table T2:

Template	Seq Identity	Oligo-state	Found by	Method	Resolution	Seq Similarity	Coverage	Description
3s2u.1.A	27.84	monomer	BLAST	X-ray	2.23Å	0.34	0.94	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase
3s2u.1.A	23.98	monomer	HHblits	X-ray	2.23Å	0.32	0.96	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase
1f0k.1.A	25.74	homo-dimer	HHblits	X-ray	1.90Å	0.33	0.95	UDP-N-ACETYLGLUCOSAMINE-N-ACETYLMURAMYL-(PENTAPEPTIDE) PYROPHOSPHORYL-UNDECAPRENOL N-ACETYLGLUCOSAMINE TRANSFERASE
1f0k.1.B	25.74	homo-dimer	HHblits	X-ray	1.90Å	0.33	0.95	UDP-N-ACETYLGLUCOSAMINE-N-ACETYLMURAMYL-(PENTAPEPTIDE) PYROPHOSPHORYL-UNDECAPRENOL N-ACETYLGLUCOSAMINE TRANSFERASE
1nlm.1.A	25.74	homo-dimer	HHblits	X-ray	2.50Å	0.33	0.95	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase
1nlm.1.B	25.74	homo-dimer	HHblits	X-ray	2.50Å	0.33	0.95	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase
4wyi.1.A	15.84	monomer	HHblits	X-ray	2.50Å	0.28	0.96	Monogalactosyldiacylglycerol synthase 1, chloroplastic
4x1t.1.A	15.84	monomer	HHblits	X-ray	2.25Å	0.28	0.96	Monogalactosyldiacylglycerol synthase 1, chloroplastic
1f0k.1.A	29.17	homo-dimer	BLAST	X-ray	1.90Å	0.35	0.88	UDP-N-ACETYLGLUCOSAMINE-N-ACETYLMURAMYL-(PENTAPEPTIDE) PYROPHOSPHORYL-UNDECAPRENOL N-ACETYLGLUCOSAMINE TRANSFERASE
1f0k.1.B	29.17	homo-dimer	BLAST	X-ray	1.90Å	0.35	0.88	UDP-N-ACETYLGLUCOSAMINE-N-ACETYLMURAMYL-(PENTAPEPTIDE) PYROPHOSPHORYL-UNDECAPRENOL N-ACETYLGLUCOSAMINE TRANSFERASE
1nlm.1.A	29.17	homo-dimer	BLAST	X-ray	2.50Å	0.35	0.88	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase
1nlm.1.B	29.17	homo-dimer	BLAST	X-ray	2.50Å	0.35	0.88	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase
3wc4.1.A	15.09	monomer	HHblits	X-ray	1.85Å	0.28	0.95	UDP-glucose:anthocyanidin 3-O-glucosyltransferase
4m60.1.A	18.62	monomer	HHblits	X-ray	1.77Å	0.29	0.94	Oleandomycin glycosyltransferase
2iyf.1.A	18.92	monomer	HHblits	X-ray	1.70Å	0.29	0.94	OLEANDOMYCIN GLYCOSYLTRANSFERASE
2iyf.2.A	18.92	monomer	HHblits	X-ray	1.70Å	0.29	0.94	OLEANDOMYCIN GLYCOSYLTRANSFERASE
2iya.1.A	17.42	monomer	HHblits	X-ray	1.70Å	0.29	0.94	OLEANDOMYCIN GLYCOSYLTRANSFERASE
4m83.1.A	18.32	monomer	HHblits	X-ray	1.70Å	0.29	0.94	Oleandomycin glycosyltransferase
4m83.2.A	18.32	monomer	HHblits	X-ray	1.70Å	0.29	0.94	Oleandomycin glycosyltransferase
4rie.1.A	18.21	homo-dimer	HHblits	X-ray	2.16Å	0.29	0.94	Glycosyl transferase homolog
4rie.1.B	18.21	homo-dimer	HHblits	X-ray	2.16Å	0.29	0.94	Glycosyl transferase homolog
4rif.1.A	18.21	homo-dimer	HHblits	X-ray	1.85Å	0.29	0.94	Glycosyl transferase homolog
4rif.1.B	18.21	homo-dimer	HHblits	X-ray	1.85Å	0.29	0.94	Glycosyl transferase homolog
5gl5.1.A	16.72	homo-dimer	HHblits	X-ray	1.90Å	0.29	0.94	Sterol 3-beta-glucosyltransferase
5gl5.1.B	16.72	homo-dimer	HHblits	X-ray	1.90Å	0.29	0.94	Sterol 3-beta-glucosyltransferase
5xvm.1.A	16.42	monomer	HHblits	X-ray	2.77Å	0.28	0.94	Sterol 3-beta-glucosyltransferase
4g2t.1.A	17.42	homo-dimer	HHblits	X-ray	2.41Å	0.29	0.94	SsfS6
4fzr.1.A	17.42	homo-dimer	HHblits	X-ray	2.40Å	0.29	0.94	SsfS6
4rii.1.A	17.66	homo-dimer	HHblits	X-ray	2.00Å	0.29	0.94	Glycosyl transferase homolog,Glycosyl transferase
4rih.1.A	17.66	homo-dimer	HHblits	X-ray	2.22Å	0.29	0.94	Glycosyl transferase homolog,Glycosyl transferase
4rig.1.B	17.66	homo-dimer	HHblits	X-ray	1.90Å	0.29	0.94	Glycosyl transferase
4rig.1.A	17.66	homo-dimer	HHblits	X-ray	1.90Å	0.29	0.94	Glycosyl transferase
3ia7.1.A	14.93	homo-dimer	HHblits	X-ray	1.91Å	0.28	0.94	CalG4
3ia7.1.B	14.93	homo-dimer	HHblits	X-ray	1.91Å	0.28	0.94	CalG4
3otg.1.A	15.43	monomer	HHblits	X-ray	2.08Å	0.28	0.95	CalG1
3oth.1.A	15.43	monomer	HHblits	X-ray	2.30Å	0.28	0.95	CalG1
2c1x.1.A	13.35	monomer	HHblits	X-ray	1.90Å	0.27	0.95	UDP-GLUCOSE FLAVONOID 3-O GLYCOSYLTRANSFERASE
5tmd.1.A	12.98	monomer	HHblits	X-ray	2.19Å	0.27	0.95	Glycosyltransferase, Os79
5tmb.1.A	12.98	monomer	HHblits	X-ray	2.34Å	0.27	0.95	Glycosyltransferase, Os79
4hln.1.A	14.71	monomer	HHblits	X-ray	2.70Å	0.26	0.96	Starch synthase I
1rzu.1.A	11.30	monomer	HHblits	X-ray	2.30Å	0.25	0.97	Glycogen synthase 1
1rzu.2.A	11.30	monomer	HHblits	X-ray	2.30Å	0.25	0.97	Glycogen synthase 1
3rsc.1.A	13.47	monomer	HHblits	X-ray	2.19Å	0.27	0.94	CalG2
4lei.1.A	17.33	homo-dimer	HHblits	X-ray	3.15Å	0.29	0.92	NDP-forosamyltransferase
4lei.1.B	17.33	homo-dimer	HHblits	X-ray	3.15Å	0.29	0.92	NDP-forosamyltransferase
3wad.1.A	15.82	homo-dimer	HHblits	X-ray	2.00Å	0.27	0.94	Glycosyltransferase
3iaa.1.A	12.91	homo-dimer	HHblits	X-ray	2.51Å	0.27	0.94	CalG2
5enz.1.A	16.46	homo-dimer	HHblits	X-ray	1.91Å	0.28	0.92	UDP-GlcNAc 2-epimerase
5enz.1.B	16.46	homo-dimer	HHblits	X-ray	1.91Å	0.28	0.92	UDP-GlcNAc 2-epimerase
3d1j.1.A	12.39	monomer	HHblits	X-ray	3.00Å	0.26	0.95	Glycogen synthase
5du2.1.A	13.86	monomer	HHblits	X-ray	2.70Å	0.27	0.93	EspG2 glycosyltransferase
5du2.2.A	13.86	monomer	HHblits	X-ray	2.70Å	0.27	0.93	EspG2 glycosyltransferase
2yjn.1.A	13.47	hetero-oligomer	HHblits	X-ray	3.09Å	0.27	0.94	GLYCOSYLTRANSFERASE
4hwg.1.A	18.15	homo-hexamer	HHblits	X-ray	2.00Å	0.28	0.91	UDP-N-acetylglucosamine 2-epimerase
1rrv.1.A	13.47	monomer	HHblits	X-ray	2.00Å	0.26	0.94	GLYCOSYLTRANSFERASE GTFD
2vg8.1.A	17.54	monomer	HHblits	X-ray	1.75Å	0.28	0.91	HYDROQUINONE GLUCOSYLTRANSFERASE
3uyl.1.A	13.98	homo-dimer	HHblits	X-ray	1.85Å	0.27	0.92	NDP-rhamnosyltransferase
3tsa.1.A	13.68	homo-dimer	HHblits	X-ray	1.70Å	0.27	0.92	NDP-rhamnosyltransferase
3tsa.1.B	13.68	homo-dimer	HHblits	X-ray	1.70Å	0.27	0.92	NDP-rhamnosyltransferase
3beo.1.A	13.46	homo-dimer	HHblits	X-ray	1.70Å	0.27	0.92	UDP-N-acetylglucosamine 2-epimerase
1f6d.1.B	13.72	homo-dimer	HHblits	X-ray	2.50Å	0.27	0.92	UDP-N-ACETYLGLUCOSAMINE 2-EPIMERASE
1f6d.1.A	13.72	homo-dimer	HHblits	X-ray	2.50Å	0.27	0.92	UDP-N-ACETYLGLUCOSAMINE 2-EPIMERASE
4amb.1.A	12.99	homo-dimer	HHblits	X-ray	2.62Å	0.26	0.93	SNOGD
4amg.1.A	12.99	homo-dimer	HHblits	X-ray	2.59Å	0.26	0.93	SNOGD
4amg.1.B	12.99	homo-dimer	HHblits	X-ray	2.59Å	0.26	0.93	SNOGD
4an4.1.A	12.99	homo-dimer	HHblits	X-ray	2.70Å	0.26	0.93	GLYCOSYL TRANSFERASE
4an4.1.B	12.99	homo-dimer	HHblits	X-ray	2.70Å	0.26	0.93	GLYCOSYL TRANSFERASE
4an4.2.A	12.99	homo-dimer	HHblits	X-ray	2.70Å	0.26	0.93	GLYCOSYL TRANSFERASE
2p6p.1.A	13.76	homo-dimer	HHblits	X-ray	1.88Å	0.27	0.92	Glycosyl transferase
2p6p.1.B	13.76	homo-dimer	HHblits	X-ray	1.88Å	0.27	0.92	Glycosyl transferase
3l01.1.A	15.81	monomer	HHblits	X-ray	2.60Å	0.27	0.92	GlgA glycogen synthase
2acv.1.A	15.64	homo-dimer	HHblits	X-ray	2.00Å	0.27	0.92	triterpene UDP-glucosyl transferase UGT71G1
2acv.1.B	15.64	homo-dimer	HHblits	X-ray	2.00Å	0.27	0.92	triterpene UDP-glucosyl transferase UGT71G1
5dld.1.A	13.15	monomer	HHblits	X-ray	1.45Å	0.27	0.92	UDP-N-Acetylglucosamine 2-epimerase
3dzc.1.A	15.34	homo-dimer	HHblits	X-ray	2.35Å	0.27	0.92	UDP-N-acetylglucosamine 2-epimerase
3dzc.1.B	15.34	homo-dimer	HHblits	X-ray	2.35Å	0.27	0.92	UDP-N-acetylglucosamine 2-epimerase
1vgv.1.B	13.76	homo-dimer	HHblits	X-ray	2.31Å	0.27	0.92	UDP-N-acetylglucosamine 2-epimerase
1vgv.1.A	13.76	homo-dimer	HHblits	X-ray	2.31Å	0.27	0.92	UDP-N-acetylglucosamine 2-epimerase
1vgv.2.B	13.76	homo-dimer	HHblits	X-ray	2.31Å	0.27	0.92	UDP-N-acetylglucosamine 2-epimerase
2acw.1.A	16.00	homo-dimer	HHblits	X-ray	2.60Å	0.27	0.91	triterpene UDP-glucosyl transferase UGT71G1
2acw.1.B	16.00	homo-dimer	HHblits	X-ray	2.60Å	0.27	0.91	triterpene UDP-glucosyl transferase UGT71G1
1iir.1.A	15.06	monomer	HHblits	X-ray	1.80Å	0.26	0.93	glycosyltransferase GtfB
3h4i.1.A	15.45	monomer	HHblits	X-ray	1.30Å	0.26	0.93	Glycosyltransferase GtfA, Glycosyltransferase
3ot5.1.A	12.20	monomer	HHblits	X-ray	2.20Å	0.26	0.92	UDP-N-acetylglucosamine 2-epimerase
3ot5.2.A	12.20	monomer	HHblits	X-ray	2.20Å	0.26	0.92	UDP-N-acetylglucosamine 2-epimerase
3hbf.1.A	15.79	monomer	HHblits	X-ray	2.10Å	0.28	0.91	Flavonoid 3-O-glucosyltransferase
3hbj.1.A	15.79	monomer	HHblits	X-ray	2.10Å	0.28	0.91	Flavonoid 3-O-glucosyltransferase
1pnv.1.A	15.20	homo-dimer	HHblits	X-ray	2.80Å	0.26	0.92	GLYCOSYLTRANSFERASE GTFA
1pnv.1.B	15.20	homo-dimer	HHblits	X-ray	2.80Å	0.26	0.92	GLYCOSYLTRANSFERASE GTFA
4neq.1.A	14.64	homo-dimer	HHblits	X-ray	2.85Å	0.28	0.90	UDP-N-acetylglucosamine 2-epimerase
4nes.1.A	14.64	homo-dimer	HHblits	X-ray	1.42Å	0.28	0.90	UDP-N-acetylglucosamine 2-epimerase
3cop.1.A	12.46	monomer	HHblits	X-ray	2.30Å	0.26	0.92	Glycogen synthase
5u6m.1.A	14.29	monomer	HHblits	X-ray	2.57Å	0.27	0.90	UDP-glycosyltransferase 74F2
5u6m.2.A	14.29	monomer	HHblits	X-ray	2.57Å	0.27	0.90	UDP-glycosyltransferase 74F2
5u6s.1.A	14.29	monomer	HHblits	X-ray	2.00Å	0.27	0.90	UDP-glycosyltransferase 74F2
5u6s.2.A	14.29	monomer	HHblits	X-ray	2.00Å	0.27	0.90	UDP-glycosyltransferase 74F2
3guh.1.A	12.46	monomer	HHblits	X-ray	2.79Å	0.26	0.92	Glycogen synthase
5v2k.1.A	14.33	monomer	HHblits	X-ray	2.00Å	0.27	0.90	UDP-glycosyltransferase 74F2
5v2k.2.A	14.33	monomer	HHblits	X-ray	2.00Å	0.27	0.90	UDP-glycosyltransferase 74F2
4zht.1.A	13.58	homo-tetramer	HHblits	X-ray	2.69Å	0.27	0.91	Bifunctional UDP-N-acetylglucosamine 2-epimerase/N-acetylmannosamine kinase
3fro.1.A	15.43	homo-trimer	HHblits	X-ray	2.50Å	0.27	0.91	GlgA glycogen synthase
3fro.1.B	15.43	homo-trimer	HHblits	X-ray	2.50Å	0.27	0.91	GlgA glycogen synthase
3fro.1.C	15.43	homo-trimer	HHblits	X-ray	2.50Å	0.27	0.91	GlgA glycogen synthase
5u6n.2.A	14.33	monomer	HHblits	X-ray	2.00Å	0.27	0.90	UDP-glycosyltransferase 74F2
5u6n.1.A	14.33	monomer	HHblits	X-ray	2.00Å	0.27	0.90	UDP-glycosyltransferase 74F2
2iv7.1.A	14.38	monomer	HHblits	X-ray	1.60Å	0.27	0.90	LIPOPOLYSACCHARIDE CORE BIOSYNTHESIS PROTEIN RFAG
4fkz.1.A	11.35	homo-dimer	HHblits	X-ray	1.69Å	0.26	0.92	UDP-N-acetylglucosamine 2-epimerase
1o6c.1.A	11.35	homo-dimer	HHblits	X-ray	2.90Å	0.26	0.92	UDP-N-acetylglucosamine 2-epimerase
1o6c.1.B	11.35	homo-dimer	HHblits	X-ray	2.90Å	0.26	0.92	UDP-N-acetylglucosamine 2-epimerase
2pq6.1.A	13.66	monomer	HHblits	X-ray	2.10Å	0.27	0.90	UDP-glucuronosyl/UDP-glucosyltransferase
1v4v.1.A	11.38	homo-dimer	HHblits	X-ray	1.80Å	0.26	0.91	UDP-N-Acetylglucosamine 2-Epimerase
1v4v.1.B	11.38	homo-dimer	HHblits	X-ray	1.80Å	0.26	0.91	UDP-N-Acetylglucosamine 2-Epimerase
3c4q.1.A	13.31	homo-dimer	HHblits	X-ray	2.80Å	0.26	0.91	Predicted glycosyltransferases
3c48.1.A	13.00	homo-dimer	HHblits	X-ray	2.10Å	0.26	0.91	Predicted glycosyltransferases
3oka.1.A	9.91	hetero-oligomer	HHblits	X-ray	2.20Å	0.26	0.91	GDP-mannose-dependent alpha-(1-6)-phosphatidylinositol monomannoside mannosyltransferase
3oti.1.A	11.80	monomer	HHblits	X-ray	1.60Å	0.26	0.90	CalG3
3d0r.1.B	11.80	homo-dimer	HHblits	X-ray	1.90Å	0.26	0.90	Protein CalG3
3d0r.1.A	11.80	homo-dimer	HHblits	X-ray	1.90Å	0.26	0.90	Protein CalG3
3d0q.1.A	11.80	homo-dimer	HHblits	X-ray	2.79Å	0.26	0.90	Protein CalG3
5d00.1.A	14.38	homo-dimer	HHblits	X-ray	2.15Å	0.28	0.88	N-acetyl-alpha-D-glucosaminyl L-malate synthase
2gek.1.A	11.49	monomer	HHblits	X-ray	2.40Å	0.25	0.90	PHOSPHATIDYLINOSITOL MANNOSYLTRANSFERASE (PimA)
4nc9.2.A	11.53	monomer	HHblits	X-ray	3.19Å	0.25	0.90	GDP-mannose-dependent alpha-(1-2)-phosphatidylinositol mannosyltransferase
4nc9.1.A	11.53	monomer	HHblits	X-ray	3.19Å	0.25	0.90	GDP-mannose-dependent alpha-(1-2)-phosphatidylinositol mannosyltransferase
4n9w.1.A	11.53	monomer	HHblits	X-ray	1.94Å	0.25	0.90	GDP-mannose-dependent alpha-(1-2)-phosphatidylinositol mannosyltransferase
2vsn.1.A	11.71	monomer	HHblits	X-ray	2.75Å	0.25	0.89	XCOGT
2xgs.1.A	11.39	monomer	HHblits	X-ray	2.39Å	0.25	0.89	XCOGT
2xgm.2.A	11.39	monomer	HHblits	X-ray	2.55Å	0.25	0.89	XCOGT
2vsy.1.A	11.39	monomer	HHblits	X-ray	2.10Å	0.25	0.89	XCC0866
2vsy.2.A	11.39	monomer	HHblits	X-ray	2.10Å	0.25	0.89	XCC0866
3mbo.1.A	12.42	homo-dimer	HHblits	X-ray	3.31Å	0.27	0.86	Glycosyltransferase, group 1 family
3mbo.1.B	12.42	homo-dimer	HHblits	X-ray	3.31Å	0.27	0.86	Glycosyltransferase, group 1 family
3mbo.2.A	12.42	homo-dimer	HHblits	X-ray	3.31Å	0.27	0.86	Glycosyltransferase, group 1 family
3mbo.2.B	12.42	homo-dimer	HHblits	X-ray	3.31Å	0.27	0.86	Glycosyltransferase, group 1 family
3mbo.3.A	12.42	homo-dimer	HHblits	X-ray	3.31Å	0.27	0.86	Glycosyltransferase, group 1 family
3mbo.3.B	12.42	homo-dimer	HHblits	X-ray	3.31Å	0.27	0.86	Glycosyltransferase, group 1 family
3mbo.4.A	12.42	homo-dimer	HHblits	X-ray	3.31Å	0.27	0.86	Glycosyltransferase, group 1 family
3mbo.4.B	12.42	homo-dimer	HHblits	X-ray	3.31Å	0.27	0.86	Glycosyltransferase, group 1 family
2bis.1.A	15.84	monomer	HHblits	X-ray	2.80Å	0.27	0.85	GLGA GLYCOGEN SYNTHASE
2bis.2.A	15.84	monomer	HHblits	X-ray	2.80Å	0.27	0.85	GLGA GLYCOGEN SYNTHASE
2r68.1.A	12.54	monomer	HHblits	X-ray	2.40Å	0.27	0.85	Glycosyl transferase, group 1
4xyw.1.A	13.44	monomer	HHblits	X-ray	2.20Å	0.26	0.86	O-antigen biosynthesis glycosyltransferase WbnH
4xsr.1.A	14.95	homo-dimer	HHblits	X-ray	2.39Å	0.27	0.85	Alr3699 protein
4xsp.1.B	14.95	homo-dimer	HHblits	X-ray	2.15Å	0.27	0.85	Alr3699 protein
4xso.1.A	14.95	homo-dimer	HHblits	X-ray	2.01Å	0.27	0.85	Alr3699 protein
2jjm.1.A	11.41	homo-tetramer	HHblits	X-ray	3.10Å	0.27	0.84	GLYCOSYL TRANSFERASE, GROUP 1 FAMILY PROTEIN
2h1f.1.A	12.75	monomer	HHblits	X-ray	2.40Å	0.27	0.84	Lipopolysaccharide heptosyltransferase-1
2h1f.2.A	12.75	monomer	HHblits	X-ray	2.40Å	0.27	0.84	Lipopolysaccharide heptosyltransferase-1
3oy2.1.A	10.74	homo-dimer	HHblits	X-ray	2.31Å	0.26	0.84	Glycosyltransferase B736L
2xa9.1.A	10.89	monomer	HHblits	X-ray	2.50Å	0.25	0.85	TREHALOSE-SYNTHASE TRET
2xa1.1.A	10.86	monomer	HHblits	X-ray	2.47Å	0.25	0.85	TREHALOSE-SYNTHASE TRET
2x6r.1.A	10.86	monomer	HHblits	X-ray	2.20Å	0.25	0.85	TREHALOSE-SYNTHASE TRET
3okp.1.A	10.33	monomer	HHblits	X-ray	2.00Å	0.26	0.84	GDP-mannose-dependent alpha-(1-6)-phosphatidylinositol monomannoside mannosyltransferase
2gt1.1.A	12.84	monomer	HHblits	X-ray	1.90Å	0.27	0.83	Lipopolysaccharide heptosyltransferase-1
2gt1.2.A	12.84	monomer	HHblits	X-ray	1.90Å	0.27	0.83	Lipopolysaccharide heptosyltransferase-1
2xci.1.A	13.54	homo-dimer	HHblits	X-ray	2.00Å	0.27	0.81	3-DEOXY-D-MANNO-2-OCTULOSONIC ACID TRANSFERASE
3hbm.1.A	18.50	monomer	HHblits	X-ray	1.80Å	0.29	0.71	UDP-sugar hydrolase
3hbn.1.A	18.50	monomer	HHblits	X-ray	1.85Å	0.29	0.71	UDP-sugar hydrolase
4x6l.1.A	12.40	homo-trimer	HHblits	X-ray	3.19Å	0.28	0.70	TarM
4x7p.1.A	12.40	homo-trimer	HHblits	X-ray	3.40Å	0.28	0.70	TarM
4x7r.1.A	11.60	monomer	HHblits	X-ray	2.15Å	0.28	0.70	TarM
4x7m.2.A	11.60	monomer	HHblits	X-ray	2.40Å	0.28	0.70	Uncharacterized protein
4x7m.1.A	11.60	monomer	HHblits	X-ray	2.40Å	0.28	0.70	Uncharacterized protein
3q3h.1.A	10.04	monomer	HHblits	X-ray	2.25Å	0.25	0.73	HMW1C-like glycosyltransferase
4wac.1.A	12.10	homo-trimer	HHblits	X-ray	2.40Å	0.28	0.70	Glycosyl transferase, group 1 family protein
4wad.1.A	12.10	homo-trimer	HHblits	X-ray	2.80Å	0.28	0.70	Glycosyl transferase, group 1 family protein
5djs.1.A	8.20	monomer	HHblits	X-ray	2.80Å	0.25	0.72	Tetratricopeptide TPR_2 repeat protein
5hvo.1.A	11.38	homo-dimer	HHblits	X-ray	2.47Å	0.26	0.69	Alpha,alpha-trehalose-phosphate synthase (UDP-forming)
2iv3.1.A	15.66	homo-dimer	HHblits	X-ray	2.30Å	0.25	0.70	GLYCOSYLTRANSFERASE
5jij.1.A	9.35	homo-tetramer	HHblits	X-ray	1.82Å	0.25	0.69	Alpha,alpha-trehalose-phosphate synthase
5jio.1.A	9.35	homo-tetramer	HHblits	X-ray	1.71Å	0.25	0.69	Alpha,alpha-trehalose-phosphate synthase
5l3k.2.D	9.35	homo-tetramer	HHblits	X-ray	2.31Å	0.25	0.69	Alpha,alpha-trehalose-phosphate synthase
4pqg.1.A	10.00	monomer	HHblits	X-ray	2.00Å	0.26	0.67	Glycosyltransferase Gtf1
5lqd.1.A	8.61	homo-dimer	HHblits	X-ray	1.95Å	0.24	0.69	Alpha,alpha-trehalose-phosphate synthase
5lqd.1.B	8.61	homo-dimer	HHblits	X-ray	1.95Å	0.24	0.69	Alpha,alpha-trehalose-phosphate synthase
5e9t.1.A	7.88	hetero-oligomer	HHblits	X-ray	2.92Å	0.25	0.68	Glycosyltransferase Gtf1
5e9t.1.C	7.88	hetero-oligomer	HHblits	X-ray	2.92Å	0.25	0.68	Glycosyltransferase Gtf1
5e9u.1.A	7.88	hetero-oligomer	HHblits	X-ray	3.84Å	0.25	0.68	Glycosyltransferase Gtf1
5e9u.1.C	7.88	hetero-oligomer	HHblits	X-ray	3.84Å	0.25	0.68	Glycosyltransferase Gtf1
5e9u.2.A	7.88	hetero-oligomer	HHblits	X-ray	3.84Å	0.25	0.68	Glycosyltransferase Gtf1
5e9u.2.C	7.88	hetero-oligomer	HHblits	X-ray	3.84Å	0.25	0.68	Glycosyltransferase Gtf1
3s27.1.A	11.91	homo-tetramer	HHblits	X-ray	2.91Å	0.26	0.66	Sucrose synthase 1
3s27.1.B	11.91	homo-tetramer	HHblits	X-ray	2.91Å	0.26	0.66	Sucrose synthase 1
4w6q.1.A	11.21	homo-tetramer	HHblits	X-ray	2.70Å	0.26	0.65	glucosyltransferase
4w6q.1.B	11.21	homo-tetramer	HHblits	X-ray	2.70Å	0.26	0.65	glucosyltransferase
4w6q.1.C	11.21	homo-tetramer	HHblits	X-ray	2.70Å	0.26	0.65	glucosyltransferase
4w6q.1.D	11.21	homo-tetramer	HHblits	X-ray	2.70Å	0.26	0.65	glucosyltransferase
5huv.1.A	12.66	homo-dimer	HHblits	X-ray	2.00Å	0.27	0.64	Alpha,alpha-trehalose-phosphate synthase [UDP-forming]
4rbn.1.A	11.89	homo-tetramer	HHblits	X-ray	3.05Å	0.26	0.64	Sucrose synthase:Glycosyl transferases group 1
4rbn.1.B	11.89	homo-tetramer	HHblits	X-ray	3.05Å	0.26	0.64	Sucrose synthase:Glycosyl transferases group 1
4rbn.1.C	11.89	homo-tetramer	HHblits	X-ray	3.05Å	0.26	0.64	Sucrose synthase:Glycosyl transferases group 1
4rbn.1.D	11.89	homo-tetramer	HHblits	X-ray	3.05Å	0.26	0.64	Sucrose synthase:Glycosyl transferases group 1
4f96.1.A	8.56	homo-dimer	HHblits	X-ray	2.15Å	0.25	0.62	VldE
4f9f.1.A	8.56	homo-dimer	HHblits	X-ray	2.81Å	0.25	0.62	VldE
4f9f.1.B	8.56	homo-dimer	HHblits	X-ray	2.81Å	0.25	0.62	VldE
4f9f.2.A	8.56	homo-dimer	HHblits	X-ray	2.81Å	0.25	0.62	VldE
3t5t.1.A	8.14	homo-dimer	HHblits	X-ray	1.70Å	0.25	0.62	Putative glycosyltransferase
3t5t.1.B	8.14	homo-dimer	HHblits	X-ray	1.70Å	0.25	0.62	Putative glycosyltransferase
3rhz.1.A	9.72	homo-tetramer	HHblits	X-ray	1.90Å	0.25	0.61	Nucleotide sugar synthetase-like protein
3qkw.1.A	9.26	homo-tetramer	HHblits	X-ray	2.29Å	0.25	0.61	Nucleotide sugar synthetase-like protein
3t7d.1.A	8.80	homo-dimer	HHblits	X-ray	1.70Å	0.25	0.61	Putative glycosyltransferase
2q6v.1.A	11.06	monomer	HHblits	X-ray	2.28Å	0.26	0.58	Glucuronosyltransferase GumK
3cv3.1.A	10.10	monomer	HHblits	X-ray	2.25Å	0.25	0.58	Glucuronosyltransferase GumK
3vue.1.A	11.98	monomer	HHblits	X-ray	2.70Å	0.25	0.54	Granule-bound starch synthase 1, chloroplastic/amyloplastic
5lvv.1.A	13.33	monomer	HHblits	X-ray	2.54Å	0.25	0.46	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit,UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit
4bfc.1.A	14.10	homo-trimer	HHblits	X-ray	1.70Å	0.28	0.44	3-DEOXY-D-MANNO-OCTULOSONIC-ACID TRANSFERASE
2o6l.1.A	24.16	homo-dimer	HHblits	X-ray	1.80Å	0.31	0.42	UDP-glucuronosyltransferase 2B7
2o6l.1.B	24.16	homo-dimer	HHblits	X-ray	1.80Å	0.31	0.42	UDP-glucuronosyltransferase 2B7
2bfw.1.A	13.70	monomer	HHblits	X-ray	1.80Å	0.27	0.41	GLGA GLYCOGEN SYNTHASE
5tvg.1.A	9.40	homo-tetramer	HHblits	X-ray	2.30Å	0.25	0.42	Alpha,alpha-trehalose-phosphate synthase (UDP-forming)
5tvg.2.A	9.40	homo-tetramer	HHblits	X-ray	2.30Å	0.25	0.42	Alpha,alpha-trehalose-phosphate synthase (UDP-forming)
5a01.1.A	11.56	monomer	HHblits	X-ray	2.66Å	0.25	0.41	O-GLYCOSYLTRANSFERASE
4ay5.1.A	12.93	hetero-oligomer	HHblits	X-ray	3.15Å	0.25	0.41	UDP-N-ACETYLGLUCOSAMINE--PEPTIDE N-ACETYLGLUCOSAMINYL TRANSFERASE 110 KDA SUBUNIT
4gyw.1.A	12.93	hetero-oligomer	HHblits	X-ray	1.70Å	0.25	0.41	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit
4n3c.1.A	12.93	hetero-oligomer	HHblits	X-ray	2.55Å	0.25	0.41	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit
5c1d.1.A	12.93	monomer	HHblits	X-ray	2.05Å	0.25	0.41	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit
5hgv.1.A	12.93	hetero-oligomer	HHblits	X-ray	2.05Å	0.25	0.41	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit
5lwv.1.A	12.93	monomer	HHblits	X-ray	1.90Å	0.25	0.41	Host cell factor 1,UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit
5e9u.1.B	9.66	hetero-oligomer	HHblits	X-ray	3.84Å	0.26	0.41	Glycosyltransferase-stabilizing protein Gtf2
5e9u.1.D	9.66	hetero-oligomer	HHblits	X-ray	3.84Å	0.26	0.41	Glycosyltransferase-stabilizing protein Gtf2
5e9u.2.B	9.66	hetero-oligomer	HHblits	X-ray	3.84Å	0.26	0.41	Glycosyltransferase-stabilizing protein Gtf2
5e9u.2.D	9.66	hetero-oligomer	HHblits	X-ray	3.84Å	0.26	0.41	Glycosyltransferase-stabilizing protein Gtf2
2f9f.1.A	13.38	monomer	HHblits	X-ray	1.80Å	0.27	0.40	first mannosyl transferase (wbaZ-1)
2jzc.1.A	22.14	monomer	HHblits	NMR	NA	0.30	0.37	UDP-N-acetylglucosamine transferase subunit ALG13
2ks6.1.A	22.14	monomer	HHblits	NMR	NA	0.30	0.37	UDP-N-acetylglucosamine transferase subunit ALG13
5i45.1.A	12.12	monomer	HHblits	X-ray	1.35Å	0.28	0.37	Glycosyl transferases group 1 family protein
3qhp.1.A	17.83	monomer	HHblits	X-ray	1.50Å	0.29	0.36	Type 1 capsular polysaccharide biosynthesis protein J (CapJ)
3qhp.2.A	17.83	monomer	HHblits	X-ray	1.50Å	0.29	0.36	Type 1 capsular polysaccharide biosynthesis protein J (CapJ)
2x0d.1.A	17.69	homo-dimer	HHblits	X-ray	2.28Å	0.28	0.37	WSAF
5u09.1.A	16.92	monomer	HHblits	X-ray	2.60Å	0.28	0.37	Cannabinoid receptor 1,GlgA glycogen synthase
2x0f.1.A	16.15	homo-dimer	HHblits	X-ray	2.55Å	0.27	0.37	WSAF
5dxf.1.A	16.54	monomer	HHblits	X-ray	2.56Å	0.29	0.36	trehalose-6-phosphate phosphatase
5dxf.2.A	16.54	monomer	HHblits	X-ray	2.56Å	0.29	0.36	trehalose-6-phosphate phosphatase
5hut.1.A	13.28	homo-dimer	HHblits	X-ray	1.90Å	0.27	0.36	Alpha,alpha-trehalose-phosphate synthase [UDP-forming]
5hvm.1.A	14.06	homo-dimer	HHblits	X-ray	2.82Å	0.27	0.36	Alpha,alpha-trehalose-phosphate synthase (UDP-forming)
2wtx.1.A	14.96	homo-dimer	HHblits	X-ray	2.20Å	0.28	0.36	ALPHA, ALPHA-TREHALOSE-PHOSPHATE SYNTHASE [UDP-FORMING]
2wtx.1.B	14.96	homo-dimer	HHblits	X-ray	2.20Å	0.28	0.36	ALPHA, ALPHA-TREHALOSE-PHOSPHATE SYNTHASE [UDP-FORMING]
4s0v.1.A	16.54	monomer	HHblits	X-ray	2.50Å	0.27	0.36	Human Orexin receptor type 2 fusion protein to P. abysii Glycogen Synthase
1gz5.1.A	14.96	homo-tetramer	HHblits	X-ray	2.43Å	0.27	0.36	ALPHA-TREHALOSE-PHOSPHATE SYNTHASE
1uqu.1.A	14.17	monomer	HHblits	X-ray	2.00Å	0.27	0.36	ALPHA, ALPHA-TREHALOSE-PHOSPHATE SYNTHASE
1uqu.2.A	14.17	monomer	HHblits	X-ray	2.00Å	0.27	0.36	ALPHA, ALPHA-TREHALOSE-PHOSPHATE SYNTHASE
5v0t.1.A	12.50	monomer	HHblits	X-ray	1.95Å	0.26	0.36	Alpha,alpha-trehalose-phosphate synthase (UDP-forming)
5uof.1.A	10.16	homo-dimer	HHblits	X-ray	1.70Å	0.26	0.36	Alpha,alpha-trehalose-phosphate synthase (UDP-forming)
4zj8.1.A	15.20	monomer	HHblits	X-ray	2.75Å	0.27	0.35	human OX1R fusion protein to P.abysii glycogen synthase
5hxa.1.A	11.81	homo-dimer	HHblits	X-ray	2.00Å	0.25	0.36	Alpha,alpha-trehalose-phosphate synthase (UDP-forming)
5e9t.1.B	11.48	hetero-oligomer	HHblits	X-ray	2.92Å	0.26	0.34	Glycosyltransferase-stabilizing protein Gtf2
5e9t.1.D	11.48	hetero-oligomer	HHblits	X-ray	2.92Å	0.26	0.34	Glycosyltransferase-stabilizing protein Gtf2
4i36.1.A	23.21	homo-tetramer	HHblits	X-ray	2.30Å	0.30	0.31	6-phosphofructokinase
4i7e.1.B	23.21	homo-tetramer	HHblits	X-ray	2.00Å	0.30	0.31	6-phosphofructokinase
1mto.1.A	23.21	homo-tetramer	HHblits	X-ray	3.20Å	0.30	0.31	6-phosphofructokinase
6pfk.1.A	23.21	homo-tetramer	HHblits	X-ray	2.60Å	0.30	0.31	PHOSPHOFRUCTOKINASE
3u39.1.A	23.21	homo-tetramer	HHblits	X-ray	2.79Å	0.30	0.31	6-phosphofructokinase
3pfk.1.A	23.21	homo-tetramer	HHblits	X-ray	2.40Å	0.30	0.31	PHOSPHOFRUCTOKINASE
1psw.1.A	16.67	monomer	HHblits	X-ray	2.00Å	0.29	0.29	ADP-HEPTOSE LPS HEPTOSYLTRANSFERASE II
4qsk.1.A	13.73	homo-tetramer	HHblits	X-ray	2.70Å	0.28	0.29	Pyruvate carboxylase
4hnu.1.A	17.65	homo-tetramer	HHblits	X-ray	3.00Å	0.27	0.29	Pyruvate carboxylase
4hnu.1.B	17.65	homo-tetramer	HHblits	X-ray	3.00Å	0.27	0.29	Pyruvate carboxylase
4hnu.1.C	17.65	homo-tetramer	HHblits	X-ray	3.00Å	0.27	0.29	Pyruvate carboxylase
4hnu.1.D	17.65	homo-tetramer	HHblits	X-ray	3.00Å	0.27	0.29	Pyruvate carboxylase
3l7i.1.A	15.31	homo-tetramer	HHblits	X-ray	2.70Å	0.30	0.28	Teichoic acid biosynthesis protein F
5vyw.1.A	14.00	homo-tetramer	HHblits	X-ray	3.10Å	0.28	0.28	Pyruvate carboxylase
5vyw.1.C	14.00	homo-tetramer	HHblits	X-ray	3.10Å	0.28	0.28	Pyruvate carboxylase
3hb9.1.A	17.17	homo-tetramer	HHblits	X-ray	2.90Å	0.28	0.28	Pyruvate carboxylase
3hb9.1.B	17.17	homo-tetramer	HHblits	X-ray	2.90Å	0.28	0.28	Pyruvate carboxylase
3hb9.1.C	17.17	homo-tetramer	HHblits	X-ray	2.90Å	0.28	0.28	Pyruvate carboxylase
3hb9.1.D	17.17	homo-tetramer	HHblits	X-ray	2.90Å	0.28	0.28	Pyruvate carboxylase
3ho8.1.A	16.00	homo-tetramer	HHblits	X-ray	2.90Å	0.27	0.28	Pyruvate carboxylase
3ho8.1.B	16.00	homo-tetramer	HHblits	X-ray	2.90Å	0.27	0.28	Pyruvate carboxylase
3ho8.1.C	16.00	homo-tetramer	HHblits	X-ray	2.90Å	0.27	0.28	Pyruvate carboxylase
3ho8.1.D	16.00	homo-tetramer	HHblits	X-ray	2.90Å	0.27	0.28	Pyruvate carboxylase
4x7g.1.A	18.56	monomer	HHblits	X-ray	1.22Å	0.30	0.27	Precorrin-6A reductase
5c4n.1.A	18.56	monomer	HHblits	X-ray	1.63Å	0.30	0.27	Precorrin-6A reductase
5c4r.1.A	17.53	monomer	HHblits	X-ray	3.17Å	0.29	0.27	Precorrin-6A reductase
4hut.1.A	14.74	homo-dimer	HHblits	X-ray	1.95Å	0.28	0.27	Cob(I)yrinic acid a,c-diamide adenosyltransferase
4hut.1.B	14.74	homo-dimer	HHblits	X-ray	1.95Å	0.28	0.27	Cob(I)yrinic acid a,c-diamide adenosyltransferase
1g64.1.A	13.68	homo-dimer	HHblits	X-ray	2.10Å	0.28	0.27	COB(I)ALAMIN ADENOSYLTRANSFERASE
1g5r.1.A	13.68	homo-dimer	HHblits	X-ray	2.10Å	0.28	0.27	COB(I)ALAMIN ADENOSYLTRANSFERASE
4wd3.1.A	10.20	homo-dimer	HHblits	X-ray	2.80Å	0.24	0.28	L-amino acid ligase
3eag.1.A	26.14	homo-dimer	HHblits	X-ray	2.55Å	0.30	0.25	UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-meso-diaminopimelate ligase
3eag.1.B	26.14	homo-dimer	HHblits	X-ray	2.55Å	0.30	0.25	UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-meso-diaminopimelate ligase
1ez1.1.A	14.77	homo-dimer	HHblits	X-ray	1.75Å	0.30	0.25	PHOSPHORIBOSYLGLYCINAMIDE FORMYLTRANSFERASE 2
1ez1.1.B	14.77	homo-dimer	HHblits	X-ray	1.75Å	0.30	0.25	PHOSPHORIBOSYLGLYCINAMIDE FORMYLTRANSFERASE 2
1kji.1.A	14.77	homo-dimer	HHblits	X-ray	1.60Å	0.30	0.25	phosphoribosylglycinamide formyltransferase 2
1kji.1.B	14.77	homo-dimer	HHblits	X-ray	1.60Å	0.30	0.25	phosphoribosylglycinamide formyltransferase 2
3lk7.1.A	20.69	monomer	HHblits	X-ray	1.50Å	0.29	0.24	UDP-N-acetylmuramoylalanine--D-glutamate ligase
3hr8.1.A	10.59	monomer	HHblits	X-ray	1.95Å	0.27	0.24	Protein recA
4zyt.1.A	16.67	monomer	HHblits	X-ray	1.70Å	0.28	0.24	Trifunctional purine biosynthetic protein adenosine-3
5j9f.1.A	16.67	monomer	HHblits	X-ray	2.10Å	0.28	0.24	Trifunctional purine biosynthetic protein adenosine-3
3p9x.1.A	15.48	homo-dimer	HHblits	X-ray	1.90Å	0.28	0.24	phosphoribosylglycinamide formyltransferase
2ywr.1.A	17.86	monomer	HHblits	X-ray	1.77Å	0.27	0.24	Phosphoribosylglycinamide formyltransferase
3av3.1.A	13.10	monomer	HHblits	X-ray	1.70Å	0.27	0.24	Phosphoribosylglycinamide formyltransferase
4ds3.1.A	18.07	homo-dimer	HHblits	X-ray	1.85Å	0.28	0.23	Phosphoribosylglycinamide formyltransferase
3tqr.1.A	14.46	monomer	HHblits	X-ray	1.97Å	0.27	0.23	Phosphoribosylglycinamide formyltransferase
3gar.1.A	14.46	homo-dimer	HHblits	X-ray	1.90Å	0.27	0.23	GLYCINAMIDE RIBONUCLEOTIDE TRANSFORMYLASE
2gar.1.A	14.46	monomer	HHblits	X-ray	1.80Å	0.27	0.23	GLYCINAMIDE RIBONUCLEOTIDE TRANSFORMYLASE
3auf.1.A	11.90	homo-dimer	HHblits	X-ray	2.07Å	0.25	0.24	Glycinamide ribonucleotide transformylase 1
5cjj.1.A	12.05	homo-dimer	HHblits	X-ray	2.42Å	0.25	0.23	Phosphoribosylglycinamide formyltransferase
5cjj.1.B	12.05	homo-dimer	HHblits	X-ray	2.42Å	0.25	0.23	Phosphoribosylglycinamide formyltransferase
4s1n.1.A	17.72	monomer	HHblits	X-ray	2.70Å	0.29	0.22	Phosphoribosylglycinamide formyltransferase
3gh1.1.A	14.10	homo-tetramer	HHblits	X-ray	1.90Å	0.28	0.22	Predicted nucleotide-binding protein
3gh1.1.B	14.10	homo-tetramer	HHblits	X-ray	1.90Å	0.28	0.22	Predicted nucleotide-binding protein
4npa.1.A	14.29	homo-tetramer	HHblits	X-ray	2.10Å	0.28	0.22	Putative uncharacterized protein
3kcq.1.A	16.88	homo-dimer	HHblits	X-ray	2.20Å	0.27	0.22	Phosphoribosylglycinamide formyltransferase
3kcq.1.B	16.88	homo-dimer	HHblits	X-ray	2.20Å	0.27	0.22	Phosphoribosylglycinamide formyltransferase
1qzu.1.A	11.69	homo-trimer	HHblits	X-ray	2.91Å	0.27	0.22	hypothetical protein MDS018
3rsz.1.A	9.33	homo-tetramer	HHblits	X-ray	3.01Å	0.27	0.21	Glycogen [starch] synthase isoform 2
3rt1.1.A	8.00	homo-tetramer	HHblits	X-ray	2.80Å	0.26	0.21	PROTEIN (Glycogen [starch] synthase isoform 2)
3rt1.1.B	8.00	homo-tetramer	HHblits	X-ray	2.80Å	0.26	0.21	PROTEIN (Glycogen [starch] synthase isoform 2)
3rt1.1.C	8.00	homo-tetramer	HHblits	X-ray	2.80Å	0.26	0.21	PROTEIN (Glycogen [starch] synthase isoform 2)
5sul.1.B	8.00	homo-tetramer	HHblits	X-ray	3.30Å	0.26	0.21	Glycogen [starch] synthase isoform 2
5sul.1.C	8.00	homo-tetramer	HHblits	X-ray	3.30Å	0.26	0.21	Glycogen [starch] synthase isoform 2
4kq1.1.B	8.00	homo-tetramer	HHblits	X-ray	2.66Å	0.26	0.21	Gsy2p
4kq1.1.A	8.00	homo-tetramer	HHblits	X-ray	2.66Å	0.26	0.21	Gsy2p
4kq1.1.C	8.00	homo-tetramer	HHblits	X-ray	2.66Å	0.26	0.21	Gsy2p
2khz.1.A	21.43	homo-dimer	HHblits	NMR	NA	0.30	0.20	c-Myc-responsive protein Rcl
4p5e.1.A	16.44	homo-dimer	HHblits	X-ray	1.35Å	0.27	0.21	2'-deoxynucleoside 5'-phosphate N-hydrolase 1
4fyh.1.A	20.00	homo-dimer	HHblits	X-ray	2.44Å	0.30	0.20	Deoxyribonucleoside 5'-monophosphate N-glycosidase
4fyi.1.A	20.00	homo-dimer	HHblits	X-ray	1.96Å	0.30	0.20	Deoxyribonucleoside 5'-monophosphate N-glycosidase
4kxl.2.A	20.00	homo-dimer	HHblits	X-ray	1.69Å	0.30	0.20	2'-deoxynucleoside 5'-phosphate N-hydrolase 1
4kxn.2.B	20.00	homo-dimer	HHblits	X-ray	1.90Å	0.30	0.20	2'-deoxynucleoside 5'-phosphate N-hydrolase 1
4kxm.2.A	20.00	homo-dimer	HHblits	X-ray	2.24Å	0.30	0.20	2'-deoxynucleoside 5'-phosphate N-hydrolase 1
4kxn.1.B	20.00	homo-dimer	HHblits	X-ray	1.90Å	0.30	0.20	2'-deoxynucleoside 5'-phosphate N-hydrolase 1
4p5d.1.B	20.00	homo-dimer	HHblits	X-ray	2.11Å	0.30	0.20	2'-deoxynucleoside 5'-phosphate N-hydrolase 1
5suk.1.A	8.22	homo-tetramer	HHblits	X-ray	2.88Å	0.27	0.21	Glycogen [starch] synthase isoform 2
5suk.1.B	8.22	homo-tetramer	HHblits	X-ray	2.88Å	0.27	0.21	Glycogen [starch] synthase isoform 2
5suk.1.C	8.22	homo-tetramer	HHblits	X-ray	2.88Å	0.27	0.21	Glycogen [starch] synthase isoform 2
4kqm.1.B	8.22	homo-tetramer	HHblits	X-ray	2.77Å	0.27	0.21	Gsy2p
4kqm.1.A	8.22	homo-tetramer	HHblits	X-ray	2.77Å	0.27	0.21	Gsy2p
4kqm.1.C	8.22	homo-tetramer	HHblits	X-ray	2.77Å	0.27	0.21	Gsy2p
2klh.1.A	20.00	homo-dimer	HHblits	NMR	NA	0.30	0.20	c-Myc-responsive protein Rcl
3lqk.1.A	7.89	homo-hexamer	HHblits	X-ray	2.10Å	0.23	0.21	Dipicolinate synthase subunit B
5wq3.1.B	11.27	homo-hexamer	HHblits	X-ray	1.95Å	0.27	0.20	Cytokinin riboside 5'-monophosphate phosphoribohydrolase
5wq3.1.A	11.27	homo-hexamer	HHblits	X-ray	1.95Å	0.27	0.20	Cytokinin riboside 5'-monophosphate phosphoribohydrolase
4qlb.1.A	8.22	hetero-oligomer	HHblits	X-ray	2.60Å	0.25	0.21	Probable glycogen [starch] synthase
4qlb.1.B	8.22	hetero-oligomer	HHblits	X-ray	2.60Å	0.25	0.21	Probable glycogen [starch] synthase
1rc0.1.A	14.71	monomer	HHblits	X-ray	2.05Å	0.28	0.19	PHOSPHORIBOSYLGLYCINAMIDE FORMYLTRANSFERASE
1meo.1.A	14.71	monomer	HHblits	X-ray	1.72Å	0.28	0.19	Phosphoribosylglycinamide formyltransferase
1zly.1.A	14.93	monomer	HHblits	X-ray	2.07Å	0.28	0.19	Phosphoribosylglycinamide formyltransferase
1eiw.1.A	15.38	monomer	HHblits	NMR	NA	0.25	0.18	HYPOTHETICAL PROTEIN MTH538
3b2n.1.A	22.41	monomer	HHblits	X-ray	2.04Å	0.31	0.16	Uncharacterized protein Q99UF4
3pfn.1.A	13.79	homo-tetramer	HHblits	X-ray	2.70Å	0.29	0.16	NAD kinase
1g63.1.A	14.04	homo-12-mer	HHblits	X-ray	2.50Å	0.26	0.16	EPIDERMIN MODIFYING ENZYME EPID
3mcu.1.A	11.86	homo-hexamer	HHblits	X-ray	2.30Å	0.23	0.17	Dipicolinate synthase, B chain
3mcu.1.E	11.86	homo-hexamer	HHblits	X-ray	2.30Å	0.23	0.17	Dipicolinate synthase, B chain
1yt5.1.B	14.55	homo-dimer	HHblits	X-ray	2.30Å	0.29	0.15	inorganic polyphosphate/ATP-NAD kinase
1yt5.1.A	14.55	homo-dimer	HHblits	X-ray	2.30Å	0.29	0.15	inorganic polyphosphate/ATP-NAD kinase
1yt5.2.B	14.55	homo-dimer	HHblits	X-ray	2.30Å	0.29	0.15	inorganic polyphosphate/ATP-NAD kinase
1g5q.1.A	12.28	homo-12-mer	HHblits	X-ray	2.57Å	0.25	0.16	EPIDERMIN MODIFYING ENZYME EPID
2an1.1.A	16.36	homo-dimer	HHblits	X-ray	2.00Å	0.27	0.15	putative kinase
2an1.1.B	16.36	homo-dimer	HHblits	X-ray	2.00Å	0.27	0.15	putative kinase
2an1.2.A	16.36	homo-dimer	HHblits	X-ray	2.00Å	0.27	0.15	putative kinase
2an1.2.B	16.36	homo-dimer	HHblits	X-ray	2.00Å	0.27	0.15	putative kinase
4hao.1.A	18.52	homo-dimer	HHblits	X-ray	2.55Å	0.28	0.15	Probable inorganic polyphosphate/ATP-NAD kinase
3bic.1.A	10.91	monomer	HHblits	X-ray	2.60Å	0.26	0.15	Methylmalonyl-CoA mutase, mitochondrial precursor
2xij.1.A	10.91	homo-dimer	HHblits	X-ray	1.95Å	0.26	0.15	METHYLMALONYL-COA MUTASE, MITOCHONDRIAL
2xiq.2.A	10.91	monomer	HHblits	X-ray	1.95Å	0.26	0.15	METHYLMALONYL-COA MUTASE, MITOCHONDRIAL
2ejb.1.A	10.91	homo-dimer	HHblits	X-ray	2.15Å	0.25	0.15	Probable aromatic acid decarboxylase
1u6k.1.A	12.24	homo-hexamer	HHblits	X-ray	1.55Å	0.29	0.14	F420-dependent methylenetetrahydromethanopterin dehydrogenase
5nc8.1.A	17.39	homo-dimer	HHblits	X-ray	3.09Å	0.30	0.13	Potassium efflux system protein
5nc8.1.B	17.39	homo-dimer	HHblits	X-ray	3.09Å	0.30	0.13	Potassium efflux system protein
3jzd.1.A	14.89	homo-dimer	HHblits	X-ray	2.10Å	0.28	0.13	Iron-containing alcohol dehydrogenase
3eyw.1.B	17.39	homo-dimer	HHblits	X-ray	2.40Å	0.29	0.13	C-terminal domain of Glutathione-regulated potassium-efflux system protein kefC fused to full length Glutathione-regulated potassium-efflux system ancillary protein kefF
3eyw.1.A	17.39	homo-dimer	HHblits	X-ray	2.40Å	0.29	0.13	C-terminal domain of Glutathione-regulated potassium-efflux system protein kefC fused to full length Glutathione-regulated potassium-efflux system ancillary protein kefF
3l9x.1.A	17.39	homo-dimer	HHblits	X-ray	2.10Å	0.29	0.13	Glutathione-regulated potassium-efflux system protein kefC, linker, ancillary protein kefF
3w5s.1.A	17.39	homo-dimer	HHblits	X-ray	1.49Å	0.27	0.13	Maleylacetate reductase
3w5s.1.B	17.39	homo-dimer	HHblits	X-ray	1.49Å	0.27	0.13	Maleylacetate reductase
1kjn.1.A	6.38	homo-dimer	HHblits	X-ray	2.20Å	0.26	0.13	MTH0777
3hl0.1.A	17.39	homo-dimer	HHblits	X-ray	1.60Å	0.27	0.13	Maleylacetate reductase
3hl0.1.B	17.39	homo-dimer	HHblits	X-ray	1.60Å	0.27	0.13	Maleylacetate reductase
1qzu.1.A	15.56	homo-trimer	HHblits	X-ray	2.91Å	0.28	0.13	hypothetical protein MDS018
3ce9.1.A	17.78	homo-tetramer	HHblits	X-ray	2.37Å	0.27	0.13	Glycerol dehydrogenase
5its.1.A	21.95	homo-dimer	HHblits	X-ray	2.30Å	0.34	0.12	Cytokinin riboside 5'-monophosphate phosphoribohydrolase
5its.2.B	21.95	homo-dimer	HHblits	X-ray	2.30Å	0.34	0.12	Cytokinin riboside 5'-monophosphate phosphoribohydrolase
1jqa.1.A	13.64	homo-octamer	HHblits	X-ray	2.05Å	0.29	0.12	Glycerol Dehydrogenase
1jq5.1.A	13.64	homo-octamer	HHblits	X-ray	1.70Å	0.29	0.12	Glycerol dehydrogenase
5xn8.1.A	13.33	homo-octamer	HHblits	X-ray	2.33Å	0.27	0.13	Glycerol Dehydrogenase
4mca.1.A	15.91	homo-16-mer	HHblits	X-ray	1.90Å	0.27	0.12	Glycerol dehydrogenase
5c4r.1.A	27.50	monomer	HHblits	X-ray	3.17Å	0.33	0.11	Precorrin-6A reductase
4x7g.1.A	27.50	monomer	HHblits	X-ray	1.22Å	0.33	0.11	Precorrin-6A reductase
5c4n.1.A	27.50	monomer	HHblits	X-ray	1.63Å	0.33	0.11	Precorrin-6A reductase
3bq9.1.A	17.07	homo-tetramer	HHblits	X-ray	1.80Å	0.30	0.12	Predicted Rossmann fold nucleotide-binding domain-containing protein
2pfk.1.A	26.83	homo-tetramer	HHblits	X-ray	2.40Å	0.28	0.12	6-PHOSPHOFRUCTOKINASE ISOZYME I
1pfk.1.A	26.83	homo-tetramer	HHblits	X-ray	2.40Å	0.28	0.12	PHOSPHOFRUCTOKINASE
1xd9.1.A	23.68	homo-dimer	HHblits	X-ray	2.80Å	0.34	0.11	Nitrogenase iron protein 1
3v4z.1.A	17.50	homo-dimer	HHblits	X-ray	2.69Å	0.30	0.11	D-alanine--D-alanine ligase
3v4z.1.B	17.50	homo-dimer	HHblits	X-ray	2.69Å	0.30	0.11	D-alanine--D-alanine ligase
3r9i.1.B	23.08	hetero-oligomer	HHblits	X-ray	2.60Å	0.32	0.11	Septum site-determining protein minD
3q9l.1.A	23.08	homo-dimer	HHblits	X-ray	2.34Å	0.32	0.11	Septum site-determining protein minD
1xdb.1.A	23.68	homo-dimer	HHblits	X-ray	2.80Å	0.34	0.11	Nitrogenase iron protein 1
1de0.1.A	23.68	homo-dimer	HHblits	X-ray	2.40Å	0.34	0.11	NITROGENASE IRON PROTEIN
1xcp.1.A	23.68	homo-dimer	HHblits	X-ray	3.20Å	0.34	0.11	Nitrogenase iron protein 1
1xcp.2.A	23.68	homo-dimer	HHblits	X-ray	3.20Å	0.34	0.11	Nitrogenase iron protein 1
1m34.1.E	23.68	hetero-oligomer	HHblits	X-ray	2.30Å	0.34	0.11	Nitrogenase Iron Protein 1
1m1y.1.E	23.68	hetero-oligomer	HHblits	X-ray	3.20Å	0.34	0.11	nitrogenase IRON protein 1
1m1y.1.F	23.68	hetero-oligomer	HHblits	X-ray	3.20Å	0.34	0.11	nitrogenase IRON protein 1
2afi.1.E	23.68	hetero-oligomer	HHblits	X-ray	3.10Å	0.34	0.11	Nitrogenase iron protein 1
2afh.1.E	23.68	hetero-oligomer	HHblits	X-ray	2.10Å	0.34	0.11	Nitrogenase iron protein 1
2afh.1.F	23.68	hetero-oligomer	HHblits	X-ray	2.10Å	0.34	0.11	Nitrogenase iron protein 1
1g5p.1.A	23.68	homo-dimer	HHblits	X-ray	2.20Å	0.34	0.11	NITROGENASE IRON PROTEIN
1g5p.1.B	23.68	homo-dimer	HHblits	X-ray	2.20Å	0.34	0.11	NITROGENASE IRON PROTEIN
1g1m.1.A	23.68	homo-dimer	HHblits	X-ray	2.25Å	0.34	0.11	NITROGENASE IRON PROTEIN
1g1m.1.B	23.68	homo-dimer	HHblits	X-ray	2.25Å	0.34	0.11	NITROGENASE IRON PROTEIN
1fp6.1.A	23.68	homo-dimer	HHblits	X-ray	2.15Å	0.34	0.11	NITROGENASE IRON PROTEIN
1nip.1.A	23.68	homo-dimer	HHblits	X-ray	2.90Å	0.34	0.11	NITROGENASE IRON PROTEIN
1nip.1.B	23.68	homo-dimer	HHblits	X-ray	2.90Å	0.34	0.11	NITROGENASE IRON PROTEIN
4wzb.1.F	23.68	hetero-oligomer	HHblits	X-ray	2.30Å	0.34	0.11	Nitrogenase iron protein 1
4wzb.1.E	23.68	hetero-oligomer	HHblits	X-ray	2.30Å	0.34	0.11	Nitrogenase iron protein 1
2c8v.1.A	23.68	monomer	HHblits	X-ray	2.50Å	0.34	0.11	NITROGENASE IRON PROTEIN 1
1rw4.1.A	23.68	homo-dimer	HHblits	X-ray	2.50Å	0.34	0.11	Nitrogenase iron protein 1
4wza.1.E	23.68	hetero-oligomer	HHblits	X-ray	1.90Å	0.34	0.11	Nitrogenase iron protein 1
4wza.1.F	23.68	hetero-oligomer	HHblits	X-ray	1.90Å	0.34	0.11	Nitrogenase iron protein 1
1g20.1.E	23.68	hetero-oligomer	HHblits	X-ray	2.20Å	0.34	0.11	NITROGENASE IRON PROTEIN
1g21.1.H	23.68	hetero-oligomer	HHblits	X-ray	3.00Å	0.34	0.11	NITROGENASE IRON PROTEIN
1g21.1.E	23.68	hetero-oligomer	HHblits	X-ray	3.00Å	0.34	0.11	NITROGENASE IRON PROTEIN
4v02.1.A	28.95	hetero-oligomer	HHblits	X-ray	2.70Å	0.34	0.11	SITE-DETERMINING PROTEIN
4v03.1.A	28.95	homo-dimer	HHblits	X-ray	1.90Å	0.34	0.11	SITE-DETERMINING PROTEIN
1xp8.1.A	15.00	homo-hexamer	HHblits	X-ray	2.50Å	0.30	0.11	RecA protein
2ejb.1.A	25.64	homo-dimer	HHblits	X-ray	2.15Å	0.32	0.11	Probable aromatic acid decarboxylase
3pg5.1.A	28.95	monomer	HHblits	X-ray	3.30Å	0.34	0.11	Uncharacterized protein
3pg5.2.A	28.95	monomer	HHblits	X-ray	3.30Å	0.34	0.11	Uncharacterized protein
3pg5.3.A	28.95	monomer	HHblits	X-ray	3.30Å	0.34	0.11	Uncharacterized protein
3pg5.4.A	28.95	monomer	HHblits	X-ray	3.30Å	0.34	0.11	Uncharacterized protein
5jrj.1.A	17.50	homo-hexamer	HHblits	X-ray	1.70Å	0.30	0.11	Protein RecA
1ion.1.A	28.95	monomer	HHblits	X-ray	2.30Å	0.34	0.11	PROBABLE CELL DIVISION INHIBITOR MIND
4rz3.1.A	31.58	homo-dimer	HHblits	X-ray	1.90Å	0.33	0.11	Site-determining protein
4rz3.1.B	31.58	homo-dimer	HHblits	X-ray	1.90Å	0.33	0.11	Site-determining protein
1cp2.1.A	21.05	homo-dimer	HHblits	X-ray	1.93Å	0.33	0.11	NITROGENASE IRON PROTEIN
1cp2.1.B	21.05	homo-dimer	HHblits	X-ray	1.93Å	0.33	0.11	NITROGENASE IRON PROTEIN
4po1.1.A	20.51	monomer	HHblits	X-ray	3.40Å	0.31	0.11	Protein RecA
1g18.1.A	20.51	monomer	HHblits	X-ray	3.80Å	0.31	0.11	RECA PROTEIN
4oqf.1.A	20.51	monomer	HHblits	X-ray	2.80Å	0.31	0.11	Protein RecA
1iov.1.A	20.51	monomer	HHblits	X-ray	2.20Å	0.31	0.11	D-ALA\:D-ALA LIGASE
2zrd.1.A	20.51	monomer	HHblits	X-ray	3.10Å	0.31	0.11	Protein recA
2zrg.1.A	20.51	monomer	HHblits	X-ray	3.50Å	0.31	0.11	Protein recA
1be1.1.A	22.50	monomer	HHblits	NMR	NA	0.28	0.11	GLUTAMATE MUTASE
1id8.1.A	22.50	monomer	HHblits	NMR	NA	0.28	0.11	METHYLASPARTATE MUTASE S CHAIN
1fmf.1.A	22.50	monomer	HHblits	NMR	NA	0.28	0.11	METHYLASPARTATE MUTASE S CHAIN
1g3r.1.A	26.32	monomer	HHblits	X-ray	2.70Å	0.32	0.11	CELL DIVISION INHIBITOR
1zxx.1.A	21.95	homo-tetramer	HHblits	X-ray	1.85Å	0.26	0.12	6-phosphofructokinase
1iow.1.A	20.51	monomer	HHblits	X-ray	1.90Å	0.30	0.11	D-ALA\:D-ALA LIGASE
1hyq.1.A	21.05	monomer	HHblits	X-ray	2.60Å	0.32	0.11	CELL DIVISION INHIBITOR (MIND-1)
1i9c.1.A	22.50	hetero-oligomer	HHblits	X-ray	1.90Å	0.28	0.11	GLUTAMATE MUTASE
1cb7.1.A	22.50	hetero-oligomer	HHblits	X-ray	2.00Å	0.28	0.11	PROTEIN (GLUTAMATE MUTASE)
1b1a.1.A	22.50	monomer	HHblits	NMR	NA	0.28	0.11	GLUTAMATE MUTASE
1rz3.1.A	17.50	monomer	HHblits	X-ray	1.90Å	0.28	0.11	hypothetical protein RBSTP0775
5j1j.1.A	29.73	homo-dimer	HHblits	X-ray	1.55Å	0.34	0.10	Site-determining protein
5j1j.1.B	29.73	homo-dimer	HHblits	X-ray	1.55Å	0.34	0.10	Site-determining protein
5jvf.1.A	29.73	monomer	HHblits	X-ray	1.66Å	0.34	0.10	Site-determining protein
4rz2.1.A	32.43	monomer	HHblits	X-ray	2.80Å	0.34	0.10	Site-determining protein
4qji.1.A	21.05	monomer	HHblits	X-ray	2.65Å	0.32	0.11	Phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase
3f6r.1.A	23.68	monomer	HHblits	X-ray	2.00Å	0.32	0.11	Flavodoxin
3f6s.1.A	23.68	monomer	HHblits	X-ray	2.50Å	0.32	0.11	Flavodoxin
1e4e.1.A	29.73	hetero-oligomer	HHblits	X-ray	2.50Å	0.34	0.10	VANCOMYCIN/TEICOPLANIN A-TYPE RESISTANCE PROTEIN VANA
4e07.1.A	18.42	monomer	HHblits	X-ray	2.90Å	0.32	0.11	Plasmid partitioning protein ParF
4e09.1.A	18.42	homo-dimer	HHblits	X-ray	2.99Å	0.32	0.11	Plasmid partitioning protein ParF
4e03.1.A	18.42	monomer	HHblits	X-ray	2.45Å	0.32	0.11	Plasmid partitioning protein ParF
4e03.2.A	18.42	monomer	HHblits	X-ray	2.45Å	0.32	0.11	Plasmid partitioning protein ParF
4dzz.1.A	18.42	monomer	HHblits	X-ray	1.80Å	0.32	0.11	Plasmid partitioning protein ParF
4dzz.2.A	18.42	monomer	HHblits	X-ray	1.80Å	0.32	0.11	Plasmid partitioning protein ParF
5u1g.1.A	18.42	hetero-oligomer	HHblits	X-ray	3.64Å	0.32	0.11	ParA
5u1g.2.B	18.42	hetero-oligomer	HHblits	X-ray	3.64Å	0.32	0.11	ParA
5d8d.3.A	15.38	homo-dimer	HHblits	X-ray	2.19Å	0.29	0.11	D-alanine--D-alanine ligase
5d8d.1.B	15.38	homo-dimer	HHblits	X-ray	2.19Å	0.29	0.11	D-alanine--D-alanine ligase
5d8d.2.B	15.38	homo-dimer	HHblits	X-ray	2.19Å	0.29	0.11	D-alanine--D-alanine ligase
5d8d.1.A	15.38	homo-dimer	HHblits	X-ray	2.19Å	0.29	0.11	D-alanine--D-alanine ligase
2yxb.1.A	23.68	monomer	HHblits	X-ray	1.80Å	0.31	0.11	Coenzyme B12-dependent mutase
3igf.1.A	29.73	homo-dimer	HHblits	X-ray	2.00Å	0.33	0.10	All4481 protein
3igf.1.B	29.73	homo-dimer	HHblits	X-ray	2.00Å	0.33	0.10	All4481 protein
5myj.1.B	24.32	hetero-oligomer	HHblits	EM	5.60Å	0.33	0.10	30S ribosomal protein S2
4i4i.1.A	19.51	homo-tetramer	HHblits	X-ray	2.49Å	0.25	0.12	6-phosphofructokinase
4c5a.1.A	21.05	homo-dimer	HHblits	X-ray	1.65Å	0.31	0.11	D-ALANINE--D-ALANINE LIGASE
3cmu.1.B	18.42	monomer	HHblits	X-ray	4.20Å	0.31	0.11	Protein recA
3kjg.2.A	27.03	homo-dimer	HHblits	X-ray	2.30Å	0.33	0.10	CO dehydrogenase/acetyl-CoA synthase complex, accessory protein CooC
3kjg.1.A	27.03	monomer	HHblits	X-ray	2.30Å	0.33	0.10	CO dehydrogenase/acetyl-CoA synthase complex, accessory protein CooC
3kji.1.A	27.03	homo-dimer	HHblits	X-ray	2.13Å	0.33	0.10	CO dehydrogenase/acetyl-CoA synthase complex, accessory protein CooC
3kji.2.A	27.03	homo-dimer	HHblits	X-ray	2.13Å	0.33	0.10	CO dehydrogenase/acetyl-CoA synthase complex, accessory protein CooC
3kjh.1.A	27.03	homo-dimer	HHblits	X-ray	1.90Å	0.33	0.10	CO dehydrogenase/acetyl-CoA synthase complex, accessory protein CooC
3kje.1.A	27.03	monomer	HHblits	X-ray	2.30Å	0.33	0.10	CO dehydrogenase/acetyl-CoA synthase complex, accessory protein CooC
3j9w.1.B	32.43	hetero-oligomer	HHblits	EM	NA	0.33	0.10	30S ribosomal protein uS2
1wcv.1.A	23.68	homo-dimer	HHblits	X-ray	1.60Å	0.31	0.11	SEGREGATION PROTEIN
2bej.1.A	23.68	homo-dimer	HHblits	X-ray	2.10Å	0.31	0.11	SEGREGATION PROTEIN
4v9l.2.A	29.73	hetero-oligomer	HHblits	X-ray	3.50Å	0.33	0.10	30S ribosomal protein S2
4v68.1.B	29.73	hetero-oligomer	HHblits	EM	NA	0.33	0.10	30S ribosomal protein S2
4w29.2.A	29.73	hetero-oligomer	HHblits	X-ray	3.80Å	0.33	0.10	30S ribosomal protein S2
4w29.1.A	29.73	hetero-oligomer	HHblits	X-ray	3.80Å	0.33	0.10	30S ribosomal protein S2
4k0k.1.B	29.73	hetero-oligomer	HHblits	X-ray	3.40Å	0.33	0.10	30S ribosomal protein S2
4v9j.2.A	29.73	hetero-oligomer	HHblits	X-ray	3.86Å	0.33	0.10	30S ribosomal protein S2
4v9k.2.A	29.73	hetero-oligomer	HHblits	X-ray	3.50Å	0.33	0.10	30S ribosomal protein S2
2ph1.1.A	29.73	homo-dimer	HHblits	X-ray	2.70Å	0.33	0.10	Nucleotide-binding protein
1f48.1.A	30.56	monomer	HHblits	X-ray	2.30Å	0.35	0.10	ARSENITE-TRANSLOCATING ATPASE
4r3u.1.B	17.95	hetero-oligomer	HHblits	X-ray	2.50Å	0.29	0.11	2-hydroxyisobutyryl-CoA mutase small subunit
3kb1.1.A	29.73	homo-dimer	HHblits	X-ray	2.90Å	0.32	0.10	Nucleotide-binding protein
4eg0.1.A	12.50	homo-dimer	HHblits	X-ray	1.65Å	0.26	0.11	D-alanine--D-alanine ligase
1vi5.1.A	18.92	monomer	HHblits	X-ray	2.65Å	0.32	0.10	30S ribosomal protein S2P
1vi5.2.A	18.92	monomer	HHblits	X-ray	2.65Å	0.32	0.10	30S ribosomal protein S2P
1vi5.4.A	18.92	monomer	HHblits	X-ray	2.65Å	0.32	0.10	30S ribosomal protein S2P
2ynm.1.A	29.73	hetero-oligomer	HHblits	X-ray	2.10Å	0.32	0.10	LIGHT-INDEPENDENT PROTOCHLOROPHYLLIDE REDUCTASE IRON-SULFUR ATP-BINDING PROTEIN
3fkq.1.A	24.32	homo-dimer	HHblits	X-ray	2.10Å	0.32	0.10	NtrC-like two-domain protein
4a3s.1.A	19.51	homo-tetramer	HHblits	X-ray	2.30Å	0.24	0.12	6-PHOSPHOFRUCTOKINASE
3ug7.1.A	21.62	homo-tetramer	HHblits	X-ray	2.90Å	0.32	0.10	arsenical pump-driving ATPase
3ug6.1.A	21.62	homo-tetramer	HHblits	X-ray	3.30Å	0.32	0.10	arsenical pump-driving ATPase
3k4h.1.A	7.50	homo-dimer	HHblits	X-ray	2.80Å	0.26	0.11	putative transcriptional regulator
3k4h.1.B	7.50	homo-dimer	HHblits	X-ray	2.80Å	0.26	0.11	putative transcriptional regulator
3kpk.1.A	25.00	monomer	HHblits	X-ray	2.05Å	0.34	0.10	Sulfide-quinone reductase, putative
3t2y.1.A	25.00	monomer	HHblits	X-ray	2.50Å	0.34	0.10	Sulfide-quinone reductase, putative
2xit.1.A	21.05	homo-dimer	HHblits	X-ray	1.80Å	0.29	0.11	MIPZ
2xj4.1.A	21.05	monomer	HHblits	X-ray	1.60Å	0.29	0.11	MIPZ
2xj9.1.A	21.05	homo-dimer	HHblits	X-ray	2.80Å	0.29	0.11	MIPZ
2xj9.1.B	21.05	homo-dimer	HHblits	X-ray	2.80Å	0.29	0.11	MIPZ
4v5o.1.K	27.03	hetero-oligomer	HHblits	X-ray	3.93Å	0.32	0.10	RPS0E
3kaq.1.A	18.42	monomer	HHblits	X-ray	2.25Å	0.29	0.11	Flavodoxin
3fmi.1.A	33.33	homo-dimer	HHblits	X-ray	2.18Å	0.34	0.10	Dethiobiotin synthetase
3fmi.1.B	33.33	homo-dimer	HHblits	X-ray	2.18Å	0.34	0.10	Dethiobiotin synthetase
3fmf.2.A	33.33	homo-dimer	HHblits	X-ray	2.05Å	0.34	0.10	Dethiobiotin synthetase
3bfv.1.A	18.92	monomer	HHblits	X-ray	1.80Å	0.31	0.10	Membrane protein CapA1, Protein tyrosine kinase
3e5n.1.A	18.92	homo-dimer	HHblits	X-ray	2.00Å	0.31	0.10	D-alanine-D-alanine ligase A
1nks.1.C	23.08	homo-trimer	HHblits	X-ray	2.57Å	0.27	0.11	ADENYLATE KINASE
1nks.1.B	23.08	homo-trimer	HHblits	X-ray	2.57Å	0.27	0.11	ADENYLATE KINASE
1nks.1.A	23.08	homo-trimer	HHblits	X-ray	2.57Å	0.27	0.11	ADENYLATE KINASE
3whp.1.A	15.38	monomer	HHblits	X-ray	2.52Å	0.27	0.11	Probable transcriptional regulator
5c8d.1.A	15.38	homo-tetramer	HHblits	X-ray	2.80Å	0.27	0.11	Light-dependent transcriptional regulator CarH
5c8d.1.B	15.38	homo-tetramer	HHblits	X-ray	2.80Å	0.27	0.11	Light-dependent transcriptional regulator CarH
5c8d.1.D	15.38	homo-tetramer	HHblits	X-ray	2.80Å	0.27	0.11	Light-dependent transcriptional regulator CarH
5c8d.2.B	15.38	homo-tetramer	HHblits	X-ray	2.80Å	0.27	0.11	Light-dependent transcriptional regulator CarH
5c8d.2.D	15.38	homo-tetramer	HHblits	X-ray	2.80Å	0.27	0.11	Light-dependent transcriptional regulator CarH
5c8e.1.A	15.38	homo-tetramer	HHblits	X-ray	3.89Å	0.27	0.11	Light-dependent transcriptional regulator CarH
5c8e.1.B	15.38	homo-tetramer	HHblits	X-ray	3.89Å	0.27	0.11	Light-dependent transcriptional regulator CarH
5c8e.1.C	15.38	homo-tetramer	HHblits	X-ray	3.89Å	0.27	0.11	Light-dependent transcriptional regulator CarH
5c8f.1.A	15.38	monomer	HHblits	X-ray	2.65Å	0.27	0.11	Light-dependent transcriptional regulator CarH
5l3q.1.B	21.05	hetero-oligomer	HHblits	X-ray	3.20Å	0.29	0.11	Signal recognition particle receptor subunit alpha
2ved.1.A	18.92	homo-octamer	HHblits	X-ray	2.60Å	0.31	0.10	MEMBRANE PROTEIN CAPA1, PROTEIN TYROSINE KINASE
3rh0.1.A	21.62	monomer	HHblits	X-ray	1.72Å	0.31	0.10	ARSENATE REDUCTASE
3rh0.2.A	21.62	monomer	HHblits	X-ray	1.72Å	0.31	0.10	ARSENATE REDUCTASE
4jmp.1.A	18.92	monomer	HHblits	X-ray	1.30Å	0.31	0.10	C-terminal fragment of CapA, Protein tyrosine kinase
5aun.1.B	27.03	hetero-oligomer	HHblits	X-ray	1.63Å	0.31	0.10	ATPase involved in chromosome partitioning, ParA/MinD family, Mrp homolog
3vx3.1.A	27.03	homo-dimer	HHblits	X-ray	2.10Å	0.31	0.10	ATPase involved in chromosome partitioning, ParA/MinD family, Mrp homolog
5auq.3.A	27.03	homo-dimer	HHblits	X-ray	2.53Å	0.31	0.10	ATPase involved in chromosome partitioning, ParA/MinD family, Mrp homolog
3vx3.1.B	27.03	homo-dimer	HHblits	X-ray	2.10Å	0.31	0.10	ATPase involved in chromosome partitioning, ParA/MinD family, Mrp homolog
4jlv.1.A	21.62	monomer	HHblits	X-ray	2.20Å	0.31	0.10	C-terminal fragment of Membrane protein CapA1, Putative uncharacterized protein capB1
3a4l.1.A	24.32	homo-dimer	HHblits	X-ray	1.80Å	0.31	0.10	L-seryl-tRNA(Sec) kinase
3a4l.1.B	24.32	homo-dimer	HHblits	X-ray	1.80Å	0.31	0.10	L-seryl-tRNA(Sec) kinase
3am1.1.C	24.32	homo-dimer	HHblits	X-ray	2.40Å	0.31	0.10	L-seryl-tRNA(Sec) kinase
2e5l.1.B	30.56	hetero-oligomer	HHblits	X-ray	3.30Å	0.33	0.10	30S ribosomal protein S2
4v7p.2.6	30.56	hetero-oligomer	HHblits	X-ray	3.62Å	0.33	0.10	30S ribosomal protein S2
4gkk.1.B	30.56	hetero-oligomer	HHblits	X-ray	3.20Å	0.33	0.10	30S ribosomal protein S2
4gkj.1.B	30.56	hetero-oligomer	HHblits	X-ray	3.30Å	0.33	0.10	30S ribosomal protein S2
4v4g.2.B	30.56	hetero-oligomer	HHblits	X-ray	11.50Å	0.33	0.10	30S ribosomal protein S2
4v9q.2.5	30.56	hetero-oligomer	HHblits	X-ray	3.40Å	0.33	0.10	30S ribosomal protein S2
4v9i.2.B	30.56	hetero-oligomer	HHblits	X-ray	3.30Å	0.33	0.10	30S Ribosomal protein S2
4jv5.1.B	30.56	hetero-oligomer	HHblits	X-ray	3.16Å	0.33	0.10	30S ribosomal protein S2
4v9h.1.O	30.56	hetero-oligomer	HHblits	X-ray	2.86Å	0.33	0.10	30S ribosomal protein S2
4wt8.2.D	30.56	hetero-oligomer	HHblits	X-ray	3.40Å	0.33	0.10	30S ribosomal protein S2
4v4a.1.B	30.56	hetero-oligomer	HHblits	X-ray	9.50Å	0.33	0.10	30S ribosomal protein S2
4xej.2.2	30.56	hetero-oligomer	HHblits	X-ray	3.80Å	0.33	0.10	30S ribosomal protein S2
5aa0.1.8	30.56	hetero-oligomer	HHblits	EM	5.00Å	0.33	0.10	30S ribosomal protein S2
4yhh.1.B	30.56	hetero-oligomer	HHblits	X-ray	3.42Å	0.33	0.10	30S ribosomal protein S2
5iwa.1.A	30.56	hetero-oligomer	HHblits	X-ray	3.50Å	0.33	0.10	30S ribosomal protein S2
2bek.1.A	24.32	homo-dimer	HHblits	X-ray	1.80Å	0.31	0.10	SEGREGATION PROTEIN
3fwy.1.A	27.03	homo-dimer	HHblits	X-ray	1.63Å	0.31	0.10	Light-independent protochlorophyllide reductase iron-sulfur ATP-binding protein
3fwy.1.B	27.03	homo-dimer	HHblits	X-ray	1.63Å	0.31	0.10	Light-independent protochlorophyllide reductase iron-sulfur ATP-binding protein
1xyv.1.A	21.05	monomer	HHblits	X-ray	1.79Å	0.29	0.11	FLAVODOXIN
4heq.1.A	24.32	homo-dimer	HHblits	X-ray	1.30Å	0.31	0.10	Flavodoxin
3q1k.1.A	13.51	homo-dimer	HHblits	X-ray	2.20Å	0.31	0.10	D-alanine--D-alanine ligase A
3q1k.1.B	13.51	homo-dimer	HHblits	X-ray	2.20Å	0.31	0.10	D-alanine--D-alanine ligase A
5l3w.1.A	15.79	monomer	HHblits	X-ray	2.40Å	0.28	0.11	Signal recognition particle receptor FtsY
5l3s.1.B	15.79	hetero-oligomer	HHblits	X-ray	1.90Å	0.28	0.11	Signal recognition particle receptor FtsY
5l3s.2.B	15.79	hetero-oligomer	HHblits	X-ray	1.90Å	0.28	0.11	Signal recognition particle receptor FtsY
5l3s.3.B	15.79	hetero-oligomer	HHblits	X-ray	1.90Å	0.28	0.11	Signal recognition particle receptor FtsY
5l3s.4.B	15.79	hetero-oligomer	HHblits	X-ray	1.90Å	0.28	0.11	Signal recognition particle receptor FtsY
3mcu.1.A	18.42	homo-hexamer	HHblits	X-ray	2.30Å	0.28	0.11	Dipicolinate synthase, B chain
3mcu.1.E	18.42	homo-hexamer	HHblits	X-ray	2.30Å	0.28	0.11	Dipicolinate synthase, B chain
5dou.1.A	18.42	homo-dimer	HHblits	X-ray	2.60Å	0.28	0.11	Carbamoyl-phosphate synthase [ammonia], mitochondrial
5dot.1.A	18.42	homo-dimer	HHblits	X-ray	2.40Å	0.28	0.11	Carbamoyl-phosphate synthase [ammonia], mitochondrial
4ybb.1.B	24.32	hetero-oligomer	HHblits	X-ray	2.10Å	0.30	0.10	30S ribosomal protein S2
5no3.1.B	24.32	hetero-oligomer	HHblits	EM	NA	0.30	0.10	30S ribosomal protein S2
4v75.1.A	24.32	hetero-oligomer	HHblits	EM	NA	0.30	0.10	30S ribosomal protein S2
4v72.1.A	24.32	hetero-oligomer	HHblits	EM	NA	0.30	0.10	30S ribosomal protein S2
4v70.1.A	24.32	hetero-oligomer	HHblits	EM	NA	0.30	0.10	30S ribosomal protein S2
4v73.1.A	24.32	hetero-oligomer	HHblits	EM	NA	0.30	0.10	30S ribosomal protein S2
4v6y.1.A	24.32	hetero-oligomer	HHblits	EM	NA	0.30	0.10	30S ribosomal protein S2
4v71.1.A	24.32	hetero-oligomer	HHblits	EM	NA	0.30	0.10	30S ribosomal protein S2
4v6z.1.A	24.32	hetero-oligomer	HHblits	EM	NA	0.30	0.10	30S ribosomal protein S2
4v74.1.A	24.32	hetero-oligomer	HHblits	EM	NA	0.30	0.10	30S ribosomal protein S2
4v77.1.A	24.32	hetero-oligomer	HHblits	EM	NA	0.30	0.10	30S ribosomal protein S2
4v76.1.A	24.32	hetero-oligomer	HHblits	EM	NA	0.30	0.10	30S ribosomal protein S2
4v7a.1.A	24.32	hetero-oligomer	HHblits	EM	NA	0.30	0.10	30S ribosomal protein S2
4v79.1.A	24.32	hetero-oligomer	HHblits	EM	NA	0.30	0.10	30S ribosomal protein S2
4v78.1.A	24.32	hetero-oligomer	HHblits	EM	NA	0.30	0.10	30S ribosomal protein S2
3gv0.1.A	18.42	monomer	HHblits	X-ray	2.35Å	0.28	0.11	Transcriptional regulator, LacI family
3cio.1.A	21.62	homo-dimer	HHblits	X-ray	2.50Å	0.30	0.10	Tyrosine-protein kinase etk
3cio.1.B	21.62	homo-dimer	HHblits	X-ray	2.50Å	0.30	0.10	Tyrosine-protein kinase etk
4v4b.1.C	21.62	hetero-oligomer	HHblits	EM	NA	0.30	0.10	40S ribosomal protein S0-A
5m1j.2.A	21.62	monomer	HHblits	EM	3.30Å	0.30	0.10	40S ribosomal protein S0-A
5lyb.1.A	21.62	monomer	HHblits	X-ray	3.25Å	0.30	0.10	40S ribosomal protein S0-A
5tga.76.A	21.62	monomer	HHblits	X-ray	3.30Å	0.30	0.10	40S ribosomal protein S0-A
4v92.1.C	21.62	hetero-oligomer	HHblits	EM	3.70Å	0.30	0.10	US2
4v88.1.A	21.62	monomer	HHblits	X-ray	3.00Å	0.30	0.10	40S ribosomal protein S0-A
3j77.46.A	21.62	monomer	HHblits	EM	NA	0.30	0.10	40S ribosomal protein S0
4v7r.1.A	21.62	monomer	HHblits	X-ray	4.00Å	0.30	0.10	40S ribosomal protein S0-A
4v6i.2.A	21.62	monomer	HHblits	EM	NA	0.30	0.10	40S ribosomal protein rpS0 (S2p)
3j78.46.A	21.62	monomer	HHblits	EM	NA	0.30	0.10	40S ribosomal protein S0
3j6y.43.A	21.62	monomer	HHblits	EM	NA	0.30	0.10	40S ribosomal protein S0
3j6x.43.A	21.62	monomer	HHblits	EM	NA	0.30	0.10	40S ribosomal protein S0
4v88.76.A	21.62	monomer	HHblits	X-ray	3.00Å	0.30	0.10	40S ribosomal protein S0-A
5mc6.16.A	21.62	monomer	HHblits	EM	NA	0.30	0.10	40S ribosomal protein S0-A
5ll6.1.B	21.62	hetero-oligomer	HHblits	EM	NA	0.30	0.10	40S ribosomal protein S0-A
5jut.46.A	21.62	monomer	HHblits	EM	NA	0.30	0.10	uS2 (yeast S0)
5juo.46.A	21.62	monomer	HHblits	EM	NA	0.30	0.10	uS2 (yeast S0)
5juu.46.A	21.62	monomer	HHblits	EM	NA	0.30	0.10	uS2 (yeast S0)
5jup.46.A	21.62	monomer	HHblits	EM	NA	0.30	0.10	uS2 (yeast S0)
5jus.46.A	21.62	monomer	HHblits	EM	NA	0.30	0.10	uS2 (yeast S0)
1dts.1.A	25.00	homo-dimer	HHblits	X-ray	1.65Å	0.32	0.10	DETHIOBIOTIN SYNTHETASE
1u6k.1.A	18.92	homo-hexamer	HHblits	X-ray	1.55Å	0.30	0.10	F420-dependent methylenetetrahydromethanopterin dehydrogenase
5k5z.1.A	21.05	homo-dimer	HHblits	X-ray	2.37Å	0.28	0.11	ParA
5k5z.2.A	21.05	homo-dimer	HHblits	X-ray	2.37Å	0.28	0.11	ParA
5k5z.2.B	21.05	homo-dimer	HHblits	X-ray	2.37Å	0.28	0.11	ParA
4fu0.1.A	19.44	homo-dimer	HHblits	X-ray	2.35Å	0.32	0.10	D-alanine--D-alanine ligase 7
4fu0.1.B	19.44	homo-dimer	HHblits	X-ray	2.35Å	0.32	0.10	D-alanine--D-alanine ligase 7
3la6.1.F	21.62	homo-octamer	HHblits	X-ray	3.20Å	0.30	0.10	Tyrosine-protein kinase wzc
3la6.1.B	21.62	homo-octamer	HHblits	X-ray	3.20Å	0.30	0.10	Tyrosine-protein kinase wzc
3la6.1.C	21.62	homo-octamer	HHblits	X-ray	3.20Å	0.30	0.10	Tyrosine-protein kinase wzc
3la6.1.D	21.62	homo-octamer	HHblits	X-ray	3.20Å	0.30	0.10	Tyrosine-protein kinase wzc
3la6.1.E	21.62	homo-octamer	HHblits	X-ray	3.20Å	0.30	0.10	Tyrosine-protein kinase wzc
3la6.1.A	21.62	homo-octamer	HHblits	X-ray	3.20Å	0.30	0.10	Tyrosine-protein kinase wzc
3la6.1.G	21.62	homo-octamer	HHblits	X-ray	3.20Å	0.30	0.10	Tyrosine-protein kinase wzc
3la6.1.H	21.62	homo-octamer	HHblits	X-ray	3.20Å	0.30	0.10	Tyrosine-protein kinase wzc
3la6.2.C	21.62	homo-octamer	HHblits	X-ray	3.20Å	0.30	0.10	Tyrosine-protein kinase wzc
5it7.45.A	18.92	monomer	HHblits	EM	NA	0.30	0.10	40S ribosomal protein S0
2woo.1.A	30.56	homo-dimer	HHblits	X-ray	3.01Å	0.32	0.10	ATPASE GET3
3zq6.1.A	22.22	homo-dimer	HHblits	X-ray	2.11Å	0.32	0.10	PUTATIVE ARSENICAL PUMP-DRIVING ATPASE
3zq6.1.B	22.22	homo-dimer	HHblits	X-ray	2.11Å	0.32	0.10	PUTATIVE ARSENICAL PUMP-DRIVING ATPASE
3zq6.2.A	22.22	homo-dimer	HHblits	X-ray	2.11Å	0.32	0.10	PUTATIVE ARSENICAL PUMP-DRIVING ATPASE
3zq6.2.B	22.22	homo-dimer	HHblits	X-ray	2.11Å	0.32	0.10	PUTATIVE ARSENICAL PUMP-DRIVING ATPASE
5kmp.1.A	18.92	homo-dimer	HHblits	X-ray	3.20Å	0.29	0.10	FAD-dependent pyridine nucleotide-disulfide oxidoreductase
3adb.1.A	25.00	homo-dimer	HHblits	X-ray	2.80Å	0.31	0.10	L-seryl-tRNA(Sec) kinase
3adc.1.B	25.00	homo-dimer	HHblits	X-ray	2.90Å	0.31	0.10	L-seryl-tRNA(Sec) kinase
3adc.1.A	25.00	homo-dimer	HHblits	X-ray	2.90Å	0.31	0.10	L-seryl-tRNA(Sec) kinase
3adb.1.B	25.00	homo-dimer	HHblits	X-ray	2.80Å	0.31	0.10	L-seryl-tRNA(Sec) kinase
3add.1.B	25.00	homo-dimer	HHblits	X-ray	2.40Å	0.31	0.10	L-seryl-tRNA(Sec) kinase
3dhn.1.A	36.36	monomer	HHblits	X-ray	2.00Å	0.38	0.09	NAD-dependent epimerase/dehydratase
5l3r.1.A	24.32	hetero-oligomer	HHblits	X-ray	2.50Å	0.29	0.10	Signal recognition particle 54 kDa protein, chloroplastic
1j8y.1.A	18.92	monomer	HHblits	X-ray	2.00Å	0.29	0.10	SIGNAL RECOGNITION 54 KDA PROTEIN
2qs7.1.A	24.32	homo-trimer	HHblits	X-ray	2.09Å	0.29	0.10	Uncharacterized protein
3h8l.1.A	22.22	homo-dimer	HHblits	X-ray	2.57Å	0.31	0.10	NADH oxidase
5mmj.1.D	22.22	hetero-oligomer	HHblits	EM	3.65Å	0.31	0.10	30S ribosomal protein S2, chloroplastic
5x8r.1.A	22.22	hetero-oligomer	HHblits	EM	NA	0.31	0.10	30S ribosomal protein S2, chloroplastic
1hdo.1.A	32.35	monomer	HHblits	X-ray	1.15Å	0.35	0.10	BILIVERDIN IX BETA REDUCTASE
5f51.1.A	18.92	homo-tetramer	HHblits	X-ray	2.53Å	0.29	0.10	NAD(P)H dehydrogenase (quinone)
3of5.1.A	25.00	homo-dimer	HHblits	X-ray	1.52Å	0.31	0.10	Dethiobiotin synthetase
3i12.1.A	13.89	homo-dimer	HHblits	X-ray	2.20Å	0.31	0.10	D-alanine-D-alanine ligase A
3i12.1.B	13.89	homo-dimer	HHblits	X-ray	2.20Å	0.31	0.10	D-alanine-D-alanine ligase A
3i12.2.A	13.89	homo-dimer	HHblits	X-ray	2.20Å	0.31	0.10	D-alanine-D-alanine ligase A
1dah.1.A	22.22	homo-dimer	HHblits	X-ray	1.64Å	0.31	0.10	DETHIOBIOTIN SYNTHETASE
1byi.1.A	22.22	homo-dimer	HHblits	X-ray	0.97Å	0.31	0.10	DETHIOBIOTIN SYNTHASE
3iqx.1.A	25.00	homo-dimer	HHblits	X-ray	3.50Å	0.31	0.10	Tail-anchored protein targeting factor Get3
3lwb.1.A	19.44	homo-dimer	HHblits	X-ray	2.10Å	0.31	0.10	D-alanine--D-alanine ligase
3lwb.1.B	19.44	homo-dimer	HHblits	X-ray	2.10Å	0.31	0.10	D-alanine--D-alanine ligase
1y80.1.A	17.95	monomer	HHblits	X-ray	1.70Å	0.24	0.11	Predicted cobalamin binding protein
1ki9.1.A	13.51	homo-trimer	HHblits	X-ray	2.76Å	0.28	0.10	adenylate kinase
1ki9.1.B	13.51	homo-trimer	HHblits	X-ray	2.76Å	0.28	0.10	adenylate kinase
1ki9.1.C	13.51	homo-trimer	HHblits	X-ray	2.76Å	0.28	0.10	adenylate kinase
1u80.1.A	20.00	homo-dimer	HHblits	X-ray	2.85Å	0.33	0.10	Coenzyme A biosynthesis bifunctional protein coaBC
1u7u.1.A	20.00	homo-dimer	HHblits	X-ray	2.40Å	0.33	0.10	Coenzyme A biosynthesis bifunctional protein coaBC
4wop.1.A	31.43	homo-dimer	HHblits	X-ray	2.39Å	0.33	0.10	ATP-dependent dethiobiotin synthetase BioD
3fx2.1.A	15.79	monomer	HHblits	X-ray	1.90Å	0.26	0.11	FLAVODOXIN
1j9g.1.A	15.79	monomer	HHblits	X-ray	2.40Å	0.26	0.11	Flavodoxin
1i1o.1.A	15.79	monomer	HHblits	X-ray	2.00Å	0.26	0.11	FLAVODOXIN
1xt6.1.A	15.79	monomer	HHblits	X-ray	1.80Å	0.26	0.11	Flavodoxin
1xjc.1.A	16.22	monomer	HHblits	X-ray	2.10Å	0.28	0.10	MobB protein homolog
5l3q.1.A	18.92	hetero-oligomer	HHblits	X-ray	3.20Å	0.28	0.10	Signal recognition particle 54 kDa protein
2j37.1.G	18.92	hetero-oligomer	HHblits	EM	8.00Å	0.28	0.10	SIGNAL RECOGNITION PARTICLE 54 KDA PROTEIN (SRP54)
1fx1.1.A	21.62	monomer	HHblits	X-ray	2.00Å	0.28	0.10	FLAVODOXIN
1np6.1.A	22.22	homo-dimer	HHblits	X-ray	1.90Å	0.30	0.10	Molybdopterin-guanine dinucleotide biosynthesis protein B
1np6.1.B	22.22	homo-dimer	HHblits	X-ray	1.90Å	0.30	0.10	Molybdopterin-guanine dinucleotide biosynthesis protein B
1akw.1.A	15.79	monomer	HHblits	X-ray	1.75Å	0.26	0.11	FLAVODOXIN
1akr.1.A	15.79	monomer	HHblits	X-ray	1.58Å	0.26	0.11	FLAVODOXIN
1akq.1.A	15.79	monomer	HHblits	X-ray	1.90Å	0.26	0.11	FLAVODOXIN
1azl.1.A	15.79	monomer	HHblits	X-ray	1.80Å	0.26	0.11	FLAVODOXIN
1f4p.1.A	15.79	monomer	HHblits	X-ray	1.30Å	0.26	0.11	FLAVODOXIN
1akt.1.A	15.79	monomer	HHblits	X-ray	1.80Å	0.26	0.11	FLAVODOXIN
1c7f.1.A	15.79	monomer	HHblits	X-ray	2.00Å	0.26	0.11	FLAVODOXIN
5b50.1.A	13.51	monomer	HHblits	X-ray	1.65Å	0.28	0.10	ABC-type transporter, periplasmic component
5b51.1.A	13.51	monomer	HHblits	X-ray	1.30Å	0.28	0.10	ABC-type transporter, periplasmic component
5l3s.1.A	18.92	hetero-oligomer	HHblits	X-ray	1.90Å	0.28	0.10	Signal recognition particle 54 kDa protein
5l3s.4.A	18.92	hetero-oligomer	HHblits	X-ray	1.90Å	0.28	0.10	Signal recognition particle 54 kDa protein
5l3v.1.A	18.92	monomer	HHblits	X-ray	2.30Å	0.28	0.10	Signal recognition particle 54 kDa protein
5l3v.2.A	18.92	monomer	HHblits	X-ray	2.30Å	0.28	0.10	Signal recognition particle 54 kDa protein
5u1j.1.A	21.62	homo-dimer	HHblits	X-ray	2.95Å	0.28	0.10	Uncharacterized protein
5u1j.1.B	21.62	homo-dimer	HHblits	X-ray	2.95Å	0.28	0.10	Uncharacterized protein
5u1j.2.A	21.62	homo-dimer	HHblits	X-ray	2.95Å	0.28	0.10	Uncharacterized protein
5u1j.2.B	21.62	homo-dimer	HHblits	X-ray	2.95Å	0.28	0.10	Uncharacterized protein
1g63.1.A	15.79	homo-12-mer	HHblits	X-ray	2.50Å	0.26	0.11	EPIDERMIN MODIFYING ENZYME EPID
1g5q.1.A	15.79	homo-12-mer	HHblits	X-ray	2.57Å	0.26	0.11	EPIDERMIN MODIFYING ENZYME EPID
3se7.1.A	22.22	homo-dimer	HHblits	X-ray	3.07Å	0.30	0.10	VanA
2pzk.1.A	39.39	homo-dimer	HHblits	X-ray	2.10Å	0.37	0.09	Putative nucleotide sugar epimerase/ dehydratase
4xrr.1.B	33.33	homo-dimer	HHblits	X-ray	2.55Å	0.37	0.09	CalS8
4xrr.1.A	33.33	homo-dimer	HHblits	X-ray	2.55Å	0.37	0.09	CalS8
2ipa.1.B	16.22	hetero-oligomer	HHblits	NMR	NA	0.28	0.10	Protein arsC
5gmo.1.A	26.47	monomer	HHblits	X-ray	2.30Å	0.34	0.10	Protein induced by osmotic stress
3lqk.1.A	13.16	homo-hexamer	HHblits	X-ray	2.10Å	0.26	0.11	Dipicolinate synthase subunit B
1fjg.1.B	28.57	hetero-oligomer	HHblits	X-ray	3.00Å	0.32	0.10	30S RIBOSOMAL PROTEIN S2
2om7.1.N	28.57	hetero-oligomer	HHblits	EM	NA	0.32	0.10	30S ribosomal protein S2
3t1h.1.B	28.57	hetero-oligomer	HHblits	X-ray	3.11Å	0.32	0.10	30S ribosomal protein S2
3oto.1.B	28.57	hetero-oligomer	HHblits	X-ray	3.69Å	0.32	0.10	30S RIBOSOMAL PROTEIN S2
4dr2.1.B	28.57	hetero-oligomer	HHblits	X-ray	3.25Å	0.32	0.10	30S ribosomal protein S2
4kvb.1.B	28.57	hetero-oligomer	HHblits	X-ray	4.20Å	0.32	0.10	30S ribosomal protein S2
4lfa.1.B	28.57	hetero-oligomer	HHblits	X-ray	3.65Å	0.32	0.10	ribosomal protein S2
4lf7.1.B	28.57	hetero-oligomer	HHblits	X-ray	3.15Å	0.32	0.10	ribosomal protein S2
4lfz.2.B	28.57	hetero-oligomer	HHblits	X-ray	3.92Å	0.32	0.10	30S ribosomal protein S2
4v8n.2.B	28.57	hetero-oligomer	HHblits	X-ray	3.10Å	0.32	0.10	30S RIBOSOMAL PROTEIN S2
4v5q.1.B	28.57	hetero-oligomer	HHblits	X-ray	3.10Å	0.32	0.10	30S RIBOSOMAL PROTEIN S2
4v9s.1.B	28.57	hetero-oligomer	HHblits	X-ray	3.10Å	0.32	0.10	30S Ribosomal Protein S2
4v5c.2.B	28.57	hetero-oligomer	HHblits	X-ray	3.30Å	0.32	0.10	30S RIBOSOMAL PROTEIN S2
4v8c.2.5	28.57	hetero-oligomer	HHblits	X-ray	3.30Å	0.32	0.10	30S RIBOSOMAL PROTEIN S2
4v8h.2.B	28.57	hetero-oligomer	HHblits	X-ray	3.10Å	0.32	0.10	30S Ribosomal Protein S2
4v4i.1.8	28.57	hetero-oligomer	HHblits	X-ray	3.71Å	0.32	0.10	30S ribosomal protein S2
4v67.1.E	28.57	hetero-oligomer	HHblits	X-ray	3.00Å	0.32	0.10	30S ribosomal protein S2
4v4p.1.c	28.57	hetero-oligomer	HHblits	X-ray	5.50Å	0.32	0.10	30S ribosomal protein S2
4v4x.1.D	28.57	hetero-oligomer	HHblits	X-ray	5.00Å	0.32	0.10	30S ribosomal protein S2
4v9a.1.B	28.57	hetero-oligomer	HHblits	X-ray	3.30Å	0.32	0.10	30S RIBOSOMAL PROTEIN S2
4v90.1.B	28.57	hetero-oligomer	HHblits	X-ray	2.95Å	0.32	0.10	30S RIBOSOMAL PROTEIN S2
4v9s.2.B	28.57	hetero-oligomer	HHblits	X-ray	3.10Å	0.32	0.10	30S Ribosomal Protein S2
4v8f.1.5	28.57	hetero-oligomer	HHblits	X-ray	3.30Å	0.32	0.10	30S RIBOSOMAL PROTEIN S2
4v9b.1.B	28.57	hetero-oligomer	HHblits	X-ray	3.10Å	0.32	0.10	30S RIBOSOMAL PROTEIN S2
4v5k.2.B	28.57	hetero-oligomer	HHblits	X-ray	3.20Å	0.32	0.10	30S RIBOSOMAL PROTEIN S2
4v5l.1.B	28.57	hetero-oligomer	HHblits	X-ray	3.10Å	0.32	0.10	30S RIBOSOMAL PROTEIN S2
4v95.2.B	28.57	hetero-oligomer	HHblits	X-ray	3.20Å	0.32	0.10	30S Ribosomal Protein S2
4v63.1.E	28.57	hetero-oligomer	HHblits	X-ray	3.21Å	0.32	0.10	30S ribosomal protein S2
4v9a.2.B	28.57	hetero-oligomer	HHblits	X-ray	3.30Å	0.32	0.10	30S RIBOSOMAL PROTEIN S2
4v9b.2.B	28.57	hetero-oligomer	HHblits	X-ray	3.10Å	0.32	0.10	30S RIBOSOMAL PROTEIN S2
4v8u.1.B	28.57	hetero-oligomer	HHblits	X-ray	3.70Å	0.32	0.10	30S RIBOSOMAL PROTEIN S2
4v95.1.B	28.57	hetero-oligomer	HHblits	X-ray	3.20Å	0.32	0.10	30S Ribosomal Protein S2
4v4j.1.8	28.57	hetero-oligomer	HHblits	X-ray	3.83Å	0.32	0.10	30S ribosomal protein S2
4v6g.1.B	28.57	hetero-oligomer	HHblits	X-ray	3.50Å	0.32	0.10	30S RIBOSOMAL PROTEIN S2
4v5e.2.B	28.57	hetero-oligomer	HHblits	X-ray	3.45Å	0.32	0.10	30S RIBOSOMAL PROTEIN S2
4v8f.2.B	28.57	hetero-oligomer	HHblits	X-ray	3.30Å	0.32	0.10	30S RIBOSOMAL PROTEIN S2
5j8b.1.8	28.57	hetero-oligomer	HHblits	X-ray	2.60Å	0.32	0.10	30S ribosomal protein S2
4y4p.2.6	28.57	hetero-oligomer	HHblits	X-ray	2.50Å	0.32	0.10	30S ribosomal protein S2
4wzd.2.B	28.57	hetero-oligomer	HHblits	X-ray	3.10Å	0.32	0.10	30S ribosomal protein S2
4wzo.2.B	28.57	hetero-oligomer	HHblits	X-ray	3.30Å	0.32	0.10	30S ribosomal protein S2
4wzo.1.B	28.57	hetero-oligomer	HHblits	X-ray	3.30Å	0.32	0.10	30S ribosomal protein S2
4wr6.1.B	28.57	hetero-oligomer	HHblits	X-ray	3.05Å	0.32	0.10	30S ribosomal protein S2
4wr6.2.B	28.57	hetero-oligomer	HHblits	X-ray	3.05Å	0.32	0.10	30S ribosomal protein S2
4wsm.2.B	28.57	hetero-oligomer	HHblits	X-ray	3.30Å	0.32	0.10	30S ribosomal protein S2
4wqr.2.B	28.57	hetero-oligomer	HHblits	X-ray	3.15Å	0.32	0.10	30S ribosomal protein S2
5el5.2.B	28.57	hetero-oligomer	HHblits	X-ray	3.15Å	0.32	0.10	30S ribosomal protein S2
5el4.1.B	28.57	hetero-oligomer	HHblits	X-ray	3.15Å	0.32	0.10	30S ribosomal protein S2
5el6.1.B	28.57	hetero-oligomer	HHblits	X-ray	3.10Å	0.32	0.10	30S ribosomal protein S2
5el6.2.B	28.57	hetero-oligomer	HHblits	X-ray	3.10Å	0.32	0.10	30S ribosomal protein S2
5el4.2.B	28.57	hetero-oligomer	HHblits	X-ray	3.15Å	0.32	0.10	30S ribosomal protein S2
5e81.2.B	28.57	hetero-oligomer	HHblits	X-ray	2.95Å	0.32	0.10	30S ribosomal protein S2
5el7.2.B	28.57	hetero-oligomer	HHblits	X-ray	3.15Å	0.32	0.10	30S ribosomal protein S2
5e7k.2.B	28.57	hetero-oligomer	HHblits	X-ray	3.20Å	0.32	0.10	30S ribosomal protein S2
4wu1.1.B	28.57	hetero-oligomer	HHblits	X-ray	3.20Å	0.32	0.10	30S ribosomal protein S2
5el5.1.B	28.57	hetero-oligomer	HHblits	X-ray	3.15Å	0.32	0.10	30S ribosomal protein S2
4wqu.2.8	28.57	hetero-oligomer	HHblits	X-ray	2.80Å	0.32	0.10	30S ribosomal protein S2
5imq.1.I	28.57	hetero-oligomer	HHblits	EM	NA	0.32	0.10	30S ribosomal protein S2
5imr.1.B	28.57	hetero-oligomer	HHblits	EM	NA	0.32	0.10	30S ribosomal protein S2
5ibb.1.B	28.57	hetero-oligomer	HHblits	X-ray	2.96Å	0.32	0.10	30S ribosomal protein S2
5ibb.2.B	28.57	hetero-oligomer	HHblits	X-ray	2.96Å	0.32	0.10	30S ribosomal protein S2
4v5a.2.B	28.57	hetero-oligomer	HHblits	X-ray	3.50Å	0.32	0.10	30S RIBOSOMAL PROTEIN S2
2uua.1.B	28.57	hetero-oligomer	HHblits	X-ray	2.90Å	0.32	0.10	30S RIBOSOMAL PROTEIN S2
2vqe.1.B	28.57	hetero-oligomer	HHblits	X-ray	2.50Å	0.32	0.10	30S RIBOSOMAL PROTEIN S2
5lmr.1.B	28.57	hetero-oligomer	HHblits	EM	NA	0.32	0.10	30S ribosomal protein S2
5lmp.1.B	28.57	hetero-oligomer	HHblits	EM	NA	0.32	0.10	30S ribosomal protein S2
5lmn.1.B	28.57	hetero-oligomer	HHblits	EM	NA	0.32	0.10	30S ribosomal protein S2
5lmu.1.B	28.57	hetero-oligomer	HHblits	EM	NA	0.32	0.10	30S ribosomal protein S2
5lmt.1.B	28.57	hetero-oligomer	HHblits	EM	NA	0.32	0.10	30S ribosomal protein S2
5lms.1.B	28.57	hetero-oligomer	HHblits	EM	NA	0.32	0.10	30S ribosomal protein S2
5lmq.1.B	28.57	hetero-oligomer	HHblits	EM	NA	0.32	0.10	30S ribosomal protein S2
5j4d.1.a	28.57	hetero-oligomer	HHblits	X-ray	3.10Å	0.32	0.10	30S ribosomal protein S2
5w4k.2.6	28.57	hetero-oligomer	HHblits	X-ray	2.70Å	0.32	0.10	30S ribosomal protein S2
5dox.1.6	28.57	hetero-oligomer	HHblits	X-ray	3.10Å	0.32	0.10	30S ribosomal protein S2
4z8c.2.6	28.57	hetero-oligomer	HHblits	X-ray	2.90Å	0.32	0.10	30S ribosomal protein S2
5dox.2.6	28.57	hetero-oligomer	HHblits	X-ray	3.10Å	0.32	0.10	30S ribosomal protein S2
1i94.1.B	28.57	hetero-oligomer	HHblits	X-ray	3.20Å	0.32	0.10	30S RIBOSOMAL PROTEIN S2
2zm6.1.B	28.57	hetero-oligomer	HHblits	X-ray	3.30Å	0.32	0.10	30S ribosomal protein S2
5wqo.1.A	20.59	homo-dimer	HHblits	X-ray	1.78Å	0.34	0.10	Probable dehydrogenase
5wqp.1.B	20.59	homo-dimer	HHblits	X-ray	1.70Å	0.34	0.10	Probable dehydrogenase
5its.1.A	16.67	homo-dimer	HHblits	X-ray	2.30Å	0.29	0.10	Cytokinin riboside 5'-monophosphate phosphoribohydrolase
5its.2.B	16.67	homo-dimer	HHblits	X-ray	2.30Å	0.29	0.10	Cytokinin riboside 5'-monophosphate phosphoribohydrolase
4dti.1.A	20.00	homo-tetramer	HHblits	X-ray	1.90Å	0.32	0.10	Enoyl-[acyl-carrier-protein] reductase [NADH]
4bge.1.D	20.00	homo-tetramer	HHblits	X-ray	2.25Å	0.32	0.10	ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
1enz.1.A	20.00	homo-dimer	HHblits	X-ray	2.70Å	0.32	0.10	ENOYL-ACYL CARRIER PROTEIN (ACP) REDUCTASE
3oey.1.A	20.00	homo-tetramer	HHblits	X-ray	2.00Å	0.32	0.10	Enoyl-[acyl-carrier-protein] reductase [NADH]
2ie0.1.A	22.86	homo-tetramer	HHblits	X-ray	2.20Å	0.32	0.10	Enoyl-[acyl-carrier-protein] reductase [NADH]
2aqh.1.A	22.86	homo-tetramer	HHblits	X-ray	2.01Å	0.32	0.10	Enoyl-[acyl-carrier-protein] reductase [NADH]
5wqn.1.A	20.59	homo-dimer	HHblits	X-ray	2.00Å	0.34	0.10	Probable dehydrogenase
5wqn.1.B	20.59	homo-dimer	HHblits	X-ray	2.00Å	0.34	0.10	Probable dehydrogenase
5wqn.2.B	20.59	homo-dimer	HHblits	X-ray	2.00Å	0.34	0.10	Probable dehydrogenase
5f4b.1.A	19.44	homo-tetramer	HHblits	X-ray	2.50Å	0.29	0.10	NAD(P)H dehydrogenase (quinone)
1zid.1.A	20.00	homo-tetramer	HHblits	X-ray	2.70Å	0.31	0.10	ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE
2ntj.1.B	20.00	homo-tetramer	HHblits	X-ray	2.50Å	0.31	0.10	Enoyl-[acyl-carrier-protein] reductase [NADH
3of2.1.A	20.00	homo-tetramer	HHblits	X-ray	2.00Å	0.31	0.10	Enoyl-[acyl-carrier-protein] reductase [NADH]
5cpf.1.C	20.00	homo-tetramer	HHblits	X-ray	3.41Å	0.31	0.10	Enoyl-[acyl-carrier-protein] reductase [NADH]
5cpf.1.D	20.00	homo-tetramer	HHblits	X-ray	3.41Å	0.31	0.10	Enoyl-[acyl-carrier-protein] reductase [NADH]
2ieb.1.A	20.00	homo-tetramer	HHblits	X-ray	2.20Å	0.31	0.10	Enoyl-[acyl-carrier-protein] reductase [NADH]
2ied.1.A	20.00	homo-tetramer	HHblits	X-ray	2.14Å	0.31	0.10	Enoyl-[acyl-carrier-protein] reductase [NADH]
2ied.1.B	20.00	homo-tetramer	HHblits	X-ray	2.14Å	0.31	0.10	Enoyl-[acyl-carrier-protein] reductase [NADH]
2ied.1.C	20.00	homo-tetramer	HHblits	X-ray	2.14Å	0.31	0.10	Enoyl-[acyl-carrier-protein] reductase [NADH]
2ied.1.D	20.00	homo-tetramer	HHblits	X-ray	2.14Å	0.31	0.10	Enoyl-[acyl-carrier-protein] reductase [NADH]
2pr2.1.A	20.00	homo-tetramer	HHblits	X-ray	2.50Å	0.31	0.10	enoyl-ACP Reductase
3fnh.1.A	20.00	homo-tetramer	HHblits	X-ray	2.80Å	0.31	0.10	Enoyl-[acyl-carrier-protein] reductase [NADH]
3fne.1.C	20.00	homo-tetramer	HHblits	X-ray	1.98Å	0.31	0.10	Enoyl-[acyl-carrier-protein] reductase [NADH]
2x23.1.A	20.00	homo-tetramer	HHblits	X-ray	1.81Å	0.31	0.10	ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
2x22.1.A	20.00	homo-tetramer	HHblits	X-ray	2.10Å	0.31	0.10	ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
2nsd.1.A	20.00	monomer	HHblits	X-ray	1.90Å	0.31	0.10	Enoyl-[acyl-carrier-protein] reductase
1p45.1.A	20.00	homo-tetramer	HHblits	X-ray	2.60Å	0.31	0.10	Enoyl-[acyl-carrier-protein] reductase [NADH]
1p45.1.B	20.00	homo-tetramer	HHblits	X-ray	2.60Å	0.31	0.10	Enoyl-[acyl-carrier-protein] reductase [NADH]
1p44.1.A	20.00	homo-tetramer	HHblits	X-ray	2.70Å	0.31	0.10	Enoyl-[acyl-carrier-protein] reductase [NADH]
1p44.2.B	20.00	homo-tetramer	HHblits	X-ray	2.70Å	0.31	0.10	Enoyl-[acyl-carrier-protein] reductase [NADH]
1p44.2.C	20.00	homo-tetramer	HHblits	X-ray	2.70Å	0.31	0.10	Enoyl-[acyl-carrier-protein] reductase [NADH]
2b37.2.B	20.00	homo-tetramer	HHblits	X-ray	2.60Å	0.31	0.10	Enoyl-[acyl-carrier-protein] reductase [NADH]
4cod.1.C	20.00	homo-tetramer	HHblits	X-ray	2.40Å	0.31	0.10	ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
4qxm.1.B	20.00	homo-tetramer	HHblits	X-ray	2.20Å	0.31	0.10	Enoyl-[acyl-carrier-protein] reductase [NADH]
3ndb.1.B	16.22	hetero-oligomer	HHblits	X-ray	3.00Å	0.27	0.10	Signal recognition 54 kDa protein
2jjy.1.B	16.67	homo-tetramer	HHblits	X-ray	2.90Å	0.29	0.10	ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE
2jjy.1.A	16.67	homo-tetramer	HHblits	X-ray	2.90Å	0.29	0.10	ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE
3uic.4.A	16.67	homo-tetramer	HHblits	X-ray	2.50Å	0.29	0.10	Enoyl-[acyl-carrier-protein] reductase [NADH]
5i9m.2.D	13.89	homo-tetramer	HHblits	X-ray	2.25Å	0.29	0.10	Enoyl-[acyl-carrier-protein] reductase [NADH]
4bku.1.C	13.89	homo-tetramer	HHblits	X-ray	1.84Å	0.29	0.10	ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
5i8w.1.C	13.89	homo-tetramer	HHblits	X-ray	1.63Å	0.29	0.10	Enoyl-[acyl-carrier-protein] reductase [NADH]
1bvr.1.A	20.00	homo-tetramer	HHblits	X-ray	2.80Å	0.31	0.10	PROTEIN (ENOYL-ACYL CARRIER PROTEIN (ACP) REDUCTASE)
1bvr.1.C	20.00	homo-tetramer	HHblits	X-ray	2.80Å	0.31	0.10	PROTEIN (ENOYL-ACYL CARRIER PROTEIN (ACP) REDUCTASE)
2idz.1.A	20.00	homo-tetramer	HHblits	X-ray	2.00Å	0.31	0.10	Enoyl-[acyl-carrier-protein] reductase [NADH]
4gll.1.A	30.30	homo-dimer	HHblits	X-ray	2.50Å	0.36	0.09	UDP-glucuronic acid decarboxylase 1
4gll.1.B	30.30	homo-dimer	HHblits	X-ray	2.50Å	0.36	0.09	UDP-glucuronic acid decarboxylase 1
4lk3.1.A	30.30	homo-hexamer	HHblits	X-ray	2.64Å	0.36	0.09	UDP-glucuronic acid decarboxylase 1
2m6r.1.A	19.44	monomer	HHblits	NMR	NA	0.29	0.10	Flavodoxin
2m6s.1.A	19.44	monomer	HHblits	NMR	NA	0.29	0.10	Flavodoxin
1bu5.1.A	19.44	homo-dimer	HHblits	X-ray	1.83Å	0.29	0.10	PROTEIN (FLAVODOXIN)
4i5d.1.A	20.59	homo-tetramer	HHblits	X-ray	2.40Å	0.33	0.10	Alclohol dehydrogenase/short-chain dehydrogenase
5gad.1.7	13.16	hetero-oligomer	HHblits	EM	NA	0.25	0.11	Signal recognition particle protein Ffh
3kl4.1.A	19.44	hetero-oligomer	HHblits	X-ray	3.50Å	0.29	0.10	Signal recognition 54 kDa protein
4d0r.1.A	17.14	homo-tetramer	HHblits	X-ray	2.75Å	0.31	0.10	ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
3ehd.1.A	20.59	homo-tetramer	HHblits	X-ray	2.15Å	0.33	0.10	uncharacterized conserved protein
4m86.1.A	20.00	homo-tetramer	HHblits	X-ray	2.15Å	0.31	0.10	Enoyl-[acyl-carrier-protein] reductase [NADH]
3ibg.1.A	28.57	homo-dimer	HHblits	X-ray	3.20Å	0.31	0.10	ATPase, subunit of the Get complex
3jaj.45.A	19.44	monomer	HHblits	EM	NA	0.28	0.10	SRP54
3jan.45.A	19.44	monomer	HHblits	EM	NA	0.28	0.10	SRP54
4ue5.1.D	19.44	hetero-oligomer	HHblits	EM	9.00Å	0.28	0.10	SIGNAL RECOGNITION PARTICLE 54 KDA PROTEIN
2c20.1.A	17.65	homo-dimer	HHblits	X-ray	2.70Å	0.33	0.10	UDP-GLUCOSE 4-EPIMERASE
4lis.1.A	23.53	homo-dimer	HHblits	X-ray	2.80Å	0.33	0.10	UDP-glucose 4-epimerase
2ntv.1.A	17.14	homo-tetramer	HHblits	X-ray	2.10Å	0.30	0.10	Enoyl-[ACP] reductase
2ntv.1.B	17.14	homo-tetramer	HHblits	X-ray	2.10Å	0.30	0.10	Enoyl-[ACP] reductase
5az3.1.A	13.89	monomer	HHblits	X-ray	1.42Å	0.28	0.10	ABC-type transporter, periplasmic component
5b4z.1.A	13.89	monomer	HHblits	X-ray	1.30Å	0.28	0.10	ABC-type transporter, periplasmic component
1kht.1.A	13.89	homo-trimer	HHblits	X-ray	2.50Å	0.28	0.10	adenylate kinase
1kht.1.B	13.89	homo-trimer	HHblits	X-ray	2.50Å	0.28	0.10	adenylate kinase
1kht.1.C	13.89	homo-trimer	HHblits	X-ray	2.50Å	0.28	0.10	adenylate kinase
2b69.1.A	34.38	homo-dimer	HHblits	X-ray	1.21Å	0.37	0.09	UDP-glucuronate decarboxylase 1
3pnx.1.A	16.22	homo-trimer	HHblits	X-ray	1.92Å	0.26	0.10	Putative sulfurtransferase dsrE
3dm5.1.A	19.44	homo-tetramer	HHblits	X-ray	2.51Å	0.28	0.10	Signal recognition 54 kDa protein
5lji.1.A	10.53	monomer	HHblits	X-ray	2.07Å	0.24	0.11	Flavodoxin
2wwv.1.D	7.89	hetero-oligomer	HHblits	NMR	NA	0.24	0.11	N\,N'-DIACETYLCHITOBIOSE-SPECIFIC PHOSPHOTRANSFERASE ENZYME IIB COMPONENT
1mfp.1.A	14.29	homo-tetramer	HHblits	X-ray	2.33Å	0.30	0.10	enoyl-[acyl-carrier-protein] reductase [Nadh]
2fhs.1.A	14.29	hetero-oligomer	HHblits	X-ray	2.70Å	0.30	0.10	enoyl-[acyl-carrier-protein] reductase, NADH-dependent
1dfg.1.A	14.29	homo-tetramer	HHblits	X-ray	2.50Å	0.30	0.10	ENOYL ACYL CARRIER PROTEIN REDUCTASE
1dfi.1.A	14.29	homo-tetramer	HHblits	X-ray	2.09Å	0.30	0.10	ENOYL ACYL CARRIER PROTEIN REDUCTASE
1d8a.1.A	14.29	homo-tetramer	HHblits	X-ray	2.20Å	0.30	0.10	ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE
3pje.1.A	14.29	homo-dimer	HHblits	X-ray	2.50Å	0.30	0.10	Enoyl-[acyl-carrier-protein] reductase [NADH]
1qsg.1.A	14.29	homo-tetramer	HHblits	X-ray	1.75Å	0.30	0.10	ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE
3pjf.1.A	14.29	homo-dimer	HHblits	X-ray	1.90Å	0.30	0.10	Enoyl-[acyl-carrier-protein] reductase [NADH]
3pjf.1.B	14.29	homo-dimer	HHblits	X-ray	1.90Å	0.30	0.10	Enoyl-[acyl-carrier-protein] reductase [NADH]
5mp4.1.A	13.51	homo-tetramer	HHblits	X-ray	2.79Å	0.25	0.10	Protoplast secreted protein 2
3ax6.1.A	27.27	homo-dimer	HHblits	X-ray	2.20Å	0.34	0.09	Phosphoribosylaminoimidazole carboxylase, ATPase subunit
3ax6.1.B	27.27	homo-dimer	HHblits	X-ray	2.20Å	0.34	0.09	Phosphoribosylaminoimidazole carboxylase, ATPase subunit
3ax6.2.B	27.27	homo-dimer	HHblits	X-ray	2.20Å	0.34	0.09	Phosphoribosylaminoimidazole carboxylase, ATPase subunit
2aqi.1.A	20.59	homo-tetramer	HHblits	X-ray	2.20Å	0.32	0.10	Enoyl-[acyl-carrier-protein] reductase [NADH]
4dqu.1.A	20.59	homo-tetramer	HHblits	X-ray	2.45Å	0.32	0.10	Enoyl-[acyl-carrier-protein] reductase [NADH]
4r9r.1.A	20.59	homo-tetramer	HHblits	X-ray	2.90Å	0.32	0.10	Enoyl-[acyl-carrier-protein] reductase [NADH]
5ljl.1.A	10.81	monomer	HHblits	X-ray	1.60Å	0.25	0.10	Flavodoxin
5b3k.1.A	13.51	monomer	HHblits	X-ray	1.70Å	0.25	0.10	Uncharacterized protein PA3435
5b3l.1.A	13.51	monomer	HHblits	X-ray	1.80Å	0.25	0.10	Uncharacterized protein PA3435
4m55.1.A	27.27	homo-hexamer	HHblits	X-ray	2.86Å	0.34	0.09	UDP-glucuronic acid decarboxylase 1
4m55.1.D	27.27	homo-hexamer	HHblits	X-ray	2.86Å	0.34	0.09	UDP-glucuronic acid decarboxylase 1
3h86.2.A	17.14	homo-trimer	HHblits	X-ray	2.50Å	0.30	0.10	Adenylate kinase
3h86.1.B	17.14	homo-trimer	HHblits	X-ray	2.50Å	0.30	0.10	Adenylate kinase
3h86.1.C	17.14	homo-trimer	HHblits	X-ray	2.50Å	0.30	0.10	Adenylate kinase
3h86.1.A	17.14	homo-trimer	HHblits	X-ray	2.50Å	0.30	0.10	Adenylate kinase
4bgi.1.A	20.59	homo-tetramer	HHblits	X-ray	2.09Å	0.32	0.10	ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
5coq.1.A	20.59	homo-tetramer	HHblits	X-ray	2.30Å	0.32	0.10	Enoyl-[acyl-carrier-protein] reductase [NADH]
3gnt.1.A	8.33	homo-tetramer	HHblits	X-ray	2.75Å	0.27	0.10	Enoyl-[acyl-carrier-protein] reductase [NADH]
3gnt.1.B	8.33	homo-tetramer	HHblits	X-ray	2.75Å	0.27	0.10	Enoyl-[acyl-carrier-protein] reductase [NADH]
4nz9.1.A	8.33	homo-dimer	HHblits	X-ray	2.30Å	0.27	0.10	Enoyl-[acyl-carrier-protein] reductase [NADPH]
2hnb.1.A	19.44	monomer	HHblits	NMR	NA	0.27	0.10	Protein mioC
2hna.1.A	19.44	monomer	HHblits	NMR	NA	0.27	0.10	Protein mioC
4bms.1.A	21.21	homo-tetramer	HHblits	X-ray	2.89Å	0.34	0.09	ALCLOHOL DEHYDROGENASE/SHORT-CHAIN DEHYDROGENASE
4bmn.1.A	21.21	homo-tetramer	HHblits	X-ray	1.50Å	0.34	0.09	ALCLOHOL DEHYDROGENASE/SHORT-CHAIN DEHYDROGENASE
1ps9.1.A	24.24	monomer	HHblits	X-ray	2.20Å	0.34	0.09	2,4-dienoyl-CoA reductase
4cv2.1.A	14.29	homo-tetramer	HHblits	X-ray	1.80Å	0.29	0.10	ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
3pjd.1.A	14.29	homo-dimer	HHblits	X-ray	2.50Å	0.29	0.10	Enoyl-[acyl-carrier-protein] reductase [NADH]
2z04.1.A	20.59	homo-dimer	HHblits	X-ray	2.35Å	0.32	0.10	Phosphoribosylaminoimidazole carboxylase ATPase subunit
3ezy.1.A	13.89	homo-tetramer	HHblits	X-ray	2.04Å	0.27	0.10	Dehydrogenase
2v3c.1.B	16.67	hetero-oligomer	HHblits	X-ray	2.50Å	0.27	0.10	SIGNAL RECOGNITION 54 KDA PROTEIN
2v3c.2.B	16.67	hetero-oligomer	HHblits	X-ray	2.50Å	0.27	0.10	SIGNAL RECOGNITION 54 KDA PROTEIN
4eit.1.A	17.14	homo-tetramer	HHblits	X-ray	2.40Å	0.29	0.10	Enoyl-[acyl-carrier-protein] reductase [NADH]
4zcc.1.B	30.30	homo-dimer	HHblits	X-ray	2.00Å	0.34	0.09	Renalase
4zcc.1.A	30.30	homo-dimer	HHblits	X-ray	2.00Å	0.34	0.09	Renalase
4zcd.3.A	30.30	monomer	HHblits	X-ray	1.66Å	0.34	0.09	Renalase
4zcd.2.A	30.30	monomer	HHblits	X-ray	1.66Å	0.34	0.09	Renalase
3aeu.1.B	24.24	hetero-oligomer	HHblits	X-ray	2.90Å	0.34	0.09	Light-independent protochlorophyllide reductase subunit B
3aer.1.B	24.24	hetero-oligomer	HHblits	X-ray	2.80Å	0.34	0.09	Light-independent protochlorophyllide reductase subunit B
3aeq.1.B	24.24	hetero-oligomer	HHblits	X-ray	2.90Å	0.34	0.09	Light-independent protochlorophyllide reductase subunit B
3aek.1.B	24.24	hetero-oligomer	HHblits	X-ray	2.30Å	0.34	0.09	Light-independent protochlorophyllide reductase subunit B
3orf.1.A	17.65	homo-dimer	HHblits	X-ray	2.16Å	0.31	0.10	Dihydropteridine reductase
3orf.2.A	17.65	homo-dimer	HHblits	X-ray	2.16Å	0.31	0.10	Dihydropteridine reductase
2qio.1.A	5.56	homo-tetramer	HHblits	X-ray	2.44Å	0.27	0.10	Enoyl-(Acyl-carrier-protein) reductase
2qio.1.C	5.56	homo-tetramer	HHblits	X-ray	2.44Å	0.27	0.10	Enoyl-(Acyl-carrier-protein) reductase
3oje.1.A	5.56	homo-dimer	HHblits	X-ray	3.02Å	0.27	0.10	Enoyl-[acyl-carrier-protein] reductase (FabL) (NADPH)
1weh.1.A	10.81	monomer	HHblits	X-ray	1.80Å	0.25	0.10	Conserved hypothetical protein TT1887
5tf4.1.A	17.14	homo-tetramer	HHblits	X-ray	1.95Å	0.29	0.10	Enoyl-[acyl-carrier-protein] reductase [NADH]
5tf4.2.B	17.14	homo-tetramer	HHblits	X-ray	1.95Å	0.29	0.10	Enoyl-[acyl-carrier-protein] reductase [NADH]
4rlh.1.A	14.29	homo-tetramer	HHblits	X-ray	2.26Å	0.29	0.10	Enoyl-[acyl-carrier-protein] reductase [NADH]
5jc8.1.A	14.29	homo-tetramer	HHblits	X-ray	1.45Å	0.29	0.10	Putative short-chain dehydrogenase/reductase
5xb5.1.A	25.71	homo-dimer	HHblits	X-ray	2.23Å	0.29	0.10	Thymidylate kinase
4j7c.1.A	27.27	hetero-oligomer	HHblits	X-ray	3.50Å	0.34	0.09	Ktr system potassium uptake protein A
4pn3.1.A	21.21	homo-tetramer	HHblits	X-ray	2.15Å	0.34	0.09	3-hydroxyacyl-CoA dehydrogenase
4o5o.1.A	21.21	homo-tetramer	HHblits	X-ray	1.40Å	0.34	0.09	3-hydroxyacyl-CoA dehydrogenase
4o5o.1.B	21.21	homo-tetramer	HHblits	X-ray	1.40Å	0.34	0.09	3-hydroxyacyl-CoA dehydrogenase
4ohu.1.C	20.59	homo-tetramer	HHblits	X-ray	1.60Å	0.31	0.10	Enoyl-[acyl-carrier-protein] reductase [NADH]
4oim.1.A	20.59	homo-tetramer	HHblits	X-ray	1.85Å	0.31	0.10	Enoyl-[acyl-carrier-protein] reductase [NADH]
5mtr.1.B	20.59	homo-tetramer	HHblits	X-ray	2.00Å	0.31	0.10	Enoyl-[acyl-carrier-protein] reductase [NADH]
4oxn.1.B	20.59	homo-tetramer	HHblits	X-ray	2.29Å	0.31	0.10	Enoyl-[acyl-carrier-protein] reductase [NADH]
5ugs.1.A	20.59	homo-tetramer	HHblits	X-ray	2.80Å	0.31	0.10	Enoyl-[acyl-carrier-protein] reductase [NADH]
3fni.1.A	10.53	monomer	HHblits	X-ray	2.30Å	0.22	0.11	Putative diflavin flavoprotein A 3
2ax4.1.A	14.29	homo-dimer	HHblits	X-ray	2.50Å	0.29	0.10	Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthetase 2
2p91.1.A	8.57	homo-tetramer	HHblits	X-ray	2.00Å	0.29	0.10	Enoyl-[acyl-carrier-protein] reductase [NADH]
2p91.1.D	8.57	homo-tetramer	HHblits	X-ray	2.00Å	0.29	0.10	Enoyl-[acyl-carrier-protein] reductase [NADH]
5guy.1.A	20.00	monomer	HHblits	X-ray	2.40Å	0.29	0.10	Uncharacterized protein chuY
4fgs.1.A	21.21	homo-tetramer	HHblits	X-ray	1.76Å	0.33	0.09	Probable dehydrogenase protein
3n6r.1.A	27.27	hetero-oligomer	HHblits	X-ray	3.20Å	0.33	0.09	Propionyl-CoA carboxylase, alpha subunit
1bdb.1.A	18.18	homo-tetramer	HHblits	X-ray	2.00Å	0.33	0.09	CIS-BIPHENYL-2,3-DIHYDRODIOL-2,3-DEHYDROGENASE
4toi.1.A	26.47	homo-dimer	HHblits	X-ray	2.30Å	0.31	0.10	30S ribosomal protein S2,Ribosomal protein S1
4gmd.1.B	16.67	homo-dimer	HHblits	X-ray	1.98Å	0.26	0.10	Thymidylate kinase
4gmd.1.A	16.67	homo-dimer	HHblits	X-ray	1.98Å	0.26	0.10	Thymidylate kinase
4edh.1.A	16.67	homo-dimer	HHblits	X-ray	1.32Å	0.26	0.10	Thymidylate kinase
4e5u.1.A	16.67	homo-dimer	HHblits	X-ray	1.81Å	0.26	0.10	Thymidylate kinase
4e5u.1.B	16.67	homo-dimer	HHblits	X-ray	1.81Å	0.26	0.10	Thymidylate kinase
2w58.1.A	11.11	homo-dimer	HHblits	X-ray	2.50Å	0.26	0.10	PRIMOSOME COMPONENT (HELICASE LOADER)
2w58.1.B	11.11	homo-dimer	HHblits	X-ray	2.50Å	0.26	0.10	PRIMOSOME COMPONENT (HELICASE LOADER)
4gbj.1.A	34.38	homo-dimer	HHblits	X-ray	2.05Å	0.36	0.09	6-phosphogluconate dehydrogenase NAD-binding
4gbj.2.A	34.38	homo-dimer	HHblits	X-ray	2.05Å	0.36	0.09	6-phosphogluconate dehydrogenase NAD-binding
2pd3.1.A	11.43	homo-tetramer	HHblits	X-ray	2.50Å	0.29	0.10	Enoyl-[acyl-carrier-protein] reductase [NADH]
3k2e.1.A	17.14	homo-tetramer	HHblits	X-ray	1.90Å	0.29	0.10	Enoyl-(Acyl-carrier-protein) reductase
4i5g.1.A	21.21	homo-tetramer	HHblits	X-ray	2.30Å	0.33	0.09	Alclohol dehydrogenase/short-chain dehydrogenase
4i5f.1.A	21.21	homo-tetramer	HHblits	X-ray	2.10Å	0.33	0.09	Alclohol dehydrogenase/short-chain dehydrogenase
1hxh.1.A	24.24	homo-tetramer	HHblits	X-ray	1.22Å	0.33	0.09	3BETA/17BETA-HYDROXYSTEROID DEHYDROGENASE
1u7t.1.A	21.21	homo-tetramer	HHblits	X-ray	2.00Å	0.33	0.09	3-hydroxyacyl-CoA dehydrogenase type II
1zwk.1.A	5.26	homo-tetramer	HHblits	X-ray	2.60Å	0.22	0.11	Trp repressor binding protein WrbA
3rv4.1.A	18.18	homo-dimer	HHblits	X-ray	1.98Å	0.33	0.09	Biotin carboxylase
3grp.1.A	27.27	homo-tetramer	HHblits	X-ray	2.09Å	0.33	0.09	3-oxoacyl-(Acyl carrierprotein) reductase
3grp.1.B	27.27	homo-tetramer	HHblits	X-ray	2.09Å	0.33	0.09	3-oxoacyl-(Acyl carrierprotein) reductase
1e6w.1.A	24.24	homo-tetramer	HHblits	X-ray	1.70Å	0.33	0.09	SHORT CHAIN 3-HYDROXYACYL-COA DEHYDROGENASE
3vc7.1.A	27.27	homo-dimer	HHblits	X-ray	2.23Å	0.33	0.09	Putative oxidoreductase
4eso.1.A	27.27	homo-tetramer	HHblits	X-ray	1.91Å	0.33	0.09	Putative oxidoreductase
4eso.1.C	27.27	homo-tetramer	HHblits	X-ray	1.91Å	0.33	0.09	Putative oxidoreductase
3l6e.1.A	24.24	homo-dimer	HHblits	X-ray	2.30Å	0.33	0.09	Oxidoreductase, short-chain dehydrogenase/reductase family
3l6e.1.B	24.24	homo-dimer	HHblits	X-ray	2.30Å	0.33	0.09	Oxidoreductase, short-chain dehydrogenase/reductase family
5je8.1.B	31.25	homo-dimer	HHblits	X-ray	2.10Å	0.35	0.09	3-hydroxyisobutyrate dehydrogenase
5je8.1.A	31.25	homo-dimer	HHblits	X-ray	2.10Å	0.35	0.09	3-hydroxyisobutyrate dehydrogenase
4zju.1.A	8.57	homo-tetramer	HHblits	X-ray	1.20Å	0.28	0.10	Enoyl-[acyl-carrier-protein] reductase [NADH]
1wnt.1.A	15.15	homo-tetramer	HHblits	X-ray	2.30Å	0.33	0.09	L-xylulose reductase
2r2g.1.A	21.21	homo-dimer	HHblits	X-ray	1.80Å	0.33	0.09	Eugenol synthase 1
1so8.1.A	21.21	homo-tetramer	HHblits	X-ray	2.30Å	0.33	0.09	3-hydroxyacyl-CoA dehydrogenase type II
4bur.1.A	21.21	monomer	HHblits	X-ray	2.88Å	0.33	0.09	APOPTOSIS INDUCING FACTOR 1, MITOCHONDRIAL
4bur.3.A	21.21	monomer	HHblits	X-ray	2.88Å	0.33	0.09	APOPTOSIS INDUCING FACTOR 1, MITOCHONDRIAL
5in4.1.A	29.41	homo-tetramer	HHblits	X-ray	1.60Å	0.30	0.10	GDP-mannose 4,6 dehydratase
1iib.1.A	8.11	monomer	HHblits	X-ray	1.80Å	0.24	0.10	ENZYME IIB OF THE CELLOBIOSE-SPECIFIC PHOSPHOTRANSFERASE SYSTEM
1e2b.1.A	8.11	monomer	HHblits	NMR	NA	0.24	0.10	ENZYME IIB-CELLOBIOSE
4nqz.1.A	8.57	homo-tetramer	HHblits	X-ray	2.60Å	0.28	0.10	Enoyl-[acyl-carrier-protein] reductase [NADH] FabI
4nr0.1.A	8.57	homo-tetramer	HHblits	X-ray	1.80Å	0.28	0.10	Enoyl-[acyl-carrier-protein] reductase [NADH] FabI
3nbm.1.A	8.33	monomer	HHblits	X-ray	1.30Å	0.26	0.10	PTS system, lactose-specific IIBC components
4jqc.1.B	14.71	homo-dimer	HHblits	X-ray	2.80Å	0.30	0.10	Enoyl-[acyl-carrier-protein] reductase [NADH] FabI
4jqc.1.A	14.71	homo-dimer	HHblits	X-ray	2.80Å	0.30	0.10	Enoyl-[acyl-carrier-protein] reductase [NADH] FabI
5cfz.1.A	14.71	homo-tetramer	HHblits	X-ray	1.97Å	0.30	0.10	Enoyl-[acyl-carrier-protein] reductase [NADH] FabI
4rap.1.A	20.59	homo-12-mer	HHblits	X-ray	2.88Å	0.30	0.10	Glycosyltransferase TibC
2o23.1.A	21.21	homo-tetramer	HHblits	X-ray	1.20Å	0.33	0.09	HADH2 protein
1zk4.1.A	21.21	homo-tetramer	HHblits	X-ray	1.00Å	0.33	0.09	R-specific alcohol dehydrogenase
1xgk.1.A	30.30	monomer	HHblits	X-ray	1.40Å	0.33	0.09	NITROGEN METABOLITE REPRESSION REGULATOR NMRA
3r9u.1.A	30.30	homo-dimer	HHblits	X-ray	2.36Å	0.33	0.09	Thioredoxin reductase
2r3e.1.A	14.29	homo-tetramer	HHblits	X-ray	1.95Å	0.28	0.10	YjeF-related protein
3orq.1.B	25.00	homo-dimer	HHblits	X-ray	2.23Å	0.35	0.09	N5-Carboxyaminoimidazole ribonucleotide synthetase
3orq.1.A	25.00	homo-dimer	HHblits	X-ray	2.23Å	0.35	0.09	N5-Carboxyaminoimidazole ribonucleotide synthetase
3q2o.1.A	21.21	homo-dimer	HHblits	X-ray	1.96Å	0.32	0.09	Phosphoribosylaminoimidazole carboxylase, ATPase subunit
3q2o.1.B	21.21	homo-dimer	HHblits	X-ray	1.96Å	0.32	0.09	Phosphoribosylaminoimidazole carboxylase, ATPase subunit
1dv2.1.A	18.18	monomer	HHblits	X-ray	2.50Å	0.32	0.09	BIOTIN CARBOXYLASE
4o6v.1.A	21.21	homo-tetramer	HHblits	X-ray	1.85Å	0.32	0.09	Oxidoreductase, short-chain dehydrogenase/reductase family
4j90.1.A	27.27	homo-octamer	HHblits	X-ray	3.24Å	0.32	0.09	Ktr system potassium uptake protein A
4j91.1.A	27.27	homo-octamer	HHblits	X-ray	2.93Å	0.32	0.09	Ktr system potassium uptake protein A
4j91.1.B	27.27	homo-octamer	HHblits	X-ray	2.93Å	0.32	0.09	Ktr system potassium uptake protein A
4j91.1.C	27.27	homo-octamer	HHblits	X-ray	2.93Å	0.32	0.09	Ktr system potassium uptake protein A
5er6.1.A	21.21	homo-tetramer	HHblits	X-ray	1.55Å	0.32	0.09	Oxidoreductase, short chain dehydrogenase/reductase family
5koi.1.B	11.43	homo-dimer	HHblits	X-ray	1.70Å	0.28	0.10	Enoyl-[acyl-carrier-protein] reductase [NADH]
5koi.1.A	11.43	homo-dimer	HHblits	X-ray	1.70Å	0.28	0.10	Enoyl-[acyl-carrier-protein] reductase [NADH]
5koi.4.A	11.43	homo-dimer	HHblits	X-ray	1.70Å	0.28	0.10	Enoyl-[acyl-carrier-protein] reductase [NADH]
2wy2.1.D	8.11	hetero-oligomer	HHblits	NMR	NA	0.23	0.10	N\,N'-DIACETYLCHITOBIOSE-SPECIFIC PHOSPHOTRANSFERASE ENZYME IIB COMPONENT
1h9c.1.A	8.11	monomer	HHblits	NMR	NA	0.23	0.10	PTS SYSTEM, CHITOBIOSE-SPECIFIC IIB COMPONENT
4mo2.1.A	24.24	homo-dimer	HHblits	X-ray	2.00Å	0.32	0.09	UDP-galactopyranose mutase
2dwc.1.A	24.24	homo-dimer	HHblits	X-ray	1.70Å	0.32	0.09	433aa long hypothetical phosphoribosylglycinamide formyl transferase
2czg.1.B	24.24	homo-dimer	HHblits	X-ray	2.35Å	0.32	0.09	phosphoribosylglycinamide formyl transferase
3oif.1.A	8.57	homo-tetramer	HHblits	X-ray	2.60Å	0.27	0.10	Enoyl-[acyl-carrier-protein] reductase [NADH]
3oig.1.A	8.57	homo-tetramer	HHblits	X-ray	1.25Å	0.27	0.10	Enoyl-[acyl-carrier-protein] reductase [NADH]
3gdg.1.B	11.43	homo-tetramer	HHblits	X-ray	2.30Å	0.27	0.10	Probable NADP-dependent mannitol dehydrogenase
3gdg.1.A	11.43	homo-tetramer	HHblits	X-ray	2.30Å	0.27	0.10	Probable NADP-dependent mannitol dehydrogenase
3gdg.1.D	11.43	homo-tetramer	HHblits	X-ray	2.30Å	0.27	0.10	Probable NADP-dependent mannitol dehydrogenase
3gdf.1.C	11.43	homo-tetramer	HHblits	X-ray	2.50Å	0.27	0.10	Probable NADP-dependent mannitol dehydrogenase
4m4w.1.J	11.43	hetero-oligomer	HHblits	X-ray	6.10Å	0.27	0.10	Primosomal protein DnaI
4m4w.1.K	11.43	hetero-oligomer	HHblits	X-ray	6.10Å	0.27	0.10	Primosomal protein DnaI
4m4w.1.L	11.43	hetero-oligomer	HHblits	X-ray	6.10Å	0.27	0.10	Primosomal protein DnaI
4m4w.1.M	11.43	hetero-oligomer	HHblits	X-ray	6.10Å	0.27	0.10	Primosomal protein DnaI
4m4w.1.N	11.43	hetero-oligomer	HHblits	X-ray	6.10Å	0.27	0.10	Primosomal protein DnaI
4m4w.1.O	11.43	hetero-oligomer	HHblits	X-ray	6.10Å	0.27	0.10	Primosomal protein DnaI
1sb9.1.A	20.59	homo-dimer	HHblits	X-ray	2.50Å	0.30	0.10	wbpP
5t2u.1.A	21.21	homo-tetramer	HHblits	X-ray	2.20Å	0.32	0.09	Oxidoreductase, short chain dehydrogenase/reductase family protein
5t2v.1.A	21.21	homo-tetramer	HHblits	X-ray	1.90Å	0.32	0.09	Oxidoreductase, short chain dehydrogenase/reductase family protein
4all.1.A	8.57	homo-tetramer	HHblits	X-ray	2.80Å	0.27	0.10	ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADPH]
4alj.1.A	8.57	homo-tetramer	HHblits	X-ray	2.20Å	0.27	0.10	ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADPH]
4alm.1.B	8.57	homo-tetramer	HHblits	X-ray	2.45Å	0.27	0.10	ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADPH]
4alm.1.C	8.57	homo-tetramer	HHblits	X-ray	2.45Å	0.27	0.10	ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADPH]
4alm.1.D	8.57	homo-tetramer	HHblits	X-ray	2.45Å	0.27	0.10	ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADPH]
4alm.1.A	8.57	homo-tetramer	HHblits	X-ray	2.45Å	0.27	0.10	ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADPH]
4aln.1.A	8.57	homo-tetramer	HHblits	X-ray	3.05Å	0.27	0.10	ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADPH]
4aln.1.C	8.57	homo-tetramer	HHblits	X-ray	3.05Å	0.27	0.10	ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADPH]
4cv1.1.D	8.57	homo-tetramer	HHblits	X-ray	1.95Å	0.27	0.10	ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
4fs3.1.A	8.57	homo-tetramer	HHblits	X-ray	1.80Å	0.27	0.10	Enoyl-[acyl-carrier-protein] reductase [NADPH] FabI
3gns.1.A	8.57	homo-tetramer	HHblits	X-ray	2.71Å	0.27	0.10	Enoyl-[acyl-carrier-protein] reductase [NADH]
3gr6.1.A	8.57	homo-tetramer	HHblits	X-ray	2.28Å	0.27	0.10	Enoyl-[acyl-carrier-protein] reductase [NADH]
4oyh.1.A	14.29	homo-dimer	HHblits	X-ray	2.41Å	0.27	0.10	Molybdopterin-guanine dinucleotide biosynthesis protein B
4oyh.2.A	14.29	homo-dimer	HHblits	X-ray	2.41Å	0.27	0.10	Molybdopterin-guanine dinucleotide biosynthesis protein B
4oyh.2.B	14.29	homo-dimer	HHblits	X-ray	2.41Å	0.27	0.10	Molybdopterin-guanine dinucleotide biosynthesis protein B
4oyh.3.A	14.29	homo-dimer	HHblits	X-ray	2.41Å	0.27	0.10	Molybdopterin-guanine dinucleotide biosynthesis protein B
4oyh.3.B	14.29	homo-dimer	HHblits	X-ray	2.41Å	0.27	0.10	Molybdopterin-guanine dinucleotide biosynthesis protein B
4nkr.1.A	14.29	homo-dimer	HHblits	X-ray	2.41Å	0.27	0.10	Molybdopterin-guanine dinucleotide biosynthesis protein B
4nkr.2.A	14.29	homo-dimer	HHblits	X-ray	2.41Å	0.27	0.10	Molybdopterin-guanine dinucleotide biosynthesis protein B
4nkr.2.B	14.29	homo-dimer	HHblits	X-ray	2.41Å	0.27	0.10	Molybdopterin-guanine dinucleotide biosynthesis protein B
4nkr.3.A	14.29	homo-dimer	HHblits	X-ray	2.41Å	0.27	0.10	Molybdopterin-guanine dinucleotide biosynthesis protein B
4nkr.3.B	14.29	homo-dimer	HHblits	X-ray	2.41Å	0.27	0.10	Molybdopterin-guanine dinucleotide biosynthesis protein B
2zki.1.A	20.00	homo-tetramer	HHblits	X-ray	2.90Å	0.27	0.10	199aa long hypothetical Trp repressor binding protein
2zki.3.A	20.00	homo-tetramer	HHblits	X-ray	2.90Å	0.27	0.10	199aa long hypothetical Trp repressor binding protein
1mrn.1.A	20.00	homo-dimer	HHblits	X-ray	2.45Å	0.27	0.10	Thymidylate Kinase
1w2h.1.A	20.00	homo-dimer	HHblits	X-ray	2.00Å	0.27	0.10	THYMIDYLATE KINASE TMK
2pbr.1.B	26.47	homo-dimer	HHblits	X-ray	1.96Å	0.29	0.10	Thymidylate kinase
2pbr.1.A	26.47	homo-dimer	HHblits	X-ray	1.96Å	0.29	0.10	Thymidylate kinase
4s35.1.B	26.47	homo-dimer	HHblits	X-ray	1.55Å	0.29	0.10	Thymidylate kinase
5xb2.1.B	26.47	homo-dimer	HHblits	X-ray	2.16Å	0.29	0.10	Thymidylate kinase
5xbh.1.A	26.47	homo-dimer	HHblits	X-ray	2.23Å	0.29	0.10	Thymidylate kinase
2dzd.1.A	18.18	homo-dimer	HHblits	X-ray	2.40Å	0.32	0.09	pyruvate carboxylase
3geg.1.A	24.24	homo-tetramer	HHblits	X-ray	2.10Å	0.32	0.09	Short-chain dehydrogenase/reductase SDR
1cyd.1.A	15.15	homo-tetramer	HHblits	X-ray	1.80Å	0.32	0.09	CARBONYL REDUCTASE
3ojf.1.A	5.71	homo-tetramer	HHblits	X-ray	2.20Å	0.27	0.10	Enoyl-[acyl-carrier-protein] reductase (FabL) (NADPH)
3ojf.1.B	5.71	homo-tetramer	HHblits	X-ray	2.20Å	0.27	0.10	Enoyl-[acyl-carrier-protein] reductase (FabL) (NADPH)
3ojf.1.C	5.71	homo-tetramer	HHblits	X-ray	2.20Å	0.27	0.10	Enoyl-[acyl-carrier-protein] reductase (FabL) (NADPH)
3ojf.1.D	5.71	homo-tetramer	HHblits	X-ray	2.20Å	0.27	0.10	Enoyl-[acyl-carrier-protein] reductase (FabL) (NADPH)
2yw9.1.A	14.29	homo-tetramer	HHblits	X-ray	2.50Å	0.27	0.10	Enoyl-[acyl carrier protein] reductase
2wyv.1.D	14.29	homo-tetramer	HHblits	X-ray	1.86Å	0.27	0.10	ENOYL-[ACYL CARRIER PROTEIN] REDUCTASE
2wyw.1.D	14.29	homo-tetramer	HHblits	X-ray	1.90Å	0.27	0.10	ENOYL-[ACYL CARRIER PROTEIN] REDUCTASE
3bgk.1.A	11.43	homo-tetramer	HHblits	X-ray	2.50Å	0.27	0.10	Putative uncharacterized protein
5xtf.1.A	25.00	homo-tetramer	HHblits	X-ray	2.10Å	0.34	0.09	2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase
3q3c.1.A	31.25	homo-tetramer	HHblits	X-ray	2.30Å	0.34	0.09	Probable 3-hydroxyisobutyrate dehydrogenase
3obb.1.A	31.25	homo-tetramer	HHblits	X-ray	2.20Å	0.34	0.09	Probable 3-hydroxyisobutyrate dehydrogenase
5vj7.1.A	28.13	hetero-oligomer	HHblits	X-ray	2.55Å	0.34	0.09	Oxidoreductase
5jca.1.A	28.13	hetero-oligomer	HHblits	X-ray	1.50Å	0.34	0.09	NADH-dependent Ferredoxin:NADP Oxidoreductase (NfnI) subunit alpha
2ph3.1.A	14.71	homo-tetramer	HHblits	X-ray	1.91Å	0.29	0.10	3-oxoacyl-[acyl carrier protein] reductase
2ph3.1.B	14.71	homo-tetramer	HHblits	X-ray	1.91Å	0.29	0.10	3-oxoacyl-[acyl carrier protein] reductase
3ezl.1.A	21.21	homo-tetramer	HHblits	X-ray	2.25Å	0.32	0.09	Acetoacetyl-CoA reductase
4ffm.1.A	21.21	monomer	HHblits	X-ray	1.91Å	0.32	0.09	PylC
3emk.1.A	24.24	homo-tetramer	HHblits	X-ray	2.50Å	0.32	0.09	GLUCOSE/RIBITOL DEHYDROGENASE
3emk.1.C	24.24	homo-tetramer	HHblits	X-ray	2.50Å	0.32	0.09	GLUCOSE/RIBITOL DEHYDROGENASE
3enn.1.A	24.24	homo-tetramer	HHblits	X-ray	2.10Å	0.32	0.09	GLUCOSE/RIBITOL DEHYDROGENASE
3nt6.1.A	27.27	homo-dimer	HHblits	X-ray	2.00Å	0.32	0.09	FAD-dependent pyridine nucleotide-disulphide oxidoreductase
3cky.1.A	28.13	homo-tetramer	HHblits	X-ray	2.30Å	0.34	0.09	2-hydroxymethyl glutarate dehydrogenase
3cky.1.C	28.13	homo-tetramer	HHblits	X-ray	2.30Å	0.34	0.09	2-hydroxymethyl glutarate dehydrogenase
2hmw.1.A	28.13	homo-octamer	HHblits	X-ray	3.00Å	0.34	0.09	YuaA protein
2hmu.1.B	28.13	homo-octamer	HHblits	X-ray	2.25Å	0.34	0.09	YuaA protein
2hms.1.A	28.13	homo-octamer	HHblits	X-ray	2.70Å	0.34	0.09	YuaA protein
5but.1.A	28.13	hetero-oligomer	HHblits	X-ray	5.97Å	0.34	0.09	Ktr system potassium uptake protein A,Ktr system potassium uptake protein A
3v2h.1.A	18.18	homo-tetramer	HHblits	X-ray	3.00Å	0.31	0.09	D-beta-hydroxybutyrate dehydrogenase
1yxm.1.A	21.21	homo-tetramer	HHblits	X-ray	1.90Å	0.31	0.09	peroxisomal trans 2-enoyl CoA reductase
1yxm.1.D	21.21	homo-tetramer	HHblits	X-ray	1.90Å	0.31	0.09	peroxisomal trans 2-enoyl CoA reductase
3k3p.1.A	13.89	homo-dimer	HHblits	X-ray	2.23Å	0.24	0.10	D-alanine--D-alanine ligase
3l77.1.A	14.71	homo-tetramer	HHblits	X-ray	1.55Å	0.29	0.10	Short-chain alcohol dehydrogenase
5if9.1.A	20.59	monomer	HHblits	X-ray	1.80Å	0.29	0.10	Cobyrinic Acid a,c-diamide synthase
1vpd.1.A	25.00	monomer	HHblits	X-ray	1.65Å	0.34	0.09	TARTRONATE SEMIALDEHYDE REDUCTASE
3sj7.1.A	21.21	homo-tetramer	HHblits	X-ray	2.50Å	0.31	0.09	3-oxoacyl-(Acyl-carrier-protein) reductase
3sj7.1.B	21.21	homo-tetramer	HHblits	X-ray	2.50Å	0.31	0.09	3-oxoacyl-(Acyl-carrier-protein) reductase
2cfc.1.A	21.21	homo-tetramer	HHblits	X-ray	1.80Å	0.31	0.09	2-(R)-HYDROXYPROPYL-COM DEHYDROGENASE
3c3x.1.A	18.18	monomer	HHblits	X-ray	2.15Å	0.31	0.09	Eugenol synthase 1
2a4k.1.A	12.12	homo-dimer	HHblits	X-ray	2.30Å	0.31	0.09	3-oxoacyl-[acyl carrier protein] reductase
2a4k.1.B	12.12	homo-dimer	HHblits	X-ray	2.30Å	0.31	0.09	3-oxoacyl-[acyl carrier protein] reductase
1zk3.1.A	18.18	homo-tetramer	HHblits	X-ray	2.20Å	0.31	0.09	R-specific alcohol dehydrogenase
3uxm.1.A	17.14	monomer	HHblits	X-ray	1.95Å	0.26	0.10	Thymidylate kinase
3uxm.2.A	17.14	monomer	HHblits	X-ray	1.95Å	0.26	0.10	Thymidylate kinase
2a5l.1.A	11.11	homo-dimer	HHblits	X-ray	1.70Å	0.24	0.10	Trp repressor binding protein WrbA
5veg.1.A	11.11	monomer	HHblits	X-ray	1.99Å	0.24	0.10	Flavodoxin
5veg.2.A	11.11	monomer	HHblits	X-ray	1.99Å	0.24	0.10	Flavodoxin
1e3w.1.A	25.00	hetero-oligomer	HHblits	X-ray	2.00Å	0.33	0.09	SHORT CHAIN 3-HYDROXYACYL-COA DEHYDROGENASE
5mq6.1.A	21.21	monomer	HHblits	X-ray	2.00Å	0.31	0.09	Pyridine nucleotide-disulfide oxidoreductase-like protein
4cqm.1.B	18.18	hetero-oligomer	HHblits	X-ray	2.34Å	0.31	0.09	CARBONYL REDUCTASE FAMILY MEMBER 4
4cql.1.C	18.18	hetero-oligomer	HHblits	X-ray	2.85Å	0.31	0.09	CARBONYL REDUCTASE FAMILY MEMBER 4
4cql.2.B	18.18	hetero-oligomer	HHblits	X-ray	2.85Å	0.31	0.09	CARBONYL REDUCTASE FAMILY MEMBER 4
4cql.2.C	18.18	hetero-oligomer	HHblits	X-ray	2.85Å	0.31	0.09	CARBONYL REDUCTASE FAMILY MEMBER 4
4cql.3.B	18.18	hetero-oligomer	HHblits	X-ray	2.85Å	0.31	0.09	CARBONYL REDUCTASE FAMILY MEMBER 4
4cql.3.C	18.18	hetero-oligomer	HHblits	X-ray	2.85Å	0.31	0.09	CARBONYL REDUCTASE FAMILY MEMBER 4
4cql.4.B	18.18	hetero-oligomer	HHblits	X-ray	2.85Å	0.31	0.09	CARBONYL REDUCTASE FAMILY MEMBER 4
4cql.4.C	18.18	hetero-oligomer	HHblits	X-ray	2.85Å	0.31	0.09	CARBONYL REDUCTASE FAMILY MEMBER 4
4cql.1.B	18.18	hetero-oligomer	HHblits	X-ray	2.85Å	0.31	0.09	CARBONYL REDUCTASE FAMILY MEMBER 4
4cqm.2.C	18.18	hetero-oligomer	HHblits	X-ray	2.34Å	0.31	0.09	CARBONYL REDUCTASE FAMILY MEMBER 4
4cqm.3.C	18.18	hetero-oligomer	HHblits	X-ray	2.34Å	0.31	0.09	CARBONYL REDUCTASE FAMILY MEMBER 4
4cqm.4.C	18.18	hetero-oligomer	HHblits	X-ray	2.34Å	0.31	0.09	CARBONYL REDUCTASE FAMILY MEMBER 4
3hnp.1.A	8.33	homo-hexamer	HHblits	X-ray	2.60Å	0.24	0.10	Oxidoreductase
3hnp.1.D	8.33	homo-hexamer	HHblits	X-ray	2.60Å	0.24	0.10	Oxidoreductase
3ruh.1.A	17.65	homo-dimer	HHblits	X-ray	2.88Å	0.28	0.10	WbgU
3asv.1.A	21.88	homo-tetramer	HHblits	X-ray	2.70Å	0.33	0.09	Short-chain dehydrogenase/reductase SDR
3pdu.1.A	25.00	homo-tetramer	HHblits	X-ray	1.89Å	0.33	0.09	3-hydroxyisobutyrate dehydrogenase family protein
1x1e.1.A	21.88	homo-tetramer	HHblits	X-ray	1.76Å	0.33	0.09	2-deoxy-D-gluconate 3-dehydrogenase
3ek2.1.A	15.15	homo-tetramer	HHblits	X-ray	1.90Å	0.31	0.09	Enoyl-(Acyl-carrier-protein) reductase (NADH)
5ffq.1.A	24.24	homo-dimer	HHblits	X-ray	2.00Å	0.31	0.09	ShuY-like protein
3o38.1.A	14.71	homo-tetramer	HHblits	X-ray	1.95Å	0.28	0.10	Short chain dehydrogenase
3vvc.1.A	18.18	homo-hexamer	HHblits	X-ray	2.20Å	0.31	0.09	Capsular polysaccharide synthesis enzyme Cap8E
2hsd.1.A	18.18	homo-tetramer	HHblits	X-ray	2.64Å	0.31	0.09	3-ALPHA, 20 BETA-HYDROXYSTEROID DEHYDROGENASE
3zyx.1.A	18.75	homo-dimer	HHblits	X-ray	2.20Å	0.33	0.09	AMINE OXIDASE [FLAVIN-CONTAINING] B
2vdc.1.G	25.00	hetero-oligomer	HHblits	EM	9.50Å	0.33	0.09	GLUTAMATE SYNTHASE [NADPH] SMALL CHAIN
4om8.1.A	25.00	homo-dimer	HHblits	X-ray	1.55Å	0.33	0.09	3-hydroxybutyryl-coA dehydrogenase
5vz0.1.A	12.12	homo-tetramer	HHblits	X-ray	2.00Å	0.30	0.09	Pyruvate carboxylase
5vz0.1.D	12.12	homo-tetramer	HHblits	X-ray	2.00Å	0.30	0.09	Pyruvate carboxylase
5vyz.1.A	12.12	homo-tetramer	HHblits	X-ray	2.30Å	0.30	0.09	Pyruvate carboxylase
5vyz.1.B	12.12	homo-tetramer	HHblits	X-ray	2.30Å	0.30	0.09	Pyruvate carboxylase
3tpc.1.A	18.18	homo-tetramer	HHblits	X-ray	2.34Å	0.30	0.09	Short chain alcohol dehydrogenase-related dehydrogenase
2bgl.1.A	18.18	homo-tetramer	HHblits	X-ray	2.80Å	0.30	0.09	RHIZOME SECOISOLARICIRESINOL DEHYDROGENASE
2bgm.1.A	18.18	homo-tetramer	HHblits	X-ray	2.00Å	0.30	0.09	RHIZOME SECOISOLARICIRESINOL DEHYDROGENASE
2bgk.1.A	18.18	homo-tetramer	HHblits	X-ray	1.60Å	0.30	0.09	RHIZOME SECOISOLARICIRESINOL DEHYDROGENASE
2bgk.1.B	18.18	homo-tetramer	HHblits	X-ray	1.60Å	0.30	0.09	RHIZOME SECOISOLARICIRESINOL DEHYDROGENASE
1hdc.1.A	18.18	homo-tetramer	HHblits	X-ray	2.20Å	0.30	0.09	3-ALPHA, 20 BETA-HYDROXYSTEROID DEHYDROGENASE
3grk.1.A	11.76	homo-tetramer	HHblits	X-ray	2.35Å	0.28	0.10	Enoyl-(acyl-carrier-protein) reductase (NADH)
1zmo.1.A	14.71	homo-tetramer	HHblits	X-ray	2.00Å	0.28	0.10	halohydrin dehalogenase
3dtt.1.A	35.48	homo-dimer	HHblits	X-ray	1.70Å	0.35	0.09	NADP oxidoreductase
3eth.1.A	21.21	homo-dimer	HHblits	X-ray	1.60Å	0.30	0.09	Phosphoribosylaminoimidazole carboxylase ATPase subunit
1b6r.1.A	21.21	homo-dimer	HHblits	X-ray	2.10Å	0.30	0.09	PROTEIN (N5-CARBOXYAMINOIMIDAZOLE RIBONUCLEOTIDE SYNTHETASE)
3etj.1.A	21.21	homo-dimer	HHblits	X-ray	1.60Å	0.30	0.09	Phosphoribosylaminoimidazole carboxylase ATPase subunit
1b6s.1.A	21.21	homo-dimer	HHblits	X-ray	2.50Å	0.30	0.09	PROTEIN (N5-CARBOXYAMINOIMIDAZOLE RIBONUCLEOTIDE SYNTHETASE)
3w1v.1.B	18.18	homo-hexamer	HHblits	X-ray	2.10Å	0.30	0.09	Capsular polysaccharide synthesis enzyme Cap8E
3vvb.1.F	18.18	homo-hexamer	HHblits	X-ray	2.80Å	0.30	0.09	CapE
4j2o.1.A	18.18	homo-hexamer	HHblits	X-ray	2.65Å	0.30	0.09	UDP-N-acetylglucosamine 4,6-dehydratase/5-epimerase
4j2o.1.D	18.18	homo-hexamer	HHblits	X-ray	2.65Å	0.30	0.09	UDP-N-acetylglucosamine 4,6-dehydratase/5-epimerase
3hbl.1.A	15.15	homo-tetramer	HHblits	X-ray	2.71Å	0.30	0.09	Pyruvate carboxylase
3hbl.1.B	15.15	homo-tetramer	HHblits	X-ray	2.71Å	0.30	0.09	Pyruvate carboxylase
3hbl.1.C	15.15	homo-tetramer	HHblits	X-ray	2.71Å	0.30	0.09	Pyruvate carboxylase
3hbl.1.D	15.15	homo-tetramer	HHblits	X-ray	2.71Å	0.30	0.09	Pyruvate carboxylase
2yqu.1.A	21.21	homo-dimer	HHblits	X-ray	1.70Å	0.30	0.09	2-oxoglutarate dehydrogenase E3 component
2eq7.1.A	21.21	hetero-oligomer	HHblits	X-ray	1.80Å	0.30	0.09	2-oxoglutarate dehydrogenase E3 component
5b6k.1.A	18.18	monomer	HHblits	X-ray	1.70Å	0.30	0.09	Uncharacterized protein CgKR1
4dqx.1.A	18.18	homo-tetramer	HHblits	X-ray	2.00Å	0.30	0.09	Probable oxidoreductase protein
2g1u.1.A	25.00	homo-dimer	HHblits	X-ray	1.50Å	0.32	0.09	hypothetical protein tm1088a
4unq.1.A	20.59	monomer	HHblits	X-ray	2.30Å	0.28	0.10	THYMIDYLATE KINASE
4unq.2.A	20.59	monomer	HHblits	X-ray	2.30Å	0.28	0.10	THYMIDYLATE KINASE
4unp.1.A	20.59	monomer	HHblits	X-ray	2.30Å	0.28	0.10	THYMIDYLATE KINASE
4unn.1.A	20.59	monomer	HHblits	X-ray	2.50Å	0.28	0.10	THYMIDYLATE KINASE
4oqz.1.A	25.81	homo-dimer	HHblits	X-ray	1.96Å	0.35	0.09	Putative oxidoreductase YfjR
5khl.1.A	14.29	monomer	HHblits	X-ray	2.40Å	0.25	0.10	Hemin ABC transporter, periplasmic hemin-binding protein HutB
2nm0.1.A	18.18	homo-tetramer	HHblits	X-ray	1.99Å	0.30	0.09	Probable 3-oxacyl-(Acyl-carrier-protein) reductase
3fbs.1.A	21.21	homo-dimer	HHblits	X-ray	2.15Å	0.30	0.09	Oxidoreductase
4qsl.1.A	12.12	homo-tetramer	HHblits	X-ray	3.28Å	0.30	0.09	Pyruvate carboxylase
4qsl.1.B	12.12	homo-tetramer	HHblits	X-ray	3.28Å	0.30	0.09	Pyruvate carboxylase
4qsl.1.C	12.12	homo-tetramer	HHblits	X-ray	3.28Å	0.30	0.09	Pyruvate carboxylase
4qsl.1.D	12.12	homo-tetramer	HHblits	X-ray	3.28Å	0.30	0.09	Pyruvate carboxylase
4yyz.1.A	18.75	homo-dimer	HHblits	X-ray	3.20Å	0.32	0.09	Corticosteroid 11-beta-dehydrogenase isozyme 1
4yyz.1.B	18.75	homo-dimer	HHblits	X-ray	3.20Å	0.32	0.09	Corticosteroid 11-beta-dehydrogenase isozyme 1
3aet.1.B	21.88	hetero-oligomer	HHblits	X-ray	2.91Å	0.32	0.09	Light-independent protochlorophyllide reductase subunit B
2y99.1.B	18.75	homo-tetramer	HHblits	X-ray	2.50Å	0.32	0.09	CIS-2,3-DIHYDROBIPHENYL-2,3-DIOL DEHYDROGENASE
2y99.1.A	18.75	homo-tetramer	HHblits	X-ray	2.50Å	0.32	0.09	CIS-2,3-DIHYDROBIPHENYL-2,3-DIOL DEHYDROGENASE
3zv6.1.A	18.75	homo-tetramer	HHblits	X-ray	2.14Å	0.32	0.09	CIS-2,3-DIHYDROBIPHENYL-2,3-DIOL DEHYDROGENASE
4a6n.4.A	29.03	monomer	HHblits	X-ray	2.30Å	0.35	0.09	TETX2 PROTEIN
2xdo.1.A	29.03	monomer	HHblits	X-ray	2.09Å	0.35	0.09	TETX2 PROTEIN
5jca.1.B	21.21	hetero-oligomer	HHblits	X-ray	1.50Å	0.30	0.09	NADH-dependent Ferredoxin:NADP Oxidoreductase (NfnI) subunit beta
1e3s.1.A	21.88	homo-tetramer	HHblits	X-ray	2.00Å	0.32	0.09	SHORT CHAIN 3-HYDROXYACYL-COA DEHYDROGENASE
3e8x.1.A	18.75	homo-dimer	HHblits	X-ray	2.10Å	0.32	0.09	Putative NAD-dependent epimerase/dehydratase
4dyv.1.A	25.00	homo-tetramer	HHblits	X-ray	1.80Å	0.32	0.09	Short-chain dehydrogenase/reductase SDR
3k30.1.A	21.88	homo-dimer	HHblits	X-ray	2.70Å	0.32	0.09	Histamine dehydrogenase
3kzv.1.A	14.71	homo-tetramer	HHblits	X-ray	2.00Å	0.27	0.10	Uncharacterized oxidoreductase YIR035C
1ydw.1.A	17.65	homo-dimer	HHblits	X-ray	2.49Å	0.27	0.10	AX110P-like protein
2q4e.1.B	17.65	homo-dimer	HHblits	X-ray	2.49Å	0.27	0.10	Probable oxidoreductase At4g09670
1k2w.1.A	12.12	homo-dimer	HHblits	X-ray	2.40Å	0.29	0.09	SORBITOL DEHYDROGENASE
4xgn.1.A	18.18	homo-tetramer	HHblits	X-ray	1.65Å	0.29	0.09	3-hydroxyacyl-CoA dehydrogenase
3n74.1.A	15.15	homo-tetramer	HHblits	X-ray	2.20Å	0.29	0.09	3-ketoacyl-(acyl-carrier-protein) reductase
4z0t.1.A	15.15	monomer	HHblits	X-ray	1.50Å	0.29	0.09	Oxidoreductase, short-chain dehydrogenase/reductase family
3ak4.1.A	18.18	homo-tetramer	HHblits	X-ray	2.00Å	0.29	0.09	NADH-dependent quinuclidinone reductase
3wds.1.C	18.18	homo-tetramer	HHblits	X-ray	1.72Å	0.29	0.09	NADH-dependent quinuclidinone reductase
3vtf.1.A	24.24	homo-dimer	HHblits	X-ray	2.00Å	0.29	0.09	UDP-glucose 6-dehydrogenase
3gvc.1.A	25.00	homo-tetramer	HHblits	X-ray	2.45Å	0.32	0.09	Probable short-chain type dehydrogenase/reductase
4npc.1.A	15.63	homo-dimer	HHblits	X-ray	1.75Å	0.32	0.09	Sorbitol dehydrogenase
3s2y.1.A	11.76	homo-tetramer	HHblits	X-ray	2.24Å	0.27	0.10	Chromate reductase
3lyu.1.A	17.65	homo-hexamer	HHblits	X-ray	2.30Å	0.27	0.10	Putative hydrogenase
3lrx.1.A	17.65	homo-hexamer	HHblits	X-ray	2.60Å	0.27	0.10	Putative hydrogenase
4z9f.1.A	14.71	homo-tetramer	HHblits	X-ray	1.75Å	0.27	0.10	Halohydrin epoxidase A
2gr3.1.A	19.35	homo-dimer	HHblits	X-ray	1.50Å	0.34	0.09	ferredoxin reductase
2bxs.1.A	29.03	monomer	HHblits	X-ray	3.15Å	0.34	0.09	AMINE OXIDASE [FLAVIN-CONTAINING] A
4zrm.1.A	22.58	homo-dimer	HHblits	X-ray	1.90Å	0.34	0.09	UDP-glucose 4-epimerase
4zrn.1.A	22.58	homo-dimer	HHblits	X-ray	2.00Å	0.34	0.09	UDP-glucose 4-epimerase
4ylf.1.A	12.12	hetero-oligomer	HHblits	X-ray	2.30Å	0.29	0.09	Dihydroorotate dehydrogenase B (NAD(+)), electron transfer subunit homolog
4ylf.2.A	12.12	hetero-oligomer	HHblits	X-ray	2.30Å	0.29	0.09	Dihydroorotate dehydrogenase B (NAD(+)), electron transfer subunit homolog
4yry.1.A	12.12	hetero-oligomer	HHblits	X-ray	2.40Å	0.29	0.09	Dihydroorotate dehydrogenase B (NAD(+)), electron transfer subunit homolog
4yry.2.A	12.12	hetero-oligomer	HHblits	X-ray	2.40Å	0.29	0.09	Dihydroorotate dehydrogenase B (NAD(+)), electron transfer subunit homolog
2b4q.1.A	18.18	homo-dimer	HHblits	X-ray	2.30Å	0.29	0.09	Rhamnolipids biosynthesis 3-oxoacyl-[acyl-carrier-protein] reductase
2b4q.1.B	18.18	homo-dimer	HHblits	X-ray	2.30Å	0.29	0.09	Rhamnolipids biosynthesis 3-oxoacyl-[acyl-carrier-protein] reductase
4qec.1.A	18.18	homo-dimer	HHblits	X-ray	1.90Å	0.29	0.09	ElxO
4qed.1.A	18.18	homo-dimer	HHblits	X-ray	1.85Å	0.29	0.09	ElxO
1fk8.1.A	15.15	homo-dimer	HHblits	X-ray	1.95Å	0.29	0.09	3ALPHA-HYDROXYSTEROID DEHYDROGENASE/CARBONYL REDUCTASE
1fk8.1.B	15.15	homo-dimer	HHblits	X-ray	1.95Å	0.29	0.09	3ALPHA-HYDROXYSTEROID DEHYDROGENASE/CARBONYL REDUCTASE
3rd5.1.A	15.15	monomer	HHblits	X-ray	1.50Å	0.29	0.09	MYPAA.01249.C
5l51.1.A	15.15	monomer	HHblits	X-ray	2.66Å	0.29	0.09	(-)-menthone:(+)-neomenthol reductase
3u09.1.A	12.12	homo-tetramer	HHblits	X-ray	1.75Å	0.29	0.09	3-oxoacyl-[acyl-carrier-protein] reductase FabG
5twb.1.A	24.24	homo-dimer	HHblits	X-ray	1.82Å	0.29	0.09	Ferredoxin--NADP reductase
5twc.1.A	24.24	homo-dimer	HHblits	X-ray	2.31Å	0.29	0.09	Ferredoxin--NADP reductase
3vzq.1.A	18.75	homo-tetramer	HHblits	X-ray	2.00Å	0.32	0.09	Acetoacetyl-CoA reductase
3vzr.1.A	18.75	homo-tetramer	HHblits	X-ray	2.90Å	0.32	0.09	Acetoacetyl-CoA reductase
3vzp.1.A	18.75	homo-tetramer	HHblits	X-ray	1.79Å	0.32	0.09	Acetoacetyl-CoA reductase
4j9u.1.C	18.75	hetero-oligomer	HHblits	X-ray	3.80Å	0.32	0.09	Potassium uptake protein TrkA
4j9v.1.A	18.75	homo-tetramer	HHblits	X-ray	3.05Å	0.32	0.09	Potassium uptake protein TrkA
4j9v.1.B	18.75	homo-tetramer	HHblits	X-ray	3.05Å	0.32	0.09	Potassium uptake protein TrkA
5kmq.1.A	15.15	homo-dimer	HHblits	X-ray	2.70Å	0.29	0.09	FAD-dependent pyridine nucleotide-disulfide oxidoreductase
5cej.1.A	12.12	homo-tetramer	HHblits	X-ray	2.50Å	0.29	0.09	3-oxoacyl-[acyl-carrier protein] reductase
5cdy.1.C	12.12	homo-tetramer	HHblits	X-ray	2.85Å	0.29	0.09	3-oxoacyl-[acyl-carrier protein] reductase
5cdy.1.A	12.12	homo-tetramer	HHblits	X-ray	2.85Å	0.29	0.09	3-oxoacyl-[acyl-carrier protein] reductase
3ru7.1.A	18.18	homo-dimer	HHblits	X-ray	2.60Å	0.29	0.09	WbgU
3ruc.1.A	18.18	homo-dimer	HHblits	X-ray	2.10Å	0.29	0.09	WbgU
1geg.1.A	15.15	homo-tetramer	HHblits	X-ray	1.70Å	0.29	0.09	ACETOIN REDUCTASE
1i8t.1.A	21.21	homo-dimer	HHblits	X-ray	2.40Å	0.29	0.09	UDP-GALACTOPYRANOSE MUTASE
1i8t.1.B	21.21	homo-dimer	HHblits	X-ray	2.40Å	0.29	0.09	UDP-GALACTOPYRANOSE MUTASE
3uwo.1.A	17.65	monomer	HHblits	X-ray	1.70Å	0.27	0.10	Thymidylate kinase
3uwk.1.A	17.65	monomer	HHblits	X-ray	1.91Å	0.27	0.10	Thymidylate kinase
3hjn.1.A	20.59	homo-dimer	HHblits	X-ray	2.10Å	0.27	0.10	Thymidylate kinase
3hjn.1.B	20.59	homo-dimer	HHblits	X-ray	2.10Å	0.27	0.10	Thymidylate kinase
3tzq.1.A	18.18	homo-tetramer	HHblits	X-ray	2.50Å	0.29	0.09	Short-chain type dehydrogenase/reductase
1jf8.1.A	18.18	monomer	HHblits	X-ray	1.12Å	0.29	0.09	arsenate reductase
1jfv.1.A	18.18	monomer	HHblits	X-ray	2.00Å	0.29	0.09	arsenate reductase
1rxi.1.A	18.18	monomer	HHblits	X-ray	1.50Å	0.29	0.09	Arsenate reductase
2hq1.1.A	15.15	homo-tetramer	HHblits	X-ray	1.90Å	0.29	0.09	Glucose/ribitol dehydrogenase
2zat.1.A	15.15	homo-tetramer	HHblits	X-ray	1.50Å	0.29	0.09	Dehydrogenase/reductase SDR family member 4
4pfs.1.A	21.21	monomer	HHblits	X-ray	2.30Å	0.29	0.09	Cobyrinic Acid a,c-diamide synthase
4pfs.2.A	21.21	monomer	HHblits	X-ray	2.30Å	0.29	0.09	Cobyrinic Acid a,c-diamide synthase
5jo9.1.A	25.81	homo-tetramer	HHblits	X-ray	2.89Å	0.34	0.09	Ribitol 2-dehydrogenase
1djn.1.A	18.75	homo-dimer	HHblits	X-ray	2.20Å	0.31	0.09	TRIMETHYLAMINE DEHYDROGENASE
1djq.1.A	18.75	homo-dimer	HHblits	X-ray	2.20Å	0.31	0.09	TRIMETHYLAMINE DEHYDROGENASE
1ulz.1.A	15.63	homo-dimer	HHblits	X-ray	2.20Å	0.31	0.09	pyruvate carboxylase n-terminal domain
5jyd.1.A	21.88	homo-tetramer	HHblits	X-ray	1.65Å	0.31	0.09	Short chain dehydrogenase
1sez.1.A	21.88	homo-dimer	HHblits	X-ray	2.90Å	0.31	0.09	Protoporphyrinogen oxidase, mitochondrial
1sez.1.B	21.88	homo-dimer	HHblits	X-ray	2.90Å	0.31	0.09	Protoporphyrinogen oxidase, mitochondrial
3hly.1.A	5.56	monomer	HHblits	X-ray	2.40Å	0.22	0.10	Flavodoxin-like domain
3hly.2.A	5.56	monomer	HHblits	X-ray	2.40Å	0.22	0.10	Flavodoxin-like domain
3hly.3.A	5.56	monomer	HHblits	X-ray	2.40Å	0.22	0.10	Flavodoxin-like domain
4nk4.1.A	8.82	homo-dimer	HHblits	X-ray	1.70Å	0.26	0.10	Enoyl-[acyl-carrier-protein] reductase [NADH]
4nk5.1.A	8.82	homo-dimer	HHblits	X-ray	2.70Å	0.26	0.10	Enoyl-[acyl-carrier-protein] reductase [NADH]
3md9.1.A	14.71	monomer	HHblits	X-ray	1.50Å	0.26	0.10	Hemin-binding periplasmic protein hmuT
3md9.2.A	14.71	monomer	HHblits	X-ray	1.50Å	0.26	0.10	Hemin-binding periplasmic protein hmuT
3ab1.1.A	21.21	homo-dimer	HHblits	X-ray	2.39Å	0.29	0.09	Ferredoxin--NADP reductase
3ab1.1.B	21.21	homo-dimer	HHblits	X-ray	2.39Å	0.29	0.09	Ferredoxin--NADP reductase
2nwq.1.A	12.12	homo-tetramer	HHblits	X-ray	2.30Å	0.29	0.09	Probable short-chain dehydrogenase
3kkj.1.A	29.03	homo-dimer	HHblits	X-ray	2.50Å	0.34	0.09	Amine oxidase, flavin-containing
2wdz.1.A	18.75	homo-tetramer	HHblits	X-ray	1.95Å	0.31	0.09	SHORT-CHAIN DEHYDROGENASE/REDUCTASE
3lqf.1.D	18.75	homo-tetramer	HHblits	X-ray	1.80Å	0.31	0.09	Galactitol dehydrogenase
4a9w.1.A	21.88	homo-dimer	HHblits	X-ray	2.72Å	0.31	0.09	MONOOXYGENASE
3tzc.1.A	15.63	homo-tetramer	HHblits	X-ray	2.45Å	0.31	0.09	3-oxoacyl-[acyl-carrier protein] reductase
3tzc.1.B	15.63	homo-tetramer	HHblits	X-ray	2.45Å	0.31	0.09	3-oxoacyl-[acyl-carrier protein] reductase
1uay.1.A	18.75	homo-tetramer	HHblits	X-ray	1.40Å	0.31	0.09	Type II 3-hydroxyacyl-CoA dehydrogenase
3ius.1.A	15.15	monomer	HHblits	X-ray	1.66Å	0.28	0.09	uncharacterized conserved protein
3ius.2.A	15.15	monomer	HHblits	X-ray	1.66Å	0.28	0.09	uncharacterized conserved protein
3oid.1.A	15.15	homo-tetramer	HHblits	X-ray	1.80Å	0.28	0.09	Enoyl-[acyl-carrier-protein] reductase [NADPH]
3oic.1.B	15.15	homo-tetramer	HHblits	X-ray	2.20Å	0.28	0.09	Enoyl-[acyl-carrier-protein] reductase [NADPH]
3oic.1.A	15.15	homo-tetramer	HHblits	X-ray	2.20Å	0.28	0.09	Enoyl-[acyl-carrier-protein] reductase [NADPH]
3m1a.1.A	15.15	homo-10-mer	HHblits	X-ray	2.00Å	0.28	0.09	Putative dehydrogenase
3rwb.1.A	12.12	homo-tetramer	HHblits	X-ray	1.70Å	0.28	0.09	Pyridoxal 4-dehydrogenase
4ywo.1.A	29.03	homo-dimer	HHblits	X-ray	1.62Å	0.33	0.09	Mercuric reductase
1ojt.1.A	25.81	homo-dimer	HHblits	X-ray	2.75Å	0.33	0.09	SURFACE PROTEIN
5jqw.1.A	25.00	homo-dimer	HHblits	X-ray	2.06Å	0.31	0.09	N5-carboxyaminoimidazole ribonucleotide synthase
3rnm.1.A	18.75	hetero-oligomer	HHblits	X-ray	2.40Å	0.31	0.09	Dihydrolipoyl dehydrogenase, mitochondrial
4g9k.1.A	18.75	homo-dimer	HHblits	X-ray	2.70Å	0.31	0.09	Rotenone-insensitive NADH-ubiquinone oxidoreductase
4g6g.1.A	18.75	homo-dimer	HHblits	X-ray	2.39Å	0.31	0.09	Rotenone-insensitive NADH-ubiquinone oxidoreductase, mitochondrial
1wvg.1.A	17.65	homo-tetramer	HHblits	X-ray	1.80Å	0.26	0.10	CDP-glucose 4,6-dehydratase
1wvg.1.B	17.65	homo-tetramer	HHblits	X-ray	1.80Å	0.26	0.10	CDP-glucose 4,6-dehydratase
3doj.1.A	22.58	homo-tetramer	HHblits	X-ray	2.10Å	0.33	0.09	Dehydrogenase-like protein
2c75.1.A	19.35	homo-dimer	HHblits	X-ray	1.70Å	0.33	0.09	AMINE OXIDASE (FLAVIN-CONTAINING) B
2c73.1.A	19.35	homo-dimer	HHblits	X-ray	2.20Å	0.33	0.09	AMINE OXIDASE (FLAVIN-CONTAINING) B
2xcg.1.A	19.35	homo-dimer	HHblits	X-ray	1.90Å	0.33	0.09	AMINE OXIDASE [FLAVIN-CONTAINING] B
1gos.1.A	19.35	homo-dimer	HHblits	X-ray	3.00Å	0.33	0.09	MONOAMINE OXIDASE
2bk5.1.A	19.35	homo-dimer	HHblits	X-ray	1.83Å	0.33	0.09	AMINE OXIDASE [FLAVIN-CONTAINING] B
4j2w.2.A	25.81	monomer	HHblits	X-ray	2.60Å	0.33	0.09	Kynurenine 3-monooxygenase
4j2w.1.A	25.81	monomer	HHblits	X-ray	2.60Å	0.33	0.09	Kynurenine 3-monooxygenase
3l4b.1.C	29.03	hetero-oligomer	HHblits	X-ray	3.45Å	0.33	0.09	TrkA K+ Channel protien TM1088B
1q7c.1.A	15.63	homo-tetramer	HHblits	X-ray	2.50Å	0.31	0.09	3-oxoacyl-[acyl-carrier protein] reductase
1i01.1.D	15.63	homo-tetramer	HHblits	X-ray	2.60Å	0.31	0.09	BETA-KETOACYL [ACP] REDUCTASE
1q7b.1.A	15.63	homo-tetramer	HHblits	X-ray	2.05Å	0.31	0.09	3-oxoacyl-[acyl-carrier protein] reductase
1i01.1.A	15.63	homo-tetramer	HHblits	X-ray	2.60Å	0.31	0.09	BETA-KETOACYL [ACP] REDUCTASE
3mle.1.A	8.82	homo-dimer	HHblits	X-ray	2.80Å	0.26	0.10	Dethiobiotin synthetase
1yqz.1.A	15.15	homo-dimer	HHblits	X-ray	1.54Å	0.28	0.09	coenzyme A disulfide reductase
2pd6.1.A	12.12	homo-tetramer	HHblits	X-ray	2.00Å	0.28	0.09	Estradiol 17-beta-dehydrogenase 8
5o30.1.A	21.88	homo-tetramer	HHblits	X-ray	2.30Å	0.30	0.09	Putative oxidoreductase
3tfo.1.A	18.75	homo-tetramer	HHblits	X-ray	2.08Å	0.30	0.09	putative 3-oxoacyl-(acyl-carrier-protein) reductase
4bmv.1.A	9.38	homo-dimer	HHblits	X-ray	2.50Å	0.30	0.09	SHORT-CHAIN DEHYDROGENASE
1ahi.1.D	18.75	homo-tetramer	HHblits	X-ray	2.30Å	0.30	0.09	7 ALPHA-HYDROXYSTEROID DEHYDROGENASE
1ahh.1.A	18.75	homo-tetramer	HHblits	X-ray	2.30Å	0.30	0.09	7 ALPHA-HYDROXYSTEROID DEHYDROGENASE
3k96.1.A	25.00	homo-dimer	HHblits	X-ray	2.10Å	0.30	0.09	Glycerol-3-phosphate dehydrogenase [NAD(P)+]
3k96.1.B	25.00	homo-dimer	HHblits	X-ray	2.10Å	0.30	0.09	Glycerol-3-phosphate dehydrogenase [NAD(P)+]
4gcm.1.A	21.88	homo-dimer	HHblits	X-ray	1.80Å	0.30	0.09	Thioredoxin reductase
4k6f.1.A	18.18	homo-tetramer	HHblits	X-ray	1.50Å	0.28	0.09	Putative Acetoacetyl-CoA reductase
1rkx.1.A	21.21	homo-tetramer	HHblits	X-ray	1.80Å	0.28	0.09	CDP-glucose-4,6-dehydratase
5fyd.1.A	15.15	homo-dimer	HHblits	X-ray	1.60Å	0.28	0.09	OXIDOREDUCTASE, SHORT CHAIN DEHYDROGENASE/REDUCTASE FAMILY PROTEIN
5fyd.1.B	15.15	homo-dimer	HHblits	X-ray	1.60Å	0.28	0.09	OXIDOREDUCTASE, SHORT CHAIN DEHYDROGENASE/REDUCTASE FAMILY PROTEIN
5gt9.1.A	15.15	homo-dimer	HHblits	X-ray	1.70Å	0.28	0.09	Oxidoreductase, short chain dehydrogenase/reductase family protein
5gt9.1.B	15.15	homo-dimer	HHblits	X-ray	1.70Å	0.28	0.09	Oxidoreductase, short chain dehydrogenase/reductase family protein
2uvd.1.A	15.15	homo-tetramer	HHblits	X-ray	2.40Å	0.28	0.09	3-OXOACYL-(ACYL-CARRIER-PROTEIN) REDUCTASE
1zy8.1.A	18.75	hetero-oligomer	HHblits	X-ray	2.59Å	0.30	0.09	Dihydrolipoyl dehydrogenase, mitochondrial
1zy8.5.A	18.75	hetero-oligomer	HHblits	X-ray	2.59Å	0.30	0.09	Dihydrolipoyl dehydrogenase, mitochondrial
1zy8.5.B	18.75	hetero-oligomer	HHblits	X-ray	2.59Å	0.30	0.09	Dihydrolipoyl dehydrogenase, mitochondrial
3llv.1.A	15.63	monomer	HHblits	X-ray	1.70Å	0.30	0.09	Exopolyphosphatase-related protein
3guy.1.A	22.58	homo-tetramer	HHblits	X-ray	1.90Å	0.33	0.09	Short-chain dehydrogenase/reductase SDR
1ks9.1.A	29.03	monomer	HHblits	X-ray	1.70Å	0.33	0.09	2-DEHYDROPANTOATE 2-REDUCTASE
1nfr.1.A	15.63	homo-tetramer	HHblits	X-ray	2.10Å	0.30	0.09	Putative oxidoreductase Rv2002
3tn7.1.A	12.12	homo-tetramer	HHblits	X-ray	1.68Å	0.28	0.09	Short-chain alcohol dehydrogenase
4iuy.1.A	12.50	homo-tetramer	HHblits	X-ray	2.38Å	0.30	0.09	Short chain dehydrogenase/reductase
1ep3.1.B	25.00	hetero-oligomer	HHblits	X-ray	2.10Å	0.30	0.09	DIHYDROOROTATE DEHYDROGENASE B (PYRK SUBUNIT)
3p19.1.A	12.50	homo-tetramer	HHblits	X-ray	2.05Å	0.30	0.09	Putative blue fluorescent protein
3lzw.1.A	28.13	homo-dimer	HHblits	X-ray	1.80Å	0.30	0.09	Ferredoxin--NADP reductase 2
3lzx.1.A	28.13	homo-dimer	HHblits	X-ray	1.90Å	0.30	0.09	Ferredoxin--NADP reductase 2
4mge.1.A	11.76	monomer	HHblits	X-ray	1.85Å	0.25	0.10	PTS system, cellobiose-specific IIB component
4mge.2.A	11.76	monomer	HHblits	X-ray	1.85Å	0.25	0.10	PTS system, cellobiose-specific IIB component
2ehd.1.A	15.63	homo-dimer	HHblits	X-ray	2.40Å	0.30	0.09	Oxidoreductase, short-chain dehydrogenase/reductase family
2ehd.1.B	15.63	homo-dimer	HHblits	X-ray	2.40Å	0.30	0.09	Oxidoreductase, short-chain dehydrogenase/reductase family
5mrc.41.A	16.13	monomer	HHblits	EM	NA	0.32	0.09	uS2m
2vns.1.A	19.35	homo-dimer	HHblits	X-ray	2.00Å	0.32	0.09	METALLOREDUCTASE STEAP3
2vq3.1.A	19.35	homo-dimer	HHblits	X-ray	2.00Å	0.32	0.09	METALLOREDUCTASE STEAP3
2vq3.1.B	19.35	homo-dimer	HHblits	X-ray	2.00Å	0.32	0.09	METALLOREDUCTASE STEAP3
3k5i.1.A	22.58	homo-dimer	HHblits	X-ray	2.00Å	0.32	0.09	Phosphoribosyl-aminoimidazole carboxylase
3k5i.1.B	22.58	homo-dimer	HHblits	X-ray	2.00Å	0.32	0.09	Phosphoribosyl-aminoimidazole carboxylase
3k5h.1.A	22.58	homo-dimer	HHblits	X-ray	2.10Å	0.32	0.09	Phosphoribosyl-aminoimidazole carboxylase
3k5h.1.B	22.58	homo-dimer	HHblits	X-ray	2.10Å	0.32	0.09	Phosphoribosyl-aminoimidazole carboxylase
1yjq.1.A	29.03	monomer	HHblits	X-ray	2.09Å	0.32	0.09	2-dehydropantoate 2-reductase
2nq8.1.A	12.12	hetero-oligomer	HHblits	X-ray	2.50Å	0.27	0.09	Enoyl-acyl carrier reductase
5dou.1.A	12.12	homo-dimer	HHblits	X-ray	2.60Å	0.27	0.09	Carbamoyl-phosphate synthase [ammonia], mitochondrial
5dot.1.A	12.12	homo-dimer	HHblits	X-ray	2.40Å	0.27	0.09	Carbamoyl-phosphate synthase [ammonia], mitochondrial
4q9n.1.A	11.76	homo-tetramer	HHblits	X-ray	1.80Å	0.25	0.10	Enoyl-[acyl-carrier-protein] reductase [NADH]
2l2q.1.A	11.76	monomer	HHblits	NMR	NA	0.25	0.10	PTS system, cellobiose-specific IIB component (CelA)
4v61.1.B	33.33	hetero-oligomer	HHblits	EM	NA	0.35	0.08	Ribosomal Protein S2
2qae.1.A	18.75	homo-dimer	HHblits	X-ray	1.90Å	0.30	0.09	Dihydrolipoyl dehydrogenase
3tzh.1.A	12.50	homo-tetramer	HHblits	X-ray	2.10Å	0.30	0.09	3-oxoacyl-[acyl-carrier protein] reductase
3op4.1.A	12.50	homo-tetramer	HHblits	X-ray	1.60Å	0.30	0.09	3-oxoacyl-[acyl-carrier protein] reductase
4pvc.1.A	12.50	homo-dimer	HHblits	X-ray	2.00Å	0.30	0.09	NADPH-dependent methylglyoxal reductase GRE2
4pvd.1.A	12.50	monomer	HHblits	X-ray	2.40Å	0.30	0.09	NADPH-dependent methylglyoxal reductase GRE2
4pvd.3.A	12.50	monomer	HHblits	X-ray	2.40Å	0.30	0.09	NADPH-dependent methylglyoxal reductase GRE2
2ew2.1.A	32.26	homo-dimer	HHblits	X-ray	2.00Å	0.32	0.09	2-dehydropantoate 2-reductase, putative
5g6s.1.A	25.81	homo-dimer	HHblits	X-ray	2.35Å	0.32	0.09	IMINE REDUCTASE
5g6r.1.A	25.81	homo-dimer	HHblits	X-ray	1.82Å	0.32	0.09	IMINE REDUCTASE
4buc.1.A	25.81	monomer	HHblits	X-ray	2.17Å	0.32	0.09	UDP-N-ACETYLMURAMOYLALANINE--D-GLUTAMATE LIGASE
4buc.2.A	25.81	monomer	HHblits	X-ray	2.17Å	0.32	0.09	UDP-N-ACETYLMURAMOYLALANINE--D-GLUTAMATE LIGASE
1enp.1.A	12.12	homo-tetramer	HHblits	X-ray	2.60Å	0.27	0.09	ENOYL ACYL CARRIER PROTEIN REDUCTASE
2gf2.1.A	20.00	homo-dimer	HHblits	X-ray	2.38Å	0.34	0.08	3-hydroxyisobutyrate dehydrogenase
4nwz.1.A	15.63	homo-dimer	HHblits	X-ray	2.50Å	0.29	0.09	FAD-dependent pyridine nucleotide-disulfide oxidoreductase
5j60.1.A	12.50	homo-dimer	HHblits	X-ray	1.90Å	0.29	0.09	Thioredoxin reductase
4ntd.1.A	18.75	homo-dimer	HHblits	X-ray	1.60Å	0.29	0.09	Thioredoxin reductase
5ksw.1.B	21.88	hetero-oligomer	HHblits	X-ray	2.47Å	0.29	0.09	Dihydroorotate dehydrogenase B (NAD(+)), electron transfer subunit
4e6p.1.A	12.50	homo-tetramer	HHblits	X-ray	2.10Å	0.29	0.09	Probable sorbitol dehydrogenase (L-iditol 2-dehydrogenase)
2acv.1.A	18.75	homo-dimer	HHblits	X-ray	2.00Å	0.29	0.09	triterpene UDP-glucosyl transferase UGT71G1
2acv.1.B	18.75	homo-dimer	HHblits	X-ray	2.00Å	0.29	0.09	triterpene UDP-glucosyl transferase UGT71G1
2acw.1.A	18.75	homo-dimer	HHblits	X-ray	2.60Å	0.29	0.09	triterpene UDP-glucosyl transferase UGT71G1
2acw.1.B	18.75	homo-dimer	HHblits	X-ray	2.60Å	0.29	0.09	triterpene UDP-glucosyl transferase UGT71G1
3if9.1.A	15.63	homo-tetramer	HHblits	X-ray	2.60Å	0.29	0.09	Glycine oxidase
3tzk.1.A	12.50	homo-tetramer	HHblits	X-ray	1.80Å	0.29	0.09	3-oxoacyl-[acyl-carrier protein] reductase
5end.1.A	12.50	homo-tetramer	HHblits	X-ray	2.55Å	0.29	0.09	3-oxoacyl-[acyl-carrier-protein] reductase FabG
4yqz.1.A	18.75	homo-tetramer	HHblits	X-ray	1.81Å	0.29	0.09	Putative oxidoreductase
4yqz.1.D	18.75	homo-tetramer	HHblits	X-ray	1.81Å	0.29	0.09	Putative oxidoreductase
1v59.1.A	19.35	homo-dimer	HHblits	X-ray	2.20Å	0.32	0.09	Dihydrolipoamide dehydrogenase
1jeh.1.A	19.35	homo-dimer	HHblits	X-ray	2.40Å	0.32	0.09	DIHYDROLIPOAMIDE DEHYDROGENASE
1jeh.1.B	19.35	homo-dimer	HHblits	X-ray	2.40Å	0.32	0.09	DIHYDROLIPOAMIDE DEHYDROGENASE
3gg2.1.A	32.26	homo-tetramer	HHblits	X-ray	1.70Å	0.32	0.09	Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family
2q7v.1.A	15.15	homo-dimer	HHblits	X-ray	1.90Å	0.27	0.09	Thioredoxin reductase
2q7v.1.B	15.15	homo-dimer	HHblits	X-ray	1.90Å	0.27	0.09	Thioredoxin reductase
2o2y.1.B	5.88	homo-tetramer	HHblits	X-ray	2.20Å	0.25	0.10	Enoyl-acyl carrier reductase
2o2y.1.A	5.88	homo-tetramer	HHblits	X-ray	2.20Å	0.25	0.10	Enoyl-acyl carrier reductase
3am3.1.A	5.88	homo-tetramer	HHblits	X-ray	2.50Å	0.25	0.10	Enoyl-ACP reductase
1zw1.1.A	5.88	homo-tetramer	HHblits	X-ray	2.90Å	0.25	0.10	enoyl-acyl carrier reductase
1zsn.1.B	5.88	homo-tetramer	HHblits	X-ray	2.99Å	0.25	0.10	enoyl-acyl carrier reductase
3am5.1.A	5.88	homo-tetramer	HHblits	X-ray	2.05Å	0.25	0.10	Enoyl-ACP reductase
1mo9.1.A	21.88	homo-dimer	HHblits	X-ray	1.65Å	0.29	0.09	orf3
1mok.1.A	21.88	homo-dimer	HHblits	X-ray	2.80Å	0.29	0.09	orf3
3wye.1.A	15.63	homo-tetramer	HHblits	X-ray	1.58Å	0.29	0.09	Diacetyl reductase [(S)-acetoin forming],L-2,3-butanediol dehydrogenase,Diacetyl reductase [(S)-acetoin forming],L-2,3-butanediol dehydrogenase,Diacetyl reductase [(S)-acetoin forming],L-2,3-butanediol dehydrogenase,Diacetyl reductase [(S)-acetoin forming]
3b1f.1.A	18.75	homo-dimer	HHblits	X-ray	2.10Å	0.29	0.09	Putative prephenate dehydrogenase
3ijp.1.A	19.35	homo-tetramer	HHblits	X-ray	2.30Å	0.32	0.09	Dihydrodipicolinate reductase
3ijp.1.B	19.35	homo-tetramer	HHblits	X-ray	2.30Å	0.32	0.09	Dihydrodipicolinate reductase
1o5w.1.A	22.58	homo-dimer	HHblits	X-ray	3.20Å	0.32	0.09	Amine oxidase [flavin-containing] A
1o5w.1.B	22.58	homo-dimer	HHblits	X-ray	3.20Å	0.32	0.09	Amine oxidase [flavin-containing] A
3qj4.1.A	12.12	monomer	HHblits	X-ray	2.50Å	0.27	0.09	Renalase
3qj4.2.A	12.12	monomer	HHblits	X-ray	2.50Å	0.27	0.09	Renalase
2o2s.1.A	11.76	homo-tetramer	HHblits	X-ray	2.60Å	0.24	0.10	Enoyl-acyl carrier reductase
3ppi.1.A	15.63	homo-tetramer	HHblits	X-ray	2.00Å	0.29	0.09	3-hydroxyacyl-CoA dehydrogenase type-2
3qfa.1.A	26.67	hetero-oligomer	HHblits	X-ray	2.20Å	0.34	0.08	Thioredoxin reductase 1, cytoplasmic
3ktd.1.A	15.63	homo-dimer	HHblits	X-ray	2.60Å	0.29	0.09	Prephenate dehydrogenase
3c85.1.A	18.75	homo-dimer	HHblits	X-ray	1.90Å	0.29	0.09	Putative glutathione-regulated potassium-efflux system protein KefB
3c85.1.B	18.75	homo-dimer	HHblits	X-ray	1.90Å	0.29	0.09	Putative glutathione-regulated potassium-efflux system protein KefB
3c85.2.A	18.75	homo-dimer	HHblits	X-ray	1.90Å	0.29	0.09	Putative glutathione-regulated potassium-efflux system protein KefB
3c85.2.B	18.75	homo-dimer	HHblits	X-ray	1.90Å	0.29	0.09	Putative glutathione-regulated potassium-efflux system protein KefB
3qiv.1.A	15.63	homo-tetramer	HHblits	X-ray	2.25Å	0.29	0.09	short-chain dehydrogenase or 3-oxoacyl-[acyl-carrier-protein] reductase
2rab.1.A	30.00	homo-dimer	HHblits	X-ray	2.50Å	0.34	0.08	glutathione amide reductase
3vpb.1.A	2.86	hetero-oligomer	HHblits	X-ray	1.80Å	0.22	0.10	Putative acetylornithine deacetylase
3vpc.1.A	2.86	homo-tetramer	HHblits	X-ray	1.87Å	0.22	0.10	Putative acetylornithine deacetylase
3vpc.1.B	2.86	homo-tetramer	HHblits	X-ray	1.87Å	0.22	0.10	Putative acetylornithine deacetylase
1lvl.1.A	22.58	homo-dimer	HHblits	X-ray	2.45Å	0.31	0.09	DIHYDROLIPOAMIDE DEHYDROGENASE
5mh4.1.A	12.50	homo-dimer	HHblits	X-ray	2.14Å	0.29	0.09	Thioredoxin reductase
5mjk.1.A	12.50	homo-dimer	HHblits	X-ray	2.00Å	0.29	0.09	Thioredoxin reductase
2c1x.1.A	18.75	monomer	HHblits	X-ray	1.90Å	0.29	0.09	UDP-GLUCOSE FLAVONOID 3-O GLYCOSYLTRANSFERASE
4jna.1.A	21.88	monomer	HHblits	X-ray	2.00Å	0.29	0.09	DepH
4jn9.1.A	21.88	homo-dimer	HHblits	X-ray	1.90Å	0.29	0.09	DepH
4jn9.1.B	21.88	homo-dimer	HHblits	X-ray	1.90Å	0.29	0.09	DepH
2ahr.1.A	26.67	homo-10-mer	HHblits	X-ray	2.15Å	0.34	0.08	putative pyrroline carboxylate reductase
1ep2.1.B	25.81	hetero-oligomer	HHblits	X-ray	2.40Å	0.31	0.09	DIHYDROOROTATE DEHYDROGENASE B (PYRK SUBUNIT)
3pgx.1.A	12.50	homo-tetramer	HHblits	X-ray	1.85Å	0.28	0.09	carveol dehydrogenase
3l4b.1.A	26.67	hetero-oligomer	HHblits	X-ray	3.45Å	0.33	0.08	TrkA K+ Channel protien TM1088A
3osu.1.A	19.35	homo-tetramer	HHblits	X-ray	1.90Å	0.31	0.09	3-oxoacyl-[acyl-carrier-protein] reductase
5t5q.1.A	12.90	homo-tetramer	HHblits	X-ray	1.95Å	0.31	0.09	Short-chain dehydrogenase/reductase SDR:Glucose/ribitol dehydrogenase
5lnk.1.R	15.15	hetero-oligomer	HHblits	EM	3.90Å	0.26	0.09	Mitochondrial complex I, 39 kDa subunit
2a9f.1.A	12.12	homo-dimer	HHblits	X-ray	2.50Å	0.26	0.09	putative malic enzyme ((S)-malate:NAD+ oxidoreductase (decarboxylating))
2a9f.1.B	12.12	homo-dimer	HHblits	X-ray	2.50Å	0.26	0.09	putative malic enzyme ((S)-malate:NAD+ oxidoreductase (decarboxylating))
2zbw.1.A	15.63	homo-dimer	HHblits	X-ray	2.10Å	0.28	0.09	Thioredoxin reductase
2zbw.1.B	15.63	homo-dimer	HHblits	X-ray	2.10Å	0.28	0.09	Thioredoxin reductase
4ntc.1.A	15.63	homo-dimer	HHblits	X-ray	1.90Å	0.28	0.09	GliT
5lcx.1.A	12.50	monomer	HHblits	X-ray	1.71Å	0.28	0.09	(-)-isopiperitenone reductase
3f9i.1.A	19.35	homo-tetramer	HHblits	X-ray	2.25Å	0.31	0.09	3-oxoacyl-[acyl-carrier-protein] reductase
2foi.1.A	12.50	hetero-oligomer	HHblits	X-ray	2.50Å	0.28	0.09	enoyl-acyl carrier reductase
5uth.1.A	15.63	homo-dimer	HHblits	X-ray	1.95Å	0.28	0.09	Thioredoxin reductase
1id1.1.A	15.63	homo-dimer	HHblits	X-ray	2.40Å	0.28	0.09	PUTATIVE POTASSIUM CHANNEL PROTEIN
4j34.1.A	26.67	monomer	HHblits	X-ray	2.03Å	0.33	0.08	Kynurenine 3-monooxygenase
4j34.2.A	26.67	monomer	HHblits	X-ray	2.03Å	0.33	0.08	Kynurenine 3-monooxygenase
4j33.1.A	26.67	monomer	HHblits	X-ray	1.82Å	0.33	0.08	Kynurenine 3-monooxygenase
4j33.2.A	26.67	monomer	HHblits	X-ray	1.82Å	0.33	0.08	Kynurenine 3-monooxygenase
4j36.1.A	26.67	monomer	HHblits	X-ray	2.13Å	0.33	0.08	Kynurenine 3-monooxygenase
4j36.2.A	26.67	monomer	HHblits	X-ray	2.13Å	0.33	0.08	Kynurenine 3-monooxygenase
1v35.1.A	9.09	homo-tetramer	HHblits	X-ray	2.50Å	0.25	0.09	enoyl-ACP reductase
5gup.12.A	12.12	monomer	HHblits	EM	NA	0.25	0.09	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial
3ii4.1.A	19.35	homo-dimer	HHblits	X-ray	2.42Å	0.30	0.09	Dihydrolipoyl dehydrogenase
4m52.1.B	19.35	homo-dimer	HHblits	X-ray	2.40Å	0.30	0.09	Dihydrolipoyl dehydrogenase
6aon.1.A	22.58	homo-dimer	HHblits	X-ray	1.72Å	0.30	0.09	Dihydrolipoyl dehydrogenase
1jax.1.A	23.33	homo-dimer	HHblits	X-ray	1.80Å	0.33	0.08	conserved hypothetical protein
1jay.1.A	23.33	homo-dimer	HHblits	X-ray	1.65Å	0.33	0.08	Coenzyme F420H2:NADP+ Oxidoreductase (FNO)
3f8p.1.A	15.63	homo-dimer	HHblits	X-ray	1.80Å	0.28	0.09	Thioredoxin reductase (TrxB-3)
3f8r.1.B	15.63	homo-dimer	HHblits	X-ray	1.95Å	0.28	0.09	Thioredoxin reductase (TrxB-3)
2pq6.1.A	15.63	monomer	HHblits	X-ray	2.10Å	0.28	0.09	UDP-glucuronosyl/UDP-glucosyltransferase
1ng3.1.A	16.13	homo-tetramer	HHblits	X-ray	2.60Å	0.30	0.09	Glycine oxidase
4wjz.1.A	12.90	homo-tetramer	HHblits	X-ray	2.40Å	0.30	0.09	3-oxoacyl-[acyl-carrier-protein] reductase FabG
4wjz.1.B	12.90	homo-tetramer	HHblits	X-ray	2.40Å	0.30	0.09	3-oxoacyl-[acyl-carrier-protein] reductase FabG
4wk6.1.A	12.90	homo-tetramer	HHblits	X-ray	2.21Å	0.30	0.09	3-oxoacyl-[acyl-carrier protein] reductase
4wk6.1.B	12.90	homo-tetramer	HHblits	X-ray	2.21Å	0.30	0.09	3-oxoacyl-[acyl-carrier protein] reductase
5vj7.1.B	18.75	hetero-oligomer	HHblits	X-ray	2.55Å	0.27	0.09	Ferredoxin-NADP(+) reductase subunit alpha
3urh.1.A	19.35	homo-dimer	HHblits	X-ray	1.90Å	0.30	0.09	Dihydrolipoyl dehydrogenase
4i08.1.A	12.90	homo-tetramer	HHblits	X-ray	2.06Å	0.30	0.09	3-oxoacyl-[acyl-carrier-protein] reductase FabG
3g0o.1.A	15.63	homo-dimer	HHblits	X-ray	1.80Å	0.27	0.09	3-hydroxyisobutyrate dehydrogenase
2myu.1.A	15.63	monomer	HHblits	NMR	NA	0.27	0.09	Glutaredoxin arsenate reductase
2ptg.1.A	12.12	homo-dimer	HHblits	X-ray	2.60Å	0.25	0.09	Enoyl-acyl carrier reductase
2eix.1.A	16.13	homo-dimer	HHblits	X-ray	1.56Å	0.29	0.09	NADH-cytochrome b5 reductase
2f1k.1.B	23.33	homo-dimer	HHblits	X-ray	1.55Å	0.32	0.08	prephenate dehydrogenase
2f1k.1.A	23.33	homo-dimer	HHblits	X-ray	1.55Å	0.32	0.08	prephenate dehydrogenase
2f1k.2.A	23.33	homo-dimer	HHblits	X-ray	1.55Å	0.32	0.08	prephenate dehydrogenase
3ic9.1.A	26.67	homo-dimer	HHblits	X-ray	2.15Å	0.32	0.08	dihydrolipoamide dehydrogenase
3ic9.1.B	26.67	homo-dimer	HHblits	X-ray	2.15Å	0.32	0.08	dihydrolipoamide dehydrogenase
3ic9.2.B	26.67	homo-dimer	HHblits	X-ray	2.15Å	0.32	0.08	dihydrolipoamide dehydrogenase
4nbw.1.A	16.13	homo-tetramer	HHblits	X-ray	2.00Å	0.29	0.09	Short-chain dehydrogenase/reductase SDR
4nbw.1.B	16.13	homo-tetramer	HHblits	X-ray	2.00Å	0.29	0.09	Short-chain dehydrogenase/reductase SDR
3fwz.1.A	22.58	homo-dimer	HHblits	X-ray	1.79Å	0.29	0.09	Inner membrane protein ybaL
2vhe.1.A	26.67	homo-trimer	HHblits	X-ray	1.80Å	0.32	0.08	ACETYLTRANSFERASE
3bfp.1.A	26.67	homo-trimer	HHblits	X-ray	1.75Å	0.32	0.08	Acetyltransferase
2l19.1.A	15.63	monomer	HHblits	NMR	NA	0.26	0.09	Arsenate reductase
2myt.1.A	15.63	monomer	HHblits	NMR	NA	0.26	0.09	Glutaredoxin arsenate reductase
3tsc.1.A	9.68	homo-tetramer	HHblits	X-ray	2.05Å	0.29	0.09	Putative oxidoreductase
1cl0.1.A	20.00	homo-dimer	HHblits	X-ray	2.50Å	0.31	0.08	THIOREDOXIN REDUCTASE
1weh.1.A	16.13	monomer	HHblits	X-ray	1.80Å	0.29	0.09	Conserved hypothetical protein TT1887
1tdf.1.A	20.00	homo-dimer	HHblits	X-ray	2.30Å	0.31	0.08	THIOREDOXIN REDUCTASE
1f6m.1.A	20.00	hetero-oligomer	HHblits	X-ray	2.95Å	0.31	0.08	THIOREDOXIN REDUCTASE
2l18.1.A	15.63	monomer	HHblits	NMR	NA	0.26	0.09	Arsenate reductase
2l17.1.A	15.63	monomer	HHblits	NMR	NA	0.26	0.09	Arsenate reductase
2myn.1.A	15.63	monomer	HHblits	NMR	NA	0.26	0.09	Glutaredoxin arsenate reductase
2myp.1.A	15.63	monomer	HHblits	NMR	NA	0.26	0.09	Glutaredoxin arsenate reductase
4iiu.1.A	9.68	homo-tetramer	HHblits	X-ray	2.10Å	0.28	0.09	3-oxoacyl-[acyl-carrier protein] reductase
5usx.1.A	20.00	homo-dimer	HHblits	X-ray	2.60Å	0.31	0.08	Thioredoxin reductase
5usx.1.B	20.00	homo-dimer	HHblits	X-ray	2.60Å	0.31	0.08	Thioredoxin reductase
5utx.1.A	20.00	homo-dimer	HHblits	X-ray	2.46Å	0.31	0.08	Thioredoxin reductase
5utx.1.B	20.00	homo-dimer	HHblits	X-ray	2.46Å	0.31	0.08	Thioredoxin reductase
5vt3.1.A	20.00	homo-dimer	HHblits	X-ray	1.98Å	0.31	0.08	Thioredoxin reductase
1trb.1.A	20.00	homo-dimer	HHblits	X-ray	2.00Å	0.31	0.08	THIOREDOXIN REDUCTASE
3f4b.1.A	9.38	homo-tetramer	HHblits	X-ray	2.49Å	0.25	0.09	Enoyl-acyl carrier protein reductase
5u63.1.A	16.67	homo-dimer	HHblits	X-ray	1.99Å	0.30	0.08	Thioredoxin reductase
3f8d.1.A	16.13	homo-dimer	HHblits	X-ray	1.40Å	0.28	0.09	Thioredoxin reductase (TrxB-3)
1zo8.1.A	12.50	homo-tetramer	HHblits	X-ray	1.90Å	0.25	0.09	halohydrin dehalogenase
5bva.1.A	23.33	monomer	HHblits	X-ray	1.87Å	0.30	0.08	flavin-dependent halogenase
5bul.1.A	23.33	monomer	HHblits	X-ray	1.98Å	0.30	0.08	flavin-dependent halogenase triple mutant
4ixt.1.A	12.50	homo-tetramer	HHblits	X-ray	2.49Å	0.25	0.09	Halohydrin dehalogenase
3zhb.1.A	20.00	homo-dimer	HHblits	X-ray	2.73Å	0.30	0.08	R-IMINE REDUCTASE
3zn2.1.A	12.50	homo-tetramer	HHblits	X-ray	1.80Å	0.25	0.09	HALOHYDRIN DEHALOGENASE
4jnq.1.A	16.67	homo-dimer	HHblits	X-ray	1.80Å	0.30	0.08	Thioredoxin reductase
2a8x.1.A	16.67	homo-dimer	HHblits	X-ray	2.40Å	0.29	0.08	Dihydrolipoyl dehydrogenase
3l8k.1.A	20.00	homo-tetramer	HHblits	X-ray	2.50Å	0.29	0.08	Dihydrolipoyl dehydrogenase
1d7o.1.A	16.67	homo-tetramer	HHblits	X-ray	1.90Å	0.29	0.08	ENOYL-[ACYL-CARRIER PROTEIN] REDUCTASE (NADH) PRECURSOR
1cwu.1.A	16.67	homo-tetramer	HHblits	X-ray	2.50Å	0.29	0.08	ENOYL ACP REDUCTASE
4dna.1.A	23.33	homo-dimer	HHblits	X-ray	2.80Å	0.29	0.08	Probable glutathione reductase
4dna.1.B	23.33	homo-dimer	HHblits	X-ray	2.80Å	0.29	0.08	Probable glutathione reductase
1w93.1.A	21.43	monomer	HHblits	X-ray	2.50Å	0.32	0.08	ACETYL-COENZYME A CARBOXYLASE
3ia7.1.A	13.79	homo-dimer	HHblits	X-ray	1.91Å	0.29	0.08	CalG4
3ia7.1.B	13.79	homo-dimer	HHblits	X-ray	1.91Å	0.29	0.08	CalG4
4fk1.1.A	13.33	homo-dimer	HHblits	X-ray	2.40Å	0.26	0.08	Putative thioredoxin reductase
3oti.1.A	21.43	monomer	HHblits	X-ray	1.60Å	0.30	0.08	CalG3
3d0r.1.B	21.43	homo-dimer	HHblits	X-ray	1.90Å	0.30	0.08	Protein CalG3
3d0r.1.A	21.43	homo-dimer	HHblits	X-ray	1.90Å	0.30	0.08	Protein CalG3
3d0q.1.A	21.43	homo-dimer	HHblits	X-ray	2.79Å	0.30	0.08	Protein CalG3
3wc4.1.A	21.43	monomer	HHblits	X-ray	1.85Å	0.30	0.08	UDP-glucose:anthocyanidin 3-O-glucosyltransferase
3hbf.1.A	17.86	monomer	HHblits	X-ray	2.10Å	0.30	0.08	Flavonoid 3-O-glucosyltransferase
3hbj.1.A	17.86	monomer	HHblits	X-ray	2.10Å	0.30	0.08	Flavonoid 3-O-glucosyltransferase
5du2.1.A	25.93	monomer	HHblits	X-ray	2.70Å	0.32	0.08	EspG2 glycosyltransferase
5du2.2.A	25.93	monomer	HHblits	X-ray	2.70Å	0.32	0.08	EspG2 glycosyltransferase
1w96.1.A	22.22	monomer	HHblits	X-ray	1.80Å	0.32	0.08	ACETYL-COENZYME A CARBOXYLASE
1pnv.1.A	14.29	homo-dimer	HHblits	X-ray	2.80Å	0.27	0.08	GLYCOSYLTRANSFERASE GTFA
1pnv.1.B	14.29	homo-dimer	HHblits	X-ray	2.80Å	0.27	0.08	GLYCOSYLTRANSFERASE GTFA
3wad.1.A	18.52	homo-dimer	HHblits	X-ray	2.00Å	0.28	0.08	Glycosyltransferase
3hbm.1.A	14.29	monomer	HHblits	X-ray	1.80Å	0.22	0.08	UDP-sugar hydrolase
3hbn.1.A	14.29	monomer	HHblits	X-ray	1.85Å	0.22	0.08	UDP-sugar hydrolase
3opy.1.A	24.00	hetero-oligomer	HHblits	X-ray	3.05Å	0.29	0.07	6-phosphofructo-1-kinase alpha-subunit
3o8o.1.A	29.17	hetero-oligomer	HHblits	X-ray	2.90Å	0.31	0.07	6-phosphofructokinase subunit alpha
2r6h.1.A	17.39	monomer	HHblits	X-ray	2.95Å	0.29	0.06	NADH:ubiquinone oxidoreductase, Na translocating, F subunit
3llq.1.A	30.00	homo-tetramer	HHblits	X-ray	2.01Å	0.33	0.06	Aquaporin Z 2
1fx8.1.A	9.52	homo-tetramer	HHblits	X-ray	2.20Å	0.27	0.06	GLYCEROL UPTAKE FACILITATOR PROTEIN
5dye.1.B	20.00	homo-tetramer	HHblits	X-ray	3.50Å	0.30	0.06	Aquaporin-5
5dye.1.A	20.00	homo-tetramer	HHblits	X-ray	3.50Å	0.30	0.06	Aquaporin-5
5c5x.1.A	20.00	homo-tetramer	HHblits	X-ray	2.60Å	0.30	0.06	Aquaporin-5
3d9s.1.B	20.00	homo-tetramer	HHblits	X-ray	2.00Å	0.30	0.06	Aquaporin-5
3d9s.1.A	20.00	homo-tetramer	HHblits	X-ray	2.00Å	0.30	0.06	Aquaporin-5
3d9s.1.D	20.00	homo-tetramer	HHblits	X-ray	2.00Å	0.30	0.06	Aquaporin-5
2zz9.1.A	15.00	homo-tetramer	HHblits	2DX	2.80Å	0.30	0.06	Aquaporin-4
2d57.1.A	15.00	homo-tetramer	HHblits	2DX	3.20Å	0.30	0.06	Aquaporin-4
3gd8.1.A	15.00	homo-tetramer	HHblits	X-ray	1.80Å	0.30	0.06	Aquaporin-4
3ne2.1.A	10.00	homo-tetramer	HHblits	X-ray	3.00Å	0.29	0.06	Probable aquaporin AqpM
3c02.1.A	10.00	homo-tetramer	HHblits	X-ray	2.05Å	0.29	0.06	Aquaglyceroporin
1ldf.1.A	10.00	homo-tetramer	HHblits	X-ray	2.10Å	0.28	0.06	Glycerol uptake facilitator protein
3cn5.1.A	15.00	homo-tetramer	HHblits	X-ray	2.05Å	0.28	0.06	Aquaporin
3cll.1.A	15.00	homo-tetramer	HHblits	X-ray	2.30Å	0.28	0.06	Aquaporin
3cn6.1.A	15.00	homo-tetramer	HHblits	X-ray	2.95Å	0.28	0.06	Aquaporin
1z98.1.A	15.00	homo-tetramer	HHblits	X-ray	2.10Å	0.28	0.06	aquaporin
4ia4.1.C	15.00	homo-tetramer	HHblits	X-ray	3.10Å	0.28	0.06	Aquaporin
4jc6.2.D	15.00	homo-tetramer	HHblits	X-ray	2.15Å	0.28	0.06	Aquaporin
2b5f.1.A	15.00	homo-tetramer	HHblits	X-ray	3.90Å	0.28	0.06	aquaporin
2b5f.1.C	15.00	homo-tetramer	HHblits	X-ray	3.90Å	0.28	0.06	aquaporin
3nk5.1.A	20.00	homo-tetramer	HHblits	X-ray	2.40Å	0.28	0.06	Aquaporin Z
2o9e.1.A	20.00	homo-tetramer	HHblits	X-ray	2.20Å	0.28	0.06	Aquaporin Z
3nkc.1.A	20.00	homo-tetramer	HHblits	X-ray	3.10Å	0.28	0.06	Aquaporin Z
3nka.1.A	20.00	homo-tetramer	HHblits	X-ray	2.50Å	0.28	0.06	Aquaporin Z
2o9g.1.A	20.00	homo-tetramer	HHblits	X-ray	1.90Å	0.28	0.06	Aquaporin Z
2o9d.1.A	20.00	homo-tetramer	HHblits	X-ray	2.30Å	0.28	0.06	Aquaporin Z
1rc2.2.A	20.00	monomer	HHblits	X-ray	2.50Å	0.28	0.06	Aquaporin Z
1rc2.1.A	20.00	homo-tetramer	HHblits	X-ray	2.50Å	0.28	0.06	Aquaporin Z
3m9i.1.A	20.00	homo-octamer	HHblits	2DX	2.50Å	0.28	0.06	Lens fiber major intrinsic protein
1sor.1.A	20.00	homo-octamer	HHblits	2DX	3.00Å	0.28	0.06	Aquaporin-0
2b6o.1.A	20.00	homo-octamer	HHblits	2DX	1.90Å	0.28	0.06	Lens fiber major intrinsic protein
1ymg.1.A	20.00	homo-tetramer	HHblits	X-ray	2.24Å	0.28	0.06	Lens fiber major intrinsic protein
3j41.1.C	20.00	hetero-oligomer	HHblits	EM	NA	0.28	0.06	Lens fiber major intrinsic protein
3j41.1.B	20.00	hetero-oligomer	HHblits	EM	NA	0.28	0.06	Lens fiber major intrinsic protein
2f2b.1.A	10.00	homo-tetramer	HHblits	X-ray	1.68Å	0.27	0.06	Aquaporin aqpM
5i32.1.A	15.00	homo-tetramer	HHblits	X-ray	1.18Å	0.27	0.06	Aquaporin TIP2-1
4oj2.1.A	10.00	homo-tetramer	HHblits	X-ray	3.05Å	0.26	0.06	Aquaporin-2
4nef.1.A	10.00	homo-tetramer	HHblits	X-ray	2.75Å	0.26	0.06	Aquaporin-2
4nef.1.B	10.00	homo-tetramer	HHblits	X-ray	2.75Å	0.26	0.06	Aquaporin-2
4nef.1.C	10.00	homo-tetramer	HHblits	X-ray	2.75Å	0.26	0.06	Aquaporin-2
4nef.1.D	10.00	homo-tetramer	HHblits	X-ray	2.75Å	0.26	0.06	Aquaporin-2
1fqy.1.A	15.00	homo-tetramer	HHblits	2DX	3.80Å	0.26	0.06	AQUAPORIN-1
1ih5.1.A	15.00	homo-tetramer	HHblits	2DX	3.70Å	0.26	0.06	AQUAPORIN-1
1h6i.1.A	15.00	monomer	HHblits	2DX	3.54Å	0.26	0.06	AQUAPORIN-1
1j4n.1.A	15.00	homo-tetramer	HHblits	X-ray	2.20Å	0.26	0.06	AQUAPORIN 1
4csk.1.A	15.00	homo-tetramer	HHblits	X-ray	3.28Å	0.26	0.06	AQUAPORIN-1
2w2e.1.A	10.00	homo-tetramer	HHblits	X-ray	1.15Å	0.24	0.06	AQUAPORIN PIP2-7 7
1mej.1.A	23.53	monomer	HHblits	X-ray	2.00Å	0.30	0.05	Phosphoribosylglycinamide formyltransferase
1men.3.A	23.53	monomer	HHblits	X-ray	2.23Å	0.30	0.05	Phosphoribosylglycinamide formyltransferase