SWISS-MODEL | Workspace | Model Results

SWISS-MODEL Homology Modelling Report

Model Building Report

This document lists the results for the homology modelling project "Q59650-MurE-P-aeruginosa" submitted to SWISS-MODEL workspace on Oct. 17, 2017, 6:24 p.m..The submitted primary amino acid sequence is given in Table T1.

If you use any results in your research, please cite the relevant publications:

Marco Biasini; Stefan Bienert; Andrew Waterhouse; Konstantin Arnold; Gabriel Studer; Tobias Schmidt; Florian Kiefer; Tiziano Gallo Cassarino; Martino Bertoni; Lorenza Bordoli; Torsten Schwede. (2014). SWISS-MODEL: modelling protein tertiary and quaternary structure using evolutionary information. Nucleic Acids Research (1 July 2014) 42 (W1): W252-W258; doi: 10.1093/nar/gku340.
Arnold, K., Bordoli, L., Kopp, J. and Schwede, T. (2006) The SWISS-MODEL workspace: a web-based environment for protein structure homology modelling. Bioinformatics, 22, 195-201.
Benkert, P., Biasini, M. and Schwede, T. (2011) Toward the estimation of the absolute quality of individual protein structure models. Bioinformatics, 27, 343-350

Results

The SWISS-MODEL template library (SMTL version 2017-10-11, PDB release 2017-10-06) was searched with Blast (Altschul et al., 1997) and HHBlits (Remmert, et al., 2011) for evolutionary related structures matching the target sequence in Table T1. For details on the template search, see Materials and Methods. Overall 632 templates were found (Table T2).

Models

The following models were built (see Materials and Methods "Model Building"):

Model #01	File	Built with	Oligo-State	Ligands	GMQE	QMEAN
	PDB	ProMod3 Version 1.0.2.	MONOMER	1 x API: 2,6-DIAMINOPIMELIC ACID;	0.76	-1.88

QMEAN	-1.88
Cβ	0.04
All Atom	-0.13
Solvation	0.19
Torsion	-1.91

Template	Seq Identity	Oligo-state	Found by	Method	Resolution	Seq Similarity	Range	Coverage	Description
1e8c.1.A	48.75	monomer	HHblits	X-ray	2.00Å	0.41	3 - 483	0.99	UDP-N-ACETYLMURAMOYLALANYL-D-GLUTAMATE--2,6-DIAMINOPIMELATE LIGASE

Ligand	Added to Model	Description
API	✓	2,6-DIAMINOPIMELIC ACID
CL	✕ - Not biologically relevant.	CHLORIDE ION
UAG	✕ - Binding site not conserved.	URIDINE-5'-DIPHOSPHATE-N-ACETYLMURAMOYL-L-ALANINE-D-GLUTAMATE

Target    MPMSLNQLFPQAE---RDLLIRELTLDSRGVRPGDLFLAVPGGRQDGRAHIADALAKGAAAVAYEAEGAG---ELPP-SD
1e8c.1.A  -DRNLRDLLAPWVPDAPSRALREMTLDSRVAAAGDLFVAVVGHQADGRRYIPQAIAQGVAAIIAEAKDEATDGEIREMHG

Target    APLIAVKGLAAQLSAVAGRFYGEPSRGLDLIGVTGTNGKTSVSQLVAQALDLLGERCGIVGTLGTGFYGALESGRHTTPD
1e8c.1.A  VPVIYLSQLNERLSALAGRFYHEPSDNLRLVGVTGTNGKTTTTQLLAQWSQLLGEISAVMGTVGNGLLGKVIPTENTTGS

Target    PLAVQATLATLKQAGARAVAMEVSSHGLDQGRVAALGFDIAVFTNLSRDHLDYHGSMEAYAAAKAKLFAWPGLRCRVINL
1e8c.1.A  AVDVQHELAGLVDQGATFCAMEVSSHGLVQHRVAALKFAASVFTNLSRDHLDYHGDMEHYEAAKWLLYSEHHCGQAIINA

Target    DDDFGRRLAGEEQDSELITYSLTDSS------AFLYCREARFGDAGIEAALVTPHGEGLLRSPLLGRFNLSNLLAAVGAL
1e8c.1.A  DDEVGRRWLAKLPD-A-VAVSMEDHINPNCHGRWLKATEVNYHDSGATIRFSSSWGDGEIESHLMGAFNVSNLLLALATL

Target    LGLGYPLGDILRTLPQLQGPVGRMQRLGGGDKPLVVVDYAHTPDALEKVLEALRPHAAARLLCLFGCGGDRDAGKRPLMA
1e8c.1.A  LALGYPLADLLKTAARLQPVCGRMEVFTAPGKPTVVVDYAHTPDALEKALQAARLHCAGKLWCVFGCGGDRDKGKRPLMG

Target    AIAERLADEVLVTDDNPRTEASAAIIADIRKGFAAADKVTFLPSRGEAIAHLIASAAVDDVVLLAGKGHEDYQEIDGVRH
1e8c.1.A  AIAEEFADVAVVTDDNPRTEEPRAIINDILAGMLDAGHAKVMEGRAEAVTCAVMQAKENDVVLVAGKGHEDYQIVGNQRL

Target    PFSDIEQAERALAAWEVPHA
1e8c.1.A  DYSDRVTVARLLGVIA----

Model #02	File	Built with	Oligo-State	Ligands	GMQE	QMEAN
	PDB	ProMod3 Version 1.0.2.	MONOMER	None	0.47	-5.63

QMEAN	-5.63
Cβ	-3.60
All Atom	-3.10
Solvation	-2.02
Torsion	-4.66

Template	Seq Identity	Oligo-state	Found by	Method	Resolution	Seq Similarity	Range	Coverage	Description
1eeh.1.A	19.00	monomer	HHblits	X-ray	1.90Å	0.29	20 - 459	0.78	UDP-N-ACETYLMURAMOYL-L-ALANINE:D-GLUTAMATE LIGASE

Ligand	Added to Model	Description
UMA	✕ - Binding site not conserved.	URIDINE-5'-DIPHOSPHATE-N-ACETYLMURAMOYL-L-ALANINE

Target    MPMSLNQLFPQAERDLLIRELTLDSRGVRPGDLFLAVPGGR--QDGRAHIADALAKGAAAVAYEAEGAGELPPSDAPLIA
1eeh.1.A  -------------------PRVMDTRMTPPGLDKLP-EAVERHTGSLN---DEWLMAADLIVASPGI----A-LAHPSLS

Target    VKG--LAAQLSAVAGRFYGEPSRGLDLIGVTGTNGKTSVSQLVAQALDLLGERCGIVGTLGTGFYGALESGRHTTPDPLA
1eeh.1.A  AAADAGIEIVGDIELFCRE---AQAPIVAITGSNGKSTVTTLVGEMAKAAGVNVGVGGNIGLPAL---------------

Target    VQATLATLKQAGARAVAMEVSSHGLDQGRVAALGFDIAVFTNLSRDHLDYHG-SMEAYAAAKAKLFAWPGLRCRVINLDD
1eeh.1.A  ------MLLDDECELYVLELSSFQLE--TTSSLQAVAATILNVTEDHMDRYPFGLQQYRAAKLRIYEN--AKVCVVNADD

Target    DFGRRLAGEEQDSELITYSLTDSSAFLYCREARFGDAGIEAALVTPHGE--GLLRSPLLGRFNLSNLLAAVGALLGLGYP
1eeh.1.A  ALTMPIRG-ADE-RCVSFGVNM--GDYHLNHQQGE--TW-LRV--KGEKVLNVKEMKLSGQHNYTNALAALALADAAGLP

Target    LGDILRTLPQLQGPVGRMQRLGGGDKPLVVVDY-AHTPDALEKVLEALRPHAAARLLCLFGCGGDRDAGKRPLMAAIAER
1eeh.1.A  RASSLKALTTFTGLPHRFEVVLEHNGVRWINDSKATNVGSTEAALNGLH-V-DGTLHLLLGGD-GKSADFSPLARYL-NG

Target    LADEVLVTDDNPRTEASAAIIADIRKGFAAADKVTFLPSRGEAIAHLIASAAVDDVVLLAGKGHEDYQEIDGVRHPFSDI
1eeh.1.A  DNVRLYCFGRD-----GAQLAALRPE------VAEQTETMEQAMRLLAPRVQPGDMVLLSPACASLD-------------

Target    EQAERALAAWEVPHA
1eeh.1.A  ---------------

Model #03	File	Built with	Oligo-State	Ligands	GMQE	QMEAN
	PDB	ProMod3 Version 1.0.2.	MONOMER (matching prediction)	None	0.08	-3.56

QMEAN	-3.56
Cβ	-1.44
All Atom	-1.14
Solvation	-1.59
Torsion	-2.90

Template	Seq Identity	Oligo-state	Found by	Method	Resolution	Seq Similarity	Range	Coverage	Description
1kzh.1.A	9.35	homo-dimer	HHblits	X-ray	2.55Å	0.25	86 - 198	0.22	phosphofructokinase

Ligand	Added to Model	Description
SO4	✕ - Not biologically relevant.	SULFATE ION
SO4	✕ - Not biologically relevant.	SULFATE ION
SO4	✕ - Not biologically relevant.	SULFATE ION
SO4	✕ - Not biologically relevant.	SULFATE ION
SO4	✕ - Not biologically relevant.	SULFATE ION
SO4	✕ - Not biologically relevant.	SULFATE ION
SO4	✕ - Not biologically relevant.	SULFATE ION
SO4	✕ - Not biologically relevant.	SULFATE ION

Target    MPMSLNQLFPQAERDLLIRELTLDSRGVRPGDLFLAVPGGRQDGRAHIADALAKGAAAVAYEAEGAGELPPSDAPLIAVK
1kzh.1.A  --------------------------------------------------------------------------------

Target    GLAAQLSAVAGRFYGEPSRGLDLIGVTGTNGKTSVSQLVAQALDLLGERCGIVGTL---GTGFYGALESGRHTTPDPLAV
1kzh.1.A  -----YNKALFVAKEN---NLNAIIIIGGDDSNTNAAILAEYFKKNGENIQVIGVPKTIDADLRNDHI---EISFGFDSA

Target    Q----ATLATL----KQAGARAVAMEV-SSHGLDQGRVAA--LGFDIAVFTNLSRDHLDYHGSMEAYAAAKAKLFAWPGL
1kzh.1.A  TKIYSELIGNLCRDAMSTKKYWHFVKLMGRSASHVALECALKTHPNICIVSE----------------------------

Target    RCRVINLDDDFGRRLAGEEQDSELITYSLTDSSAFLYCREARFGDAGIEAALVTPHGEGLLRSPLLGRFNLSNLLAAVGA
1kzh.1.A  --------------------------------------------------------------------------------

Target    LLGLGYPLGDILRTLPQLQGPVGRMQRLGGGDKPLVVVDYAHTPDALEKVLEALRPHAAARLLCLFGCGGDRDAGKRPLM
1kzh.1.A  --------------------------------------------------------------------------------

Target    AAIAERLADEVLVTDDNPRTEASAAIIADIRKGFAAADKVTFLPSRGEAIAHLIASAAVDDVVLLAGKGHEDYQEIDGVR
1kzh.1.A  --------------------------------------------------------------------------------

Target    HPFSDIEQAERALAAWEVPHA
1kzh.1.A  ---------------------

Materials and Methods

Template Search

Template search with Blast and HHBlits has been performed against the SWISS-MODEL template library (SMTL, last update: 2017-10-11, last included PDB release: 2017-10-06).

The target sequence was searched with BLAST (Altschul et al., 1997) against the primary amino acid sequence contained in the SMTL. A total of 7 templates were found.

An initial HHblits profile has been built using the procedure outlined in (Remmert, et al., 2011), followed by 1 iteration of HHblits against NR20. The obtained profile has then be searched against all profiles of the SMTL. A total of 627 templates were found.

Template Selection

For each identified template, the template's quality has been predicted from features of the target-template alignment. The templates with the highest quality have then been selected for model building.

Model Building

Models are built based on the target-template alignment using ProMod3. Coordinates which are conserved between the target and the template are copied from the template to the model. Insertions and deletions are remodelled using a fragment library. Side chains are then rebuilt. Finally, the geometry of the resulting model is regularized by using a force field. In case loop modelling with ProMod3 fails, an alternative model is built with PROMOD-II (Guex, et al., 1997).

Model Quality Estimation

The global and per-residue model quality has been assessed using the QMEAN scoring function (Benkert, et al., 2011) . For improved performance, weights of the individual QMEAN terms have been trained specifically for SWISS-MODEL.

Ligand Modelling

Ligands present in the template structure are transferred by homology to the model when the following criteria are met (Gallo -Casserino, to be published): (a) The ligands are annotated as biologically relevant in the template library, (b) the ligand is in contact with the model, (c) the ligand is not clashing with the protein, (d) the residues in contact with the ligand are conserved between the target and the template. If any of these four criteria is not satisfied, a certain ligand will not be included in the model. The model summary includes information on why and which ligand has not been included.

Oligomeric State Conservation

Homo-oligomeric structure of the target protein is predicted based on the analysis of pairwise interfaces of the identified template structures. For each relevant interface between polypeptide chains (interfaces with more than 10 residue-residue interactions), the QscoreOligomer (Mariani et al., 2011) is predicted from features such as similarity to target and frequency of observing this interface in the identified templates (Kiefer, Bertoni, Biasini, to be published). The prediction is performed with a random forest regressor using these features as input parameters to predict the probability of conservation for each interface. The QscoreOligomer of the whole complex is then calculated as the weight-averaged QscoreOligomer of the interfaces. The oligomeric state of the target is predicted to be the same as in the template when QscoreOligomer is predicted to be higher or equal to 0.5.

References

Altschul, S.F., Madden, T.L., Schaffer, A.A., Zhang, J., Zhang, Z., Miller, W. and Lipman, D.J. (1997) Gapped BLAST and PSI-BLAST: a new generation of protein database search programs. Nucleic Acids Res, 25, 3389-3402.
Remmert, M., Biegert, A., Hauser, A. and Soding, J. (2012) HHblits: lightning-fast iterative protein sequence searching by HMM-HMM alignment. Nat Methods, 9, 173-175.
Guex, N. and Peitsch, M.C. (1997) SWISS-MODEL and the Swiss-PdbViewer: an environment for comparative protein modeling. Electrophoresis, 18, 2714-2723.
Sali, A. and Blundell, T.L. (1993) Comparative protein modelling by satisfaction of spatial restraints. J Mol Biol, 234, 779-815.
Benkert, P., Biasini, M. and Schwede, T. (2011) Toward the estimation of the absolute quality of individual protein structure models. Bioinformatics, 27, 343-350.
Mariani, V., Kiefer, F., Schmidt, T., Haas, J. and Schwede, T. (2011) Assessment of template based protein structure predictions in CASP9. Proteins, 79 Suppl 10, 37-58.

Table T1:

Primary amino acid sequence for which templates were searched and models were built.

MPMSLNQLFPQAERDLLIRELTLDSRGVRPGDLFLAVPGGRQDGRAHIADALAKGAAAVAYEAEGAGELPPSDAPLIAVKGLAAQLSAVAGRFYGEPSRG
LDLIGVTGTNGKTSVSQLVAQALDLLGERCGIVGTLGTGFYGALESGRHTTPDPLAVQATLATLKQAGARAVAMEVSSHGLDQGRVAALGFDIAVFTNLS
RDHLDYHGSMEAYAAAKAKLFAWPGLRCRVINLDDDFGRRLAGEEQDSELITYSLTDSSAFLYCREARFGDAGIEAALVTPHGEGLLRSPLLGRFNLSNL
LAAVGALLGLGYPLGDILRTLPQLQGPVGRMQRLGGGDKPLVVVDYAHTPDALEKVLEALRPHAAARLLCLFGCGGDRDAGKRPLMAAIAERLADEVLVT
DDNPRTEASAAIIADIRKGFAAADKVTFLPSRGEAIAHLIASAAVDDVVLLAGKGHEDYQEIDGVRHPFSDIEQAERALAAWEVPHA

Table T2:

Template	Seq Identity	Oligo-state	Found by	Method	Resolution	Seq Similarity	Coverage	Description
1e8c.1.A	48.75	monomer	HHblits	X-ray	2.00Å	0.41	0.99	UDP-N-ACETYLMURAMOYLALANYL-D-GLUTAMATE--2,6-DIAMINOPIMELATE LIGASE
1e8c.1.A	50.22	monomer	BLAST	X-ray	2.00Å	0.42	0.93	UDP-N-ACETYLMURAMOYLALANYL-D-GLUTAMATE--2,6-DIAMINOPIMELATE LIGASE
2xja.1.A	39.62	monomer	HHblits	X-ray	3.00Å	0.37	0.98	UDP-N-ACETYLMURAMOYL-L-ALANYL-D-GLUTAMATE--2,6-DIAMINOPIMELATE LIGASE
2wtz.1.A	39.62	monomer	HHblits	X-ray	3.00Å	0.37	0.98	UDP-N-ACETYLMURAMOYL-L-ALANYL-D-GLUTAMATE--2,6-DIAMINOPIMELATE LIGASE
4c12.1.A	33.26	homo-dimer	HHblits	X-ray	1.80Å	0.36	0.97	UDP-N-ACETYLMURAMOYL-L-ALANYL-D-GLUTAMATE--L-LYSINE LIGASE
4bub.1.A	35.47	monomer	HHblits	X-ray	2.90Å	0.36	0.96	UDP-N-ACETYLMURAMOYL-L-ALANYL-D-GLUTAMATE--LD-LYSINE LIGASE
4bub.2.A	35.47	monomer	HHblits	X-ray	2.90Å	0.36	0.96	UDP-N-ACETYLMURAMOYL-L-ALANYL-D-GLUTAMATE--LD-LYSINE LIGASE
4bub.1.A	39.01	monomer	BLAST	X-ray	2.90Å	0.38	0.92	UDP-N-ACETYLMURAMOYL-L-ALANYL-D-GLUTAMATE--LD-LYSINE LIGASE
4bub.2.A	39.01	monomer	BLAST	X-ray	2.90Å	0.38	0.92	UDP-N-ACETYLMURAMOYL-L-ALANYL-D-GLUTAMATE--LD-LYSINE LIGASE
2xja.1.A	38.41	monomer	BLAST	X-ray	3.00Å	0.37	0.93	UDP-N-ACETYLMURAMOYL-L-ALANYL-D-GLUTAMATE--2,6-DIAMINOPIMELATE LIGASE
2wtz.1.A	38.41	monomer	BLAST	X-ray	3.00Å	0.37	0.93	UDP-N-ACETYLMURAMOYL-L-ALANYL-D-GLUTAMATE--2,6-DIAMINOPIMELATE LIGASE
4c12.1.A	34.23	homo-dimer	BLAST	X-ray	1.80Å	0.37	0.92	UDP-N-ACETYLMURAMOYL-L-ALANYL-D-GLUTAMATE--L-LYSINE LIGASE
4cvl.1.A	24.17	monomer	HHblits	X-ray	2.98Å	0.31	0.87	UDP-N-ACETYLMURAMOYL-TRIPEPTIDE--D-ALANYL-D-ALANINE LIGASE
4cvm.1.A	24.17	monomer	HHblits	X-ray	2.06Å	0.31	0.87	UDP-N-ACETYLMURAMOYL-TRIPEPTIDE--D-ALANYL-D- ALANINE LIGASE
4ziy.1.A	20.76	monomer	HHblits	X-ray	1.85Å	0.30	0.86	UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase
1gg4.1.A	22.43	monomer	HHblits	X-ray	2.30Å	0.30	0.86	UDP-N-ACETYLMURAMOYLALANYL-D-GLUTAMYL-2,6-DIAMINOPIMELATE-D-ALANYL-D-ALANYL LIGASE
4qf5.1.A	20.81	monomer	HHblits	X-ray	2.80Å	0.30	0.86	UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase
4qdi.1.A	20.81	monomer	HHblits	X-ray	1.80Å	0.30	0.86	UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase
2am2.1.A	18.14	monomer	HHblits	X-ray	2.80Å	0.29	0.86	UDP-N-acetylmuramoylalanine-D-glutamyl-lysine-D-alanyl-D-alanine ligase, MurF protein
3zm5.1.A	18.27	monomer	HHblits	X-ray	2.94Å	0.29	0.85	UDP-N-ACETYLMURAMOYL-TRIPEPTIDE--D-ALANYL-D-ALANINE LIGASE
3zl8.1.A	21.25	monomer	HHblits	X-ray	1.65Å	0.30	0.82	UDP-N-ACETYLMURAMOYL-TRIPEPTIDE--D-ALANYL-D-ALANINE LIGASE
3lk7.1.A	22.28	monomer	HHblits	X-ray	1.50Å	0.30	0.79	UDP-N-acetylmuramoylalanine--D-glutamate ligase
1uag.1.A	19.00	monomer	HHblits	X-ray	1.95Å	0.29	0.78	UDP-N-ACETYLMURAMOYL-L-ALANINE/:D-GLUTAMATE LIGASE
1eeh.1.A	19.00	monomer	HHblits	X-ray	1.90Å	0.29	0.78	UDP-N-ACETYLMURAMOYL-L-ALANINE:D-GLUTAMATE LIGASE
2uag.1.A	19.00	monomer	HHblits	X-ray	1.70Å	0.29	0.78	PROTEIN (UDP-N-ACETYLMURAMOYL-L-ALANINE:D-GLUTAMATE LIGASE)
1e0d.1.A	19.00	monomer	HHblits	X-ray	2.40Å	0.29	0.78	UDP-N-ACETYLMURAMOYLALANINE--D-GLUTAMATE LIGASE
5a5e.1.A	19.00	monomer	HHblits	X-ray	1.84Å	0.29	0.78	UDP-N-ACETYLMURAMOYLALANINE--D-GLUTAMATE LIGASE
5a5f.1.A	19.10	monomer	HHblits	X-ray	1.90Å	0.29	0.77	UDP-N-ACETYLMURAMOYLALANINE--D-GLUTAMATE LIGASE
2y67.1.A	19.10	monomer	HHblits	X-ray	1.85Å	0.29	0.77	UDP-N-ACETYLMURAMOYLALANINE--D-GLUTAMATE LIGASE
2xpc.1.A	18.88	monomer	HHblits	X-ray	1.49Å	0.29	0.77	UDP-N-ACETYLMURAMOYLALANINE--D-GLUTAMATE LIGASE
2vor.1.A	21.82	monomer	HHblits	X-ray	2.30Å	0.30	0.74	FOLYLPOLYGLUTAMATE SYNTHASE PROTEIN FOLC
4hv4.1.A	22.80	monomer	HHblits	X-ray	2.25Å	0.30	0.75	UDP-N-acetylmuramate--L-alanine ligase
4hv4.2.A	22.80	monomer	HHblits	X-ray	2.25Å	0.30	0.75	UDP-N-acetylmuramate--L-alanine ligase
2f00.1.A	21.70	homo-dimer	HHblits	X-ray	2.50Å	0.29	0.75	UDP-N-acetylmuramate--L-alanine ligase
1p3d.1.A	20.33	monomer	HHblits	X-ray	1.70Å	0.29	0.75	UDP-N-acetylmuramate--alanine ligase
1gqq.1.A	20.33	homo-dimer	HHblits	X-ray	3.10Å	0.29	0.75	UDP-N-ACETYLMURAMATE-L-ALANINE LIGASE
1gqq.1.B	20.33	homo-dimer	HHblits	X-ray	3.10Å	0.29	0.75	UDP-N-ACETYLMURAMATE-L-ALANINE LIGASE
1p31.1.A	20.33	monomer	HHblits	X-ray	1.85Å	0.29	0.75	UDP-N-acetylmuramate--alanine ligase
1gqy.1.B	20.33	homo-dimer	HHblits	X-ray	1.80Å	0.29	0.75	UDP-N-ACETYLMURAMATE-L-ALANINE LIGASE
1gqy.1.A	20.33	homo-dimer	HHblits	X-ray	1.80Å	0.29	0.75	UDP-N-ACETYLMURAMATE-L-ALANINE LIGASE
4buc.1.A	18.36	monomer	HHblits	X-ray	2.17Å	0.28	0.75	UDP-N-ACETYLMURAMOYLALANINE--D-GLUTAMATE LIGASE
4buc.2.A	18.36	monomer	HHblits	X-ray	2.17Å	0.28	0.75	UDP-N-ACETYLMURAMOYLALANINE--D-GLUTAMATE LIGASE
1j6u.1.A	21.41	monomer	HHblits	X-ray	2.30Å	0.29	0.73	UDP-N-acetylmuramate-alanine ligase MurC
1fgs.1.A	19.54	monomer	HHblits	X-ray	2.40Å	0.29	0.71	FOLYLPOLYGLUTAMATE SYNTHETASE
1jbw.1.A	19.54	monomer	HHblits	X-ray	1.85Å	0.29	0.71	FOLYLPOLYGLUTAMATE SYNTHASE
1jbv.1.A	19.54	monomer	HHblits	X-ray	1.95Å	0.29	0.71	FOLYLPOLYGLUTAMATE SYNTHASE
2gca.1.A	19.54	monomer	HHblits	X-ray	2.40Å	0.29	0.71	Folylpolyglutamate synthase
2gcb.1.A	19.25	monomer	HHblits	X-ray	2.30Å	0.29	0.71	Folylpolyglutamate synthase
2gc6.1.A	19.54	monomer	HHblits	X-ray	1.90Å	0.29	0.71	Folylpolyglutamate synthase
2gc5.1.A	19.25	monomer	HHblits	X-ray	1.85Å	0.29	0.71	Folylpolyglutamate synthase
1o5z.1.A	18.23	monomer	HHblits	X-ray	2.10Å	0.28	0.72	folylpolyglutamate synthase/dihydrofolate synthase
1w7k.1.A	21.99	monomer	HHblits	X-ray	2.10Å	0.30	0.70	FOLC BIFUNCTIONAL PROTEIN
1w78.1.A	21.99	monomer	HHblits	X-ray	1.82Å	0.30	0.70	FOLC BIFUNCTIONAL PROTEIN
3hn7.1.A	19.77	monomer	HHblits	X-ray	1.65Å	0.29	0.71	UDP-N-acetylmuramate-L-alanine ligase
3nrs.1.A	21.92	monomer	HHblits	X-ray	1.80Å	0.30	0.68	Dihydrofolate:folylpolyglutamate synthetase
3pyz.1.A	21.92	monomer	HHblits	X-ray	2.10Å	0.30	0.68	Bifunctional folylpolyglutamate synthase/dihydrofolate synthase
5vvw.1.A	20.08	homo-tetramer	HHblits	X-ray	2.30Å	0.29	0.49	UDP-N-acetylmuramate--L-alanine ligase
3eag.1.A	18.96	homo-dimer	HHblits	X-ray	2.55Å	0.28	0.43	UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-meso-diaminopimelate ligase
3eag.1.B	18.96	homo-dimer	HHblits	X-ray	2.55Å	0.28	0.43	UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-meso-diaminopimelate ligase
3lk7.1.A	36.97	monomer	BLAST	X-ray	1.50Å	0.37	0.24	UDP-N-acetylmuramoylalanine--D-glutamate ligase
3mvn.1.A	18.85	monomer	HHblits	X-ray	1.90Å	0.30	0.25	UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-medo-diaminopimelate ligase
2obn.1.A	14.41	homo-dimer	HHblits	X-ray	2.30Å	0.25	0.24	Hypothetical protein
2obn.1.B	14.41	homo-dimer	HHblits	X-ray	2.30Å	0.25	0.24	Hypothetical protein
1kzh.1.A	9.35	homo-dimer	HHblits	X-ray	2.55Å	0.25	0.22	phosphofructokinase
1kzh.1.B	9.35	homo-dimer	HHblits	X-ray	2.55Å	0.25	0.22	phosphofructokinase
2f48.1.B	9.35	homo-dimer	HHblits	X-ray	2.11Å	0.25	0.22	diphosphate--fructose-6-phosphate 1-phosphotransferase
4j29.1.A	15.73	homo-dimer	HHblits	X-ray	2.10Å	0.29	0.18	Engineered Protein OR258
5gaj.1.A	15.73	monomer	HHblits	NMR	NA	0.29	0.18	DE NOVO DESIGNED PROTEIN OR258
3md0.1.A	21.25	homo-dimer	HHblits	X-ray	2.45Å	0.30	0.16	Arginine/ornithine transport system ATPase
2j37.1.G	16.88	hetero-oligomer	HHblits	EM	8.00Å	0.29	0.16	SIGNAL RECOGNITION PARTICLE 54 KDA PROTEIN (SRP54)
4ue5.1.D	16.88	hetero-oligomer	HHblits	EM	9.00Å	0.29	0.16	SIGNAL RECOGNITION PARTICLE 54 KDA PROTEIN
5l3q.1.A	16.88	hetero-oligomer	HHblits	X-ray	3.20Å	0.29	0.16	Signal recognition particle 54 kDa protein
3jaj.45.A	17.11	monomer	HHblits	EM	NA	0.29	0.16	SRP54
3jan.45.A	17.11	monomer	HHblits	EM	NA	0.29	0.16	SRP54
3dm5.1.A	14.47	homo-tetramer	HHblits	X-ray	2.51Å	0.29	0.16	Signal recognition 54 kDa protein
3qw4.1.B	20.78	homo-tetramer	HHblits	X-ray	3.00Å	0.27	0.16	UMP synthase
3qw4.1.A	20.78	homo-tetramer	HHblits	X-ray	3.00Å	0.27	0.16	UMP synthase
3kl4.1.A	12.99	hetero-oligomer	HHblits	X-ray	3.50Å	0.27	0.16	Signal recognition 54 kDa protein
5l3s.1.A	12.99	hetero-oligomer	HHblits	X-ray	1.90Å	0.27	0.16	Signal recognition particle 54 kDa protein
5l3s.4.A	12.99	hetero-oligomer	HHblits	X-ray	1.90Å	0.27	0.16	Signal recognition particle 54 kDa protein
1qzw.1.B	12.99	monomer	HHblits	X-ray	4.10Å	0.27	0.16	Signal recognition 54 kDa protein
1qzx.1.A	12.99	monomer	HHblits	X-ray	4.00Å	0.27	0.16	Signal recognition 54 kDa protein
1j8y.1.A	13.16	monomer	HHblits	X-ray	2.00Å	0.27	0.16	SIGNAL RECOGNITION 54 KDA PROTEIN
2j28.1.H	12.99	hetero-oligomer	HHblits	EM	8.00Å	0.26	0.16	SIGNAL RECOGNITION PARTICLE 54
5gad.1.7	12.99	hetero-oligomer	HHblits	EM	NA	0.26	0.16	Signal recognition particle protein Ffh
2ffh.1.A	13.16	monomer	HHblits	X-ray	3.20Å	0.27	0.16	PROTEIN (FFH)
2xxa.1.A	13.16	hetero-oligomer	HHblits	X-ray	3.94Å	0.26	0.16	SIGNAL RECOGNITION PARTICLE PROTEIN
2xxa.2.A	13.16	hetero-oligomer	HHblits	X-ray	3.94Å	0.26	0.16	SIGNAL RECOGNITION PARTICLE PROTEIN
3jd5.1.W	16.13	hetero-oligomer	HHblits	EM	NA	0.26	0.13	28S ribosomal protein S29, mitochondrial
3j9m.74.A	18.33	monomer	HHblits	EM	NA	0.26	0.12	mS29
5t4p.1.D	15.79	hetero-oligomer	HHblits	EM	NA	0.29	0.12	ATP synthase subunit beta
5t4q.1.E	15.79	hetero-oligomer	HHblits	EM	NA	0.29	0.12	ATP synthase subunit beta
5t4q.1.F	15.79	hetero-oligomer	HHblits	EM	NA	0.29	0.12	ATP synthase subunit beta
5t4o.1.D	15.79	hetero-oligomer	HHblits	EM	NA	0.29	0.12	ATP synthase subunit beta
5t4o.1.E	15.79	hetero-oligomer	HHblits	EM	NA	0.29	0.12	ATP synthase subunit beta
5t4o.1.F	15.79	hetero-oligomer	HHblits	EM	NA	0.29	0.12	ATP synthase subunit beta
5t4q.1.D	15.79	hetero-oligomer	HHblits	EM	NA	0.29	0.12	ATP synthase subunit beta
5t4p.1.E	15.79	hetero-oligomer	HHblits	EM	NA	0.29	0.12	ATP synthase subunit beta
5mrc.62.A	16.07	monomer	HHblits	EM	NA	0.28	0.11	mS29
3r8f.1.A	20.00	homo-tetramer	HHblits	X-ray	3.37Å	0.28	0.11	Chromosomal replication initiator protein dnaA
1l8q.1.A	20.00	monomer	HHblits	X-ray	2.70Å	0.28	0.11	Chromosomal replication initiator protein dnaA
2oze.1.A	16.98	homo-dimer	HHblits	X-ray	1.83Å	0.29	0.11	Orf delta'
1rz3.1.A	17.31	monomer	HHblits	X-ray	1.90Å	0.30	0.11	hypothetical protein RBSTP0775
4jmp.1.A	19.61	monomer	HHblits	X-ray	1.30Å	0.31	0.10	C-terminal fragment of CapA, Protein tyrosine kinase
3bfv.1.A	19.61	monomer	HHblits	X-ray	1.80Å	0.31	0.10	Membrane protein CapA1, Protein tyrosine kinase
2ved.1.A	17.65	homo-octamer	HHblits	X-ray	2.60Å	0.30	0.10	MEMBRANE PROTEIN CAPA1, PROTEIN TYROSINE KINASE
3cio.1.A	17.65	homo-dimer	HHblits	X-ray	2.50Å	0.30	0.10	Tyrosine-protein kinase etk
3cio.1.B	17.65	homo-dimer	HHblits	X-ray	2.50Å	0.30	0.10	Tyrosine-protein kinase etk
3sc3.1.A	17.31	homo-dimer	HHblits	X-ray	3.00Å	0.28	0.11	Putative DNA replication regulator Hda
3sc3.1.B	17.31	homo-dimer	HHblits	X-ray	3.00Å	0.28	0.11	Putative DNA replication regulator Hda
4jlv.1.A	15.69	monomer	HHblits	X-ray	2.20Å	0.29	0.10	C-terminal fragment of Membrane protein CapA1, Putative uncharacterized protein capB1
3la6.1.F	14.00	homo-octamer	HHblits	X-ray	3.20Å	0.29	0.10	Tyrosine-protein kinase wzc
3la6.1.B	14.00	homo-octamer	HHblits	X-ray	3.20Å	0.29	0.10	Tyrosine-protein kinase wzc
3la6.1.C	14.00	homo-octamer	HHblits	X-ray	3.20Å	0.29	0.10	Tyrosine-protein kinase wzc
3la6.1.D	14.00	homo-octamer	HHblits	X-ray	3.20Å	0.29	0.10	Tyrosine-protein kinase wzc
3la6.1.E	14.00	homo-octamer	HHblits	X-ray	3.20Å	0.29	0.10	Tyrosine-protein kinase wzc
3la6.1.A	14.00	homo-octamer	HHblits	X-ray	3.20Å	0.29	0.10	Tyrosine-protein kinase wzc
3la6.1.G	14.00	homo-octamer	HHblits	X-ray	3.20Å	0.29	0.10	Tyrosine-protein kinase wzc
3la6.1.H	14.00	homo-octamer	HHblits	X-ray	3.20Å	0.29	0.10	Tyrosine-protein kinase wzc
3la6.2.C	14.00	homo-octamer	HHblits	X-ray	3.20Å	0.29	0.10	Tyrosine-protein kinase wzc
3upu.1.A	22.92	monomer	HHblits	X-ray	3.30Å	0.32	0.10	ATP-dependent DNA helicase dda
3upu.3.A	22.92	monomer	HHblits	X-ray	3.30Å	0.32	0.10	ATP-dependent DNA helicase dda
1sq5.1.A	23.40	homo-dimer	HHblits	X-ray	2.20Å	0.32	0.10	Pantothenate kinase
3ecc.1.A	16.00	monomer	HHblits	X-ray	2.70Å	0.26	0.10	DNA replication protein DnaC
1lv7.1.A	17.02	monomer	HHblits	X-ray	1.50Å	0.30	0.10	FtsH
3bos.1.A	15.22	homo-dimer	HHblits	X-ray	1.75Å	0.28	0.09	Putative DNA replication factor
3bos.1.B	15.22	homo-dimer	HHblits	X-ray	1.75Å	0.28	0.09	Putative DNA replication factor
3pxg.1.F	22.73	hetero-oligomer	HHblits	X-ray	3.65Å	0.30	0.09	Negative regulator of genetic competence ClpC/MecB
3pxg.1.D	22.73	hetero-oligomer	HHblits	X-ray	3.65Å	0.30	0.09	Negative regulator of genetic competence ClpC/MecB
3pxg.1.B	22.73	hetero-oligomer	HHblits	X-ray	3.65Å	0.30	0.09	Negative regulator of genetic competence ClpC/MecB
3pxg.1.J	22.73	hetero-oligomer	HHblits	X-ray	3.65Å	0.30	0.09	Negative regulator of genetic competence ClpC/MecB
3pxi.1.B	23.26	hetero-oligomer	HHblits	X-ray	6.93Å	0.30	0.09	Negative regulator of genetic competence ClpC/MecB
3pxi.1.D	23.26	hetero-oligomer	HHblits	X-ray	6.93Å	0.30	0.09	Negative regulator of genetic competence ClpC/MecB
3pxi.1.F	23.26	hetero-oligomer	HHblits	X-ray	6.93Å	0.30	0.09	Negative regulator of genetic competence ClpC/MecB
4c8p.1.A	20.93	homo-dimer	HHblits	X-ray	2.10Å	0.30	0.09	E3 UBIQUITIN-PROTEIN LIGASE ZNRF3
1jbk.1.A	21.43	monomer	HHblits	X-ray	1.80Å	0.30	0.09	CLPB PROTEIN
1xjc.1.A	28.95	monomer	HHblits	X-ray	2.10Å	0.32	0.08	MobB protein homolog
2g0t.1.A	24.32	homo-dimer	HHblits	X-ray	2.67Å	0.32	0.08	conserved hypothetical protein
1p9n.1.A	24.32	homo-dimer	HHblits	X-ray	2.80Å	0.32	0.08	Molybdopterin-guanine dinucleotide biosynthesis protein B
1p9n.1.B	24.32	homo-dimer	HHblits	X-ray	2.80Å	0.32	0.08	Molybdopterin-guanine dinucleotide biosynthesis protein B
1np6.1.A	24.32	homo-dimer	HHblits	X-ray	1.90Å	0.32	0.08	Molybdopterin-guanine dinucleotide biosynthesis protein B
1np6.1.B	24.32	homo-dimer	HHblits	X-ray	1.90Å	0.32	0.08	Molybdopterin-guanine dinucleotide biosynthesis protein B
4pfs.1.A	27.03	monomer	HHblits	X-ray	2.30Å	0.30	0.08	Cobyrinic Acid a,c-diamide synthase
4pfs.2.A	27.03	monomer	HHblits	X-ray	2.30Å	0.30	0.08	Cobyrinic Acid a,c-diamide synthase
2v3c.1.B	19.44	hetero-oligomer	HHblits	X-ray	2.50Å	0.32	0.07	SIGNAL RECOGNITION 54 KDA PROTEIN
2v3c.2.B	19.44	hetero-oligomer	HHblits	X-ray	2.50Å	0.32	0.07	SIGNAL RECOGNITION 54 KDA PROTEIN
5j1j.1.A	44.12	homo-dimer	HHblits	X-ray	1.55Å	0.37	0.07	Site-determining protein
5j1j.1.B	44.12	homo-dimer	HHblits	X-ray	1.55Å	0.37	0.07	Site-determining protein
5jvf.1.A	44.12	monomer	HHblits	X-ray	1.66Å	0.37	0.07	Site-determining protein
4oyh.1.A	22.22	homo-dimer	HHblits	X-ray	2.41Å	0.32	0.07	Molybdopterin-guanine dinucleotide biosynthesis protein B
4oyh.2.A	22.22	homo-dimer	HHblits	X-ray	2.41Å	0.32	0.07	Molybdopterin-guanine dinucleotide biosynthesis protein B
4oyh.2.B	22.22	homo-dimer	HHblits	X-ray	2.41Å	0.32	0.07	Molybdopterin-guanine dinucleotide biosynthesis protein B
4oyh.3.A	22.22	homo-dimer	HHblits	X-ray	2.41Å	0.32	0.07	Molybdopterin-guanine dinucleotide biosynthesis protein B
4oyh.3.B	22.22	homo-dimer	HHblits	X-ray	2.41Å	0.32	0.07	Molybdopterin-guanine dinucleotide biosynthesis protein B
4nkr.1.A	22.22	homo-dimer	HHblits	X-ray	2.41Å	0.32	0.07	Molybdopterin-guanine dinucleotide biosynthesis protein B
4nkr.2.A	22.22	homo-dimer	HHblits	X-ray	2.41Å	0.32	0.07	Molybdopterin-guanine dinucleotide biosynthesis protein B
4nkr.2.B	22.22	homo-dimer	HHblits	X-ray	2.41Å	0.32	0.07	Molybdopterin-guanine dinucleotide biosynthesis protein B
4nkr.3.A	22.22	homo-dimer	HHblits	X-ray	2.41Å	0.32	0.07	Molybdopterin-guanine dinucleotide biosynthesis protein B
4nkr.3.B	22.22	homo-dimer	HHblits	X-ray	2.41Å	0.32	0.07	Molybdopterin-guanine dinucleotide biosynthesis protein B
1zu5.1.A	28.57	monomer	HHblits	X-ray	2.40Å	0.33	0.07	ftsY
1zu4.1.A	28.57	monomer	HHblits	X-ray	1.95Å	0.33	0.07	ftsY
1j8m.1.A	28.57	monomer	HHblits	X-ray	2.00Å	0.33	0.07	SIGNAL RECOGNITION 54 KDA PROTEIN
3ndb.1.B	20.00	hetero-oligomer	HHblits	X-ray	3.00Å	0.33	0.07	Signal recognition 54 kDa protein
3c8u.1.A	32.35	monomer	HHblits	X-ray	1.95Å	0.35	0.07	Fructokinase
3nxs.1.A	22.86	homo-dimer	HHblits	X-ray	2.30Å	0.33	0.07	LAO/AO transport system ATPase
5l3r.1.A	28.57	hetero-oligomer	HHblits	X-ray	2.50Å	0.33	0.07	Signal recognition particle 54 kDa protein, chloroplastic
5if9.1.A	27.78	monomer	HHblits	X-ray	1.80Å	0.31	0.07	Cobyrinic Acid a,c-diamide synthase
2p67.1.A	25.71	homo-dimer	HHblits	X-ray	1.80Å	0.33	0.07	LAO/AO transport system kinase
5l3v.1.A	25.71	monomer	HHblits	X-ray	2.30Å	0.33	0.07	Signal recognition particle 54 kDa protein
5l3v.2.A	25.71	monomer	HHblits	X-ray	2.30Å	0.33	0.07	Signal recognition particle 54 kDa protein
2gks.1.A	20.00	homo-dimer	HHblits	X-ray	2.31Å	0.33	0.07	Bifunctional SAT/APS kinase
2gks.1.B	20.00	homo-dimer	HHblits	X-ray	2.31Å	0.33	0.07	Bifunctional SAT/APS kinase
4f7w.1.B	16.67	homo-dimer	HHblits	X-ray	2.10Å	0.30	0.07	Pantothenate kinase
4f7w.1.A	16.67	homo-dimer	HHblits	X-ray	2.10Å	0.30	0.07	Pantothenate kinase
4f7w.3.A	16.67	homo-dimer	HHblits	X-ray	2.10Å	0.30	0.07	Pantothenate kinase
4f7w.4.B	16.67	homo-dimer	HHblits	X-ray	2.10Å	0.30	0.07	Pantothenate kinase
4ne2.2.A	16.67	homo-dimer	HHblits	X-ray	1.90Å	0.30	0.07	Pantothenate kinase
2og2.1.A	25.00	monomer	HHblits	X-ray	2.00Å	0.30	0.07	Putative signal recognition particle receptor
3tk1.1.A	22.86	homo-dimer	HHblits	X-ray	2.40Å	0.32	0.07	Membrane ATPase/protein kinase
3fmi.1.A	32.35	homo-dimer	HHblits	X-ray	2.18Å	0.34	0.07	Dethiobiotin synthetase
3fmi.1.B	32.35	homo-dimer	HHblits	X-ray	2.18Å	0.34	0.07	Dethiobiotin synthetase
3fmf.2.A	32.35	homo-dimer	HHblits	X-ray	2.05Å	0.34	0.07	Dethiobiotin synthetase
5aun.1.B	35.29	hetero-oligomer	HHblits	X-ray	1.63Å	0.34	0.07	ATPase involved in chromosome partitioning, ParA/MinD family, Mrp homolog
3vx3.1.A	35.29	homo-dimer	HHblits	X-ray	2.10Å	0.34	0.07	ATPase involved in chromosome partitioning, ParA/MinD family, Mrp homolog
5auq.3.A	35.29	homo-dimer	HHblits	X-ray	2.53Å	0.34	0.07	ATPase involved in chromosome partitioning, ParA/MinD family, Mrp homolog
3vx3.1.B	35.29	homo-dimer	HHblits	X-ray	2.10Å	0.34	0.07	ATPase involved in chromosome partitioning, ParA/MinD family, Mrp homolog
5gad.1.9	22.86	hetero-oligomer	HHblits	EM	NA	0.31	0.07	Signal recognition particle receptor FtsY
2xxa.1.B	22.86	hetero-oligomer	HHblits	X-ray	3.94Å	0.31	0.07	SRP RECEPTOR FTSY
5nco.1.c	22.86	hetero-oligomer	HHblits	EM	4.80Å	0.31	0.07	Signal recognition particle receptor FtsY
2qy9.1.A	22.86	monomer	HHblits	X-ray	1.90Å	0.31	0.07	Cell division protein ftsY
2bek.1.A	32.35	homo-dimer	HHblits	X-ray	1.80Å	0.33	0.07	SEGREGATION PROTEIN
1wcv.1.A	32.35	homo-dimer	HHblits	X-ray	1.60Å	0.33	0.07	SEGREGATION PROTEIN
2bej.1.A	32.35	homo-dimer	HHblits	X-ray	2.10Å	0.33	0.07	SEGREGATION PROTEIN
1fts.1.A	22.86	monomer	HHblits	X-ray	2.20Å	0.31	0.07	FTSY
4v02.1.A	30.30	hetero-oligomer	HHblits	X-ray	2.70Å	0.36	0.07	SITE-DETERMINING PROTEIN
4rz3.1.A	35.29	homo-dimer	HHblits	X-ray	1.90Å	0.33	0.07	Site-determining protein
4rz3.1.B	35.29	homo-dimer	HHblits	X-ray	1.90Å	0.33	0.07	Site-determining protein
2hly.1.A	20.59	monomer	HHblits	X-ray	1.60Å	0.33	0.07	Hypothetical protein Atu2299
5l3r.1.B	25.71	hetero-oligomer	HHblits	X-ray	2.50Å	0.31	0.07	Cell division protein FtsY homolog, chloroplastic
3b9q.1.A	25.71	monomer	HHblits	X-ray	1.75Å	0.31	0.07	Chloroplast SRP receptor homolog, alpha subunit CPFTSY
5u1j.1.A	24.24	homo-dimer	HHblits	X-ray	2.95Å	0.35	0.07	Uncharacterized protein
5u1j.1.B	24.24	homo-dimer	HHblits	X-ray	2.95Å	0.35	0.07	Uncharacterized protein
5u1j.2.A	24.24	homo-dimer	HHblits	X-ray	2.95Å	0.35	0.07	Uncharacterized protein
5u1j.2.B	24.24	homo-dimer	HHblits	X-ray	2.95Å	0.35	0.07	Uncharacterized protein
5l3s.1.B	25.00	hetero-oligomer	HHblits	X-ray	1.90Å	0.29	0.07	Signal recognition particle receptor FtsY
5l3s.2.B	25.00	hetero-oligomer	HHblits	X-ray	1.90Å	0.29	0.07	Signal recognition particle receptor FtsY
5l3s.3.B	25.00	hetero-oligomer	HHblits	X-ray	1.90Å	0.29	0.07	Signal recognition particle receptor FtsY
5l3s.4.B	25.00	hetero-oligomer	HHblits	X-ray	1.90Å	0.29	0.07	Signal recognition particle receptor FtsY
3do6.1.A	29.41	homo-tetramer	HHblits	X-ray	1.85Å	0.33	0.07	Formate--tetrahydrofolate ligase
1vma.1.A	25.71	monomer	HHblits	X-ray	1.60Å	0.31	0.07	cell division protein FtsY
2xx3.1.A	29.41	homo-dimer	HHblits	X-ray	2.00Å	0.33	0.07	THYMIDYLATE KINASE
2vo1.1.A	25.71	homo-tetramer	HHblits	X-ray	2.80Å	0.30	0.07	CTP SYNTHASE 1
3syn.2.A	22.86	hetero-oligomer	HHblits	X-ray	3.06Å	0.30	0.07	Flagellar biosynthesis protein flhF
2px0.1.B	22.86	homo-dimer	HHblits	X-ray	3.00Å	0.30	0.07	Flagellar biosynthesis protein flhF
2px0.3.B	22.86	homo-dimer	HHblits	X-ray	3.00Å	0.30	0.07	Flagellar biosynthesis protein flhF
2px0.4.A	22.86	homo-dimer	HHblits	X-ray	3.00Å	0.30	0.07	Flagellar biosynthesis protein flhF
2px3.1.A	22.86	homo-dimer	HHblits	X-ray	3.20Å	0.30	0.07	Flagellar biosynthesis protein flhF
2px0.1.A	22.86	homo-dimer	HHblits	X-ray	3.00Å	0.30	0.07	Flagellar biosynthesis protein flhF
1ion.1.A	30.30	monomer	HHblits	X-ray	2.30Å	0.35	0.07	PROBABLE CELL DIVISION INHIBITOR MIND
3dm9.1.A	28.57	homo-hexamer	HHblits	X-ray	2.20Å	0.30	0.07	Signal recognition particle receptor
3e70.1.A	28.57	monomer	HHblits	X-ray	1.97Å	0.30	0.07	Signal recognition particle receptor
3dmd.1.F	28.57	homo-hexamer	HHblits	X-ray	2.21Å	0.30	0.07	Signal recognition particle receptor
3dmd.1.E	28.57	homo-hexamer	HHblits	X-ray	2.21Å	0.30	0.07	Signal recognition particle receptor
2cnw.1.B	23.53	hetero-oligomer	HHblits	X-ray	2.39Å	0.32	0.07	CELL DIVISION PROTEIN FTSY
2iyl.1.A	23.53	monomer	HHblits	X-ray	2.10Å	0.32	0.07	CELL DIVISION PROTEIN FTSY
2cnw.2.B	23.53	hetero-oligomer	HHblits	X-ray	2.39Å	0.32	0.07	CELL DIVISION PROTEIN FTSY
2j7p.1.B	23.53	hetero-oligomer	HHblits	X-ray	1.97Å	0.32	0.07	CELL DIVISION PROTEIN FTSY
1okk.1.B	23.53	hetero-oligomer	HHblits	X-ray	2.05Å	0.32	0.07	CELL DIVISION PROTEIN FTSY
2xkv.1.D	23.53	hetero-oligomer	HHblits	EM	13.50Å	0.32	0.07	CELL DIVISION PROTEIN FTSY
2q9a.1.A	23.53	monomer	HHblits	X-ray	2.24Å	0.32	0.07	Cell division protein ftsY
2q9a.2.A	23.53	monomer	HHblits	X-ray	2.24Å	0.32	0.07	Cell division protein ftsY
1f48.1.A	35.29	monomer	HHblits	X-ray	2.30Å	0.32	0.07	ARSENITE-TRANSLOCATING ATPASE
1dah.1.A	35.29	homo-dimer	HHblits	X-ray	1.64Å	0.32	0.07	DETHIOBIOTIN SYNTHETASE
1byi.1.A	35.29	homo-dimer	HHblits	X-ray	0.97Å	0.32	0.07	DETHIOBIOTIN SYNTHASE
4v03.1.A	27.27	homo-dimer	HHblits	X-ray	1.90Å	0.34	0.07	SITE-DETERMINING PROTEIN
1fp7.1.A	39.39	homo-tetramer	HHblits	X-ray	3.20Å	0.34	0.07	FORMATE--TETRAHYDROFOLATE LIGASE
3qus.1.A	39.39	homo-dimer	HHblits	X-ray	2.84Å	0.34	0.07	Formate--tetrahydrofolate ligase
3zq6.1.A	23.53	homo-dimer	HHblits	X-ray	2.11Å	0.32	0.07	PUTATIVE ARSENICAL PUMP-DRIVING ATPASE
3zq6.1.B	23.53	homo-dimer	HHblits	X-ray	2.11Å	0.32	0.07	PUTATIVE ARSENICAL PUMP-DRIVING ATPASE
3zq6.2.A	23.53	homo-dimer	HHblits	X-ray	2.11Å	0.32	0.07	PUTATIVE ARSENICAL PUMP-DRIVING ATPASE
3zq6.2.B	23.53	homo-dimer	HHblits	X-ray	2.11Å	0.32	0.07	PUTATIVE ARSENICAL PUMP-DRIVING ATPASE
2j7p.1.A	26.47	hetero-oligomer	HHblits	X-ray	1.97Å	0.32	0.07	SIGNAL RECOGNITION PARTICLE PROTEIN
3ng1.1.A	26.47	monomer	HHblits	X-ray	2.30Å	0.32	0.07	SIGNAL SEQUENCE RECOGNITION PROTEIN FFH
2cnw.1.A	26.47	hetero-oligomer	HHblits	X-ray	2.39Å	0.32	0.07	SIGNAL RECOGNITION PARTICLE PROTEIN
2cnw.3.A	26.47	hetero-oligomer	HHblits	X-ray	2.39Å	0.32	0.07	SIGNAL RECOGNITION PARTICLE PROTEIN
2xkv.1.A	26.47	hetero-oligomer	HHblits	EM	13.50Å	0.32	0.07	SIGNAL RECOGNITION PARTICLE PROTEIN
1ffh.1.A	26.47	monomer	HHblits	X-ray	2.05Å	0.32	0.07	FFH
4rz2.1.A	32.35	monomer	HHblits	X-ray	2.80Å	0.32	0.07	Site-determining protein
2yhs.1.A	23.53	monomer	HHblits	X-ray	1.60Å	0.32	0.07	CELL DIVISION PROTEIN FTSY
4c7o.1.B	20.00	hetero-oligomer	HHblits	X-ray	2.60Å	0.30	0.07	SIGNAL RECOGNITION PARTICLE RECEPTOR FTSY
2j45.1.A	26.47	monomer	HHblits	X-ray	1.14Å	0.32	0.07	SIGNAL RECOGNITION PARTICLE PROTEIN
2j45.2.A	26.47	monomer	HHblits	X-ray	1.14Å	0.32	0.07	SIGNAL RECOGNITION PARTICLE PROTEIN
2j46.1.A	26.47	monomer	HHblits	X-ray	1.14Å	0.32	0.07	SIGNAL RECOGNITION PARTICLE PROTEIN
2j46.2.A	26.47	monomer	HHblits	X-ray	1.14Å	0.32	0.07	SIGNAL RECOGNITION PARTICLE PROTEIN
1o87.1.A	26.47	monomer	HHblits	X-ray	2.10Å	0.32	0.07	SIGNAL RECOGNITION PARTICLE PROTEIN
1o87.2.A	26.47	monomer	HHblits	X-ray	2.10Å	0.32	0.07	SIGNAL RECOGNITION PARTICLE PROTEIN
2c04.1.A	26.47	monomer	HHblits	X-ray	1.15Å	0.32	0.07	SIGNAL RECOGNITION PARTICLE PROTEIN
2c04.2.A	26.47	monomer	HHblits	X-ray	1.15Å	0.32	0.07	SIGNAL RECOGNITION PARTICLE PROTEIN
2c03.1.A	26.47	monomer	HHblits	X-ray	1.24Å	0.32	0.07	SIGNAL RECOGNITION PARTICLE PROTEIN
2c03.2.A	26.47	monomer	HHblits	X-ray	1.24Å	0.32	0.07	SIGNAL RECOGNITION PARTICLE PROTEIN
2ng1.1.A	26.47	monomer	HHblits	X-ray	2.02Å	0.32	0.07	SIGNAL SEQUENCE RECOGNITION PROTEIN FFH
1rj9.1.B	26.47	hetero-oligomer	HHblits	X-ray	1.90Å	0.32	0.07	Signal recognition particle protein
1jpj.1.A	26.47	monomer	HHblits	X-ray	2.30Å	0.32	0.07	SIGNAL RECOGNITION PARTICLE PROTEIN
1jpn.1.A	26.47	monomer	HHblits	X-ray	1.90Å	0.32	0.07	SIGNAL RECOGNITION PARTICLE PROTEIN
1jpn.2.A	26.47	monomer	HHblits	X-ray	1.90Å	0.32	0.07	SIGNAL RECOGNITION PARTICLE PROTEIN
1ls1.1.A	26.47	monomer	HHblits	X-ray	1.10Å	0.32	0.07	SIGNAL RECOGNITION PARTICLE PROTEIN
2www.1.A	17.65	homo-dimer	HHblits	X-ray	2.64Å	0.32	0.07	METHYLMALONIC ACIDURIA TYPE A PROTEIN, MITOCHONDRIAL
3adb.1.A	29.41	homo-dimer	HHblits	X-ray	2.80Å	0.32	0.07	L-seryl-tRNA(Sec) kinase
3adc.1.B	29.41	homo-dimer	HHblits	X-ray	2.90Å	0.32	0.07	L-seryl-tRNA(Sec) kinase
3adc.1.A	29.41	homo-dimer	HHblits	X-ray	2.90Å	0.32	0.07	L-seryl-tRNA(Sec) kinase
3adb.1.B	29.41	homo-dimer	HHblits	X-ray	2.80Å	0.32	0.07	L-seryl-tRNA(Sec) kinase
3add.1.B	29.41	homo-dimer	HHblits	X-ray	2.40Å	0.32	0.07	L-seryl-tRNA(Sec) kinase
3ez7.1.A	17.14	homo-dimer	HHblits	X-ray	2.92Å	0.29	0.07	Plasmid partition protein A
5k5z.1.A	28.13	homo-dimer	HHblits	X-ray	2.37Å	0.36	0.07	ParA
5k5z.2.A	28.13	homo-dimer	HHblits	X-ray	2.37Å	0.36	0.07	ParA
5k5z.2.B	28.13	homo-dimer	HHblits	X-ray	2.37Å	0.36	0.07	ParA
2ynm.1.A	30.30	hetero-oligomer	HHblits	X-ray	2.10Å	0.34	0.07	LIGHT-INDEPENDENT PROTOCHLOROPHYLLIDE REDUCTASE IRON-SULFUR ATP-BINDING PROTEIN
4wop.1.A	33.33	homo-dimer	HHblits	X-ray	2.39Å	0.34	0.07	ATP-dependent dethiobiotin synthetase BioD
1e9f.1.A	30.30	homo-dimer	HHblits	X-ray	1.90Å	0.34	0.07	THYMIDYLATE KINASE
2xj9.1.A	23.53	homo-dimer	HHblits	X-ray	2.80Å	0.31	0.07	MIPZ
2xj9.1.B	23.53	homo-dimer	HHblits	X-ray	2.80Å	0.31	0.07	MIPZ
5l3w.1.A	22.22	monomer	HHblits	X-ray	2.40Å	0.27	0.07	Signal recognition particle receptor FtsY
1rw4.1.A	27.27	homo-dimer	HHblits	X-ray	2.50Å	0.34	0.07	Nitrogenase iron protein 1
5u1g.1.A	30.30	hetero-oligomer	HHblits	X-ray	3.64Å	0.34	0.07	ParA
5u1g.2.B	30.30	hetero-oligomer	HHblits	X-ray	3.64Å	0.34	0.07	ParA
4e07.1.A	30.30	monomer	HHblits	X-ray	2.90Å	0.34	0.07	Plasmid partitioning protein ParF
4e09.1.A	30.30	homo-dimer	HHblits	X-ray	2.99Å	0.34	0.07	Plasmid partitioning protein ParF
4e03.1.A	30.30	monomer	HHblits	X-ray	2.45Å	0.34	0.07	Plasmid partitioning protein ParF
4e03.2.A	30.30	monomer	HHblits	X-ray	2.45Å	0.34	0.07	Plasmid partitioning protein ParF
4dzz.1.A	30.30	monomer	HHblits	X-ray	1.80Å	0.34	0.07	Plasmid partitioning protein ParF
4dzz.2.A	30.30	monomer	HHblits	X-ray	1.80Å	0.34	0.07	Plasmid partitioning protein ParF
1g3r.1.A	30.30	monomer	HHblits	X-ray	2.70Å	0.34	0.07	CELL DIVISION INHIBITOR
2xj4.1.A	23.53	monomer	HHblits	X-ray	1.60Å	0.31	0.07	MIPZ
1rj9.1.A	24.24	hetero-oligomer	HHblits	X-ray	1.90Å	0.33	0.07	Signal Recognition Protein
1xnj.1.B	30.30	homo-dimer	HHblits	X-ray	1.98Å	0.33	0.07	Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthetase 1
1xnj.1.A	30.30	homo-dimer	HHblits	X-ray	1.98Å	0.33	0.07	Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthetase 1
3fwy.1.A	27.27	homo-dimer	HHblits	X-ray	1.63Å	0.33	0.07	Light-independent protochlorophyllide reductase iron-sulfur ATP-binding protein
3fwy.1.B	27.27	homo-dimer	HHblits	X-ray	1.63Å	0.33	0.07	Light-independent protochlorophyllide reductase iron-sulfur ATP-binding protein
4ixn.1.A	17.65	homo-dimer	HHblits	X-ray	2.05Å	0.31	0.07	Uncharacterized GTP-binding protein YjiA
4ak9.1.A	20.59	homo-dimer	HHblits	X-ray	1.80Å	0.31	0.07	CPFTSY
1a7j.1.A	23.53	monomer	HHblits	X-ray	2.50Å	0.31	0.07	PHOSPHORIBULOKINASE
1m8p.1.A	20.59	homo-hexamer	HHblits	X-ray	2.60Å	0.31	0.07	sulfate adenylyltransferase
1i2d.1.A	20.59	homo-hexamer	HHblits	X-ray	2.81Å	0.31	0.07	ATP SULFURYLASE
3fkq.1.A	17.14	homo-dimer	HHblits	X-ray	2.10Å	0.29	0.07	NtrC-like two-domain protein
5a5g.1.A	33.33	homo-dimer	HHblits	X-ray	2.30Å	0.33	0.07	FORMATE--TETRAHYDROFOLATE LIGASE
3r9i.1.B	34.38	hetero-oligomer	HHblits	X-ray	2.60Å	0.35	0.07	Septum site-determining protein minD
3q9l.1.A	34.38	homo-dimer	HHblits	X-ray	2.34Å	0.35	0.07	Septum site-determining protein minD
1hyq.1.A	33.33	monomer	HHblits	X-ray	2.60Å	0.33	0.07	CELL DIVISION INHIBITOR (MIND-1)
4ixm.2.B	17.65	homo-dimer	HHblits	X-ray	2.57Å	0.31	0.07	Uncharacterized GTP-binding protein YjiA
1nij.1.A	17.65	monomer	HHblits	X-ray	2.00Å	0.31	0.07	Hypothetical protein yjiA
1dts.1.A	36.36	homo-dimer	HHblits	X-ray	1.65Å	0.33	0.07	DETHIOBIOTIN SYNTHETASE
4jim.1.A	36.36	homo-dimer	HHblits	X-ray	2.10Å	0.33	0.07	Formate--tetrahydrofolate ligase
4jjz.1.A	36.36	homo-dimer	HHblits	X-ray	2.50Å	0.33	0.07	Formate--tetrahydrofolate ligase
1eg7.1.A	36.36	homo-tetramer	HHblits	X-ray	2.50Å	0.33	0.07	FORMYLTETRAHYDROFOLATE SYNTHETASE
3nva.1.A	26.47	homo-dimer	HHblits	X-ray	2.50Å	0.30	0.07	CTP synthase
5gaf.1.7	17.14	hetero-oligomer	HHblits	EM	NA	0.28	0.07	Signal recognition particle protein
1tf7.1.A	23.53	homo-hexamer	HHblits	X-ray	2.80Å	0.30	0.07	KaiC
1tf7.1.F	23.53	homo-hexamer	HHblits	X-ray	2.80Å	0.30	0.07	KaiC
4c7o.1.A	17.14	hetero-oligomer	HHblits	X-ray	2.60Å	0.28	0.07	SIGNAL RECOGNITION PARTICLE PROTEIN
4c7o.2.A	17.14	hetero-oligomer	HHblits	X-ray	2.60Å	0.28	0.07	SIGNAL RECOGNITION PARTICLE PROTEIN
2ph1.1.A	34.38	homo-dimer	HHblits	X-ray	2.70Å	0.35	0.07	Nucleotide-binding protein
2f1r.1.A	28.13	homo-dimer	HHblits	X-ray	2.10Å	0.35	0.07	molybdopterin-guanine dinucleotide biosynthesis protein B (mobB)
2f1r.1.B	28.13	homo-dimer	HHblits	X-ray	2.10Å	0.35	0.07	molybdopterin-guanine dinucleotide biosynthesis protein B (mobB)
3ez6.1.A	20.59	homo-dimer	HHblits	X-ray	2.58Å	0.30	0.07	Plasmid partition protein A
3ez6.1.B	20.59	homo-dimer	HHblits	X-ray	2.58Å	0.30	0.07	Plasmid partition protein A
3ez2.1.B	20.59	homo-dimer	HHblits	X-ray	2.05Å	0.30	0.07	Plasmid partition protein A
4ohv.1.A	23.53	monomer	HHblits	X-ray	2.30Å	0.30	0.07	Protein clpf-1
2ofx.1.A	31.25	homo-dimer	HHblits	X-ray	1.90Å	0.34	0.07	Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthetase 1
1e98.1.A	31.25	homo-dimer	HHblits	X-ray	1.90Å	0.34	0.07	THYMIDYLATE KINASE
1nmy.1.A	31.25	monomer	HHblits	X-ray	1.60Å	0.34	0.07	similar to THYMIDYLATE KINASE (DTMP KINASE)
1e2e.1.A	31.25	homo-dimer	HHblits	X-ray	2.00Å	0.34	0.07	THYMIDYLATE KINASE
1e9c.1.A	31.25	homo-dimer	HHblits	X-ray	1.60Å	0.34	0.07	THYMIDYLATE KINASE
3of5.1.A	17.65	homo-dimer	HHblits	X-ray	1.52Å	0.30	0.07	Dethiobiotin synthetase
3kb1.1.A	30.30	homo-dimer	HHblits	X-ray	2.90Å	0.32	0.07	Nucleotide-binding protein
3pg5.1.A	37.50	monomer	HHblits	X-ray	3.30Å	0.34	0.07	Uncharacterized protein
3pg5.2.A	37.50	monomer	HHblits	X-ray	3.30Å	0.34	0.07	Uncharacterized protein
3pg5.3.A	37.50	monomer	HHblits	X-ray	3.30Å	0.34	0.07	Uncharacterized protein
3pg5.4.A	37.50	monomer	HHblits	X-ray	3.30Å	0.34	0.07	Uncharacterized protein
2xit.1.A	24.24	homo-dimer	HHblits	X-ray	1.80Å	0.32	0.07	MIPZ
3ug7.1.A	26.47	homo-tetramer	HHblits	X-ray	2.90Å	0.29	0.07	arsenical pump-driving ATPase
3ug6.1.A	26.47	homo-tetramer	HHblits	X-ray	3.30Å	0.29	0.07	arsenical pump-driving ATPase
3ez9.1.A	26.47	homo-dimer	HHblits	X-ray	2.80Å	0.29	0.07	ParA
3ez9.2.A	26.47	homo-dimer	HHblits	X-ray	2.80Å	0.29	0.07	ParA
3ezf.1.A	26.47	homo-dimer	HHblits	X-ray	2.80Å	0.29	0.07	ParA
3mle.1.A	25.81	homo-dimer	HHblits	X-ray	2.80Å	0.36	0.06	Dethiobiotin synthetase
3ihl.1.A	27.27	homo-tetramer	HHblits	X-ray	2.80Å	0.31	0.07	CTP synthase 2
3ihl.1.B	27.27	homo-tetramer	HHblits	X-ray	2.80Å	0.31	0.07	CTP synthase 2
4zdi.1.A	20.59	homo-dimer	HHblits	X-ray	3.52Å	0.29	0.07	CTP synthase
4zdk.1.A	20.59	homo-tetramer	HHblits	X-ray	3.49Å	0.29	0.07	CTP synthase
5nco.1.9	17.65	hetero-oligomer	HHblits	EM	4.80Å	0.29	0.07	Signal recognition particle protein,Signal recognition particle protein,Signal recognition particle protein,Signal recognition particle protein,Signal recognition particle protein,Signal recognition particle protein,Signal recognition particle protein,Signal recognition particle protein,Signal recognition particle protein,Signal recognition particle protein
1g20.1.E	28.13	hetero-oligomer	HHblits	X-ray	2.20Å	0.33	0.07	NITROGENASE IRON PROTEIN
1g21.1.H	28.13	hetero-oligomer	HHblits	X-ray	3.00Å	0.33	0.07	NITROGENASE IRON PROTEIN
1g21.1.E	28.13	hetero-oligomer	HHblits	X-ray	3.00Å	0.33	0.07	NITROGENASE IRON PROTEIN
4wzb.1.F	28.13	hetero-oligomer	HHblits	X-ray	2.30Å	0.33	0.07	Nitrogenase iron protein 1
4wzb.1.E	28.13	hetero-oligomer	HHblits	X-ray	2.30Å	0.33	0.07	Nitrogenase iron protein 1
5cb6.3.B	28.13	homo-dimer	HHblits	X-ray	2.79Å	0.33	0.07	Probable adenylyl-sulfate kinase
5cb6.2.B	28.13	homo-dimer	HHblits	X-ray	2.79Å	0.33	0.07	Probable adenylyl-sulfate kinase
3k0e.1.A	24.24	homo-hexamer	HHblits	X-ray	3.20Å	0.31	0.07	Circadian clock protein kinase KaiC
3k0e.1.B	24.24	homo-hexamer	HHblits	X-ray	3.20Å	0.31	0.07	Circadian clock protein kinase KaiC
3k0e.1.C	24.24	homo-hexamer	HHblits	X-ray	3.20Å	0.31	0.07	Circadian clock protein kinase KaiC
3k0e.1.D	24.24	homo-hexamer	HHblits	X-ray	3.20Å	0.31	0.07	Circadian clock protein kinase KaiC
3k0e.1.E	24.24	homo-hexamer	HHblits	X-ray	3.20Å	0.31	0.07	Circadian clock protein kinase KaiC
3k0e.1.F	24.24	homo-hexamer	HHblits	X-ray	3.20Å	0.31	0.07	Circadian clock protein kinase KaiC
2yvu.1.A	29.03	homo-dimer	HHblits	X-ray	2.10Å	0.35	0.06	Probable adenylyl-sulfate kinase
2yvu.1.B	29.03	homo-dimer	HHblits	X-ray	2.10Å	0.35	0.06	Probable adenylyl-sulfate kinase
4d4j.1.A	22.58	homo-dimer	HHblits	X-ray	3.00Å	0.35	0.06	6-PHOSPHOFRUCTO-2-KINASE/FRUCTOSE-2,6-BISPHOSPHATASE 3
1yr6.1.A	21.88	homo-dimer	HHblits	X-ray	2.15Å	0.33	0.07	ATP(GTP)binding protein
1yr7.1.A	21.88	homo-dimer	HHblits	X-ray	2.08Å	0.33	0.07	ATP(GTP)binding protein
1yr8.1.A	21.88	homo-dimer	HHblits	X-ray	2.40Å	0.33	0.07	ATP(GTP)binding protein
1yr9.1.A	21.88	homo-dimer	HHblits	X-ray	2.80Å	0.33	0.07	ATP(GTP)binding protein
1yra.1.A	21.88	homo-dimer	HHblits	X-ray	2.30Å	0.33	0.07	ATP(GTP)binding protein
1yra.1.B	21.88	homo-dimer	HHblits	X-ray	2.30Å	0.33	0.07	ATP(GTP)binding protein
1yrb.1.A	21.88	homo-dimer	HHblits	X-ray	1.75Å	0.33	0.07	ATP(GTP)binding protein
2oxr.1.A	21.88	homo-dimer	HHblits	X-ray	2.40Å	0.33	0.07	ATP(GTP)binding protein
2ax4.1.A	24.24	homo-dimer	HHblits	X-ray	2.50Å	0.30	0.07	Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthetase 2
2qq0.1.A	21.21	homo-tetramer	HHblits	X-ray	1.50Å	0.30	0.07	Thymidine kinase
2qpo.1.B	21.21	homo-tetramer	HHblits	X-ray	1.95Å	0.30	0.07	Thymidine kinase
2qpo.1.D	21.21	homo-tetramer	HHblits	X-ray	1.95Å	0.30	0.07	Thymidine kinase
2qpo.1.A	21.21	homo-tetramer	HHblits	X-ray	1.95Å	0.30	0.07	Thymidine kinase
1odf.1.A	23.53	monomer	HHblits	X-ray	2.25Å	0.28	0.07	HYPOTHETICAL 33.3 KDA PROTEIN IN ADE3-SER2 INTERGENIC REGION
4bzq.1.A	31.25	homo-dimer	HHblits	X-ray	2.10Å	0.33	0.07	BIFUNCTIONAL ENZYME CYSN/CYSC
4d2i.1.A	29.03	homo-hexamer	HHblits	X-ray	2.84Å	0.35	0.06	HERA
4d2i.1.B	29.03	homo-hexamer	HHblits	X-ray	2.84Å	0.35	0.06	HERA
5l3q.1.B	17.14	hetero-oligomer	HHblits	X-ray	3.20Å	0.25	0.07	Signal recognition particle receptor subunit alpha
3k9h.1.A	18.18	homo-dimer	HHblits	X-ray	2.25Å	0.30	0.07	PF-32 protein
3k9g.1.A	18.18	homo-dimer	HHblits	X-ray	2.25Å	0.30	0.07	PF-32 protein
1mrn.1.A	21.88	homo-dimer	HHblits	X-ray	2.45Å	0.32	0.07	Thymidylate Kinase
1w2h.1.A	21.88	homo-dimer	HHblits	X-ray	2.00Å	0.32	0.07	THYMIDYLATE KINASE TMK
2ofw.1.B	35.48	homo-dimer	HHblits	X-ray	2.05Å	0.35	0.06	APS kinase domain of the PAPS synthetase 1
2ofw.1.A	35.48	homo-dimer	HHblits	X-ray	2.05Å	0.35	0.06	APS kinase domain of the PAPS synthetase 1
5tsg.1.A	24.24	homo-hexamer	HHblits	X-ray	3.40Å	0.30	0.07	Type IV pilus biogenesis ATPase PilB
5tsg.1.C	24.24	homo-hexamer	HHblits	X-ray	3.40Å	0.30	0.07	Type IV pilus biogenesis ATPase PilB
5tsh.1.C	24.24	homo-hexamer	HHblits	X-ray	2.30Å	0.30	0.07	Type IV pilus biogenesis ATPase PilB
5tsh.1.B	24.24	homo-hexamer	HHblits	X-ray	2.30Å	0.30	0.07	Type IV pilus biogenesis ATPase PilB
5tsh.1.F	24.24	homo-hexamer	HHblits	X-ray	2.30Å	0.30	0.07	Type IV pilus biogenesis ATPase PilB
3ibg.1.A	28.13	homo-dimer	HHblits	X-ray	3.20Å	0.32	0.07	ATPase, subunit of the Get complex
2pey.1.A	32.26	homo-dimer	HHblits	X-ray	1.88Å	0.34	0.06	Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthetase 1 (PAPS synthetase 1) (PAPSS 1) (Sulfurylase kinase 1) (SK1) (SK 1)
2pey.1.B	32.26	homo-dimer	HHblits	X-ray	1.88Å	0.34	0.06	Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthetase 1 (PAPS synthetase 1) (PAPSS 1) (Sulfurylase kinase 1) (SK1) (SK 1)
5lnk.1.Y	31.25	hetero-oligomer	HHblits	EM	3.90Å	0.32	0.07	Mitochondrial complex I, 42 kDa subunit
4rfv.1.A	32.26	homo-dimer	HHblits	X-ray	1.69Å	0.34	0.06	Bifunctional enzyme CysN/CysC
5it5.1.A	12.12	homo-hexamer	HHblits	X-ray	2.65Å	0.29	0.07	ATP binding motif-containing protein PilF
5it5.1.B	12.12	homo-hexamer	HHblits	X-ray	2.65Å	0.29	0.07	ATP binding motif-containing protein PilF
5it5.1.C	12.12	homo-hexamer	HHblits	X-ray	2.65Å	0.29	0.07	ATP binding motif-containing protein PilF
5it5.1.D	12.12	homo-hexamer	HHblits	X-ray	2.65Å	0.29	0.07	ATP binding motif-containing protein PilF
5it5.1.E	12.12	homo-hexamer	HHblits	X-ray	2.65Å	0.29	0.07	ATP binding motif-containing protein PilF
5it5.1.F	12.12	homo-hexamer	HHblits	X-ray	2.65Å	0.29	0.07	ATP binding motif-containing protein PilF
3n2i.1.A	25.00	homo-dimer	HHblits	X-ray	2.25Å	0.31	0.07	Thymidylate kinase
3ea0.1.A	17.65	homo-dimer	HHblits	X-ray	2.20Å	0.27	0.07	ATPase, ParA family
3ea0.1.B	17.65	homo-dimer	HHblits	X-ray	2.20Å	0.27	0.07	ATPase, ParA family
3jc8.36.A	25.00	monomer	HHblits	EM	NA	0.31	0.07	Type IV-A pilus assembly ATPase PilB
3jc8.37.A	25.00	monomer	HHblits	EM	NA	0.31	0.07	Type IV-A pilus assembly ATPase PilB
3hjn.1.A	33.33	homo-dimer	HHblits	X-ray	2.10Å	0.36	0.06	Thymidylate kinase
3hjn.1.B	33.33	homo-dimer	HHblits	X-ray	2.10Å	0.36	0.06	Thymidylate kinase
2qmo.1.A	26.67	homo-dimer	HHblits	X-ray	1.47Å	0.36	0.06	Dethiobiotin synthetase
3a4l.1.A	28.13	homo-dimer	HHblits	X-ray	1.80Å	0.31	0.07	L-seryl-tRNA(Sec) kinase
3a4l.1.B	28.13	homo-dimer	HHblits	X-ray	1.80Å	0.31	0.07	L-seryl-tRNA(Sec) kinase
3am1.1.C	28.13	homo-dimer	HHblits	X-ray	2.40Å	0.31	0.07	L-seryl-tRNA(Sec) kinase
3ld9.1.A	33.33	homo-tetramer	HHblits	X-ray	2.15Å	0.35	0.06	Thymidylate kinase
4unq.1.A	22.58	monomer	HHblits	X-ray	2.30Å	0.32	0.06	THYMIDYLATE KINASE
4unq.2.A	22.58	monomer	HHblits	X-ray	2.30Å	0.32	0.06	THYMIDYLATE KINASE
4unp.1.A	22.58	monomer	HHblits	X-ray	2.30Å	0.32	0.06	THYMIDYLATE KINASE
4unn.1.A	22.58	monomer	HHblits	X-ray	2.50Å	0.32	0.06	THYMIDYLATE KINASE
1nks.1.C	35.48	homo-trimer	HHblits	X-ray	2.57Å	0.32	0.06	ADENYLATE KINASE
1nks.1.B	35.48	homo-trimer	HHblits	X-ray	2.57Å	0.32	0.06	ADENYLATE KINASE
1nks.1.A	35.48	homo-trimer	HHblits	X-ray	2.57Å	0.32	0.06	ADENYLATE KINASE
4gmd.1.B	18.75	homo-dimer	HHblits	X-ray	1.98Å	0.29	0.07	Thymidylate kinase
4gmd.1.A	18.75	homo-dimer	HHblits	X-ray	1.98Å	0.29	0.07	Thymidylate kinase
4edh.1.A	18.75	homo-dimer	HHblits	X-ray	1.32Å	0.29	0.07	Thymidylate kinase
4e5u.1.A	18.75	homo-dimer	HHblits	X-ray	1.81Å	0.29	0.07	Thymidylate kinase
4e5u.1.B	18.75	homo-dimer	HHblits	X-ray	1.81Å	0.29	0.07	Thymidylate kinase
3uxm.1.A	18.75	monomer	HHblits	X-ray	1.95Å	0.29	0.07	Thymidylate kinase
3uxm.2.A	18.75	monomer	HHblits	X-ray	1.95Å	0.29	0.07	Thymidylate kinase
2w58.1.A	25.00	homo-dimer	HHblits	X-ray	2.50Å	0.29	0.07	PRIMOSOME COMPONENT (HELICASE LOADER)
2w58.1.B	25.00	homo-dimer	HHblits	X-ray	2.50Å	0.29	0.07	PRIMOSOME COMPONENT (HELICASE LOADER)
5xb5.1.A	26.67	homo-dimer	HHblits	X-ray	2.23Å	0.34	0.06	Thymidylate kinase
5xbh.1.A	26.67	homo-dimer	HHblits	X-ray	2.23Å	0.34	0.06	Thymidylate kinase
2woo.1.A	22.58	homo-dimer	HHblits	X-ray	3.01Å	0.31	0.06	ATPASE GET3
3iqx.1.A	29.03	homo-dimer	HHblits	X-ray	3.50Å	0.31	0.06	Tail-anchored protein targeting factor Get3
2hcb.1.A	30.00	homo-tetramer	HHblits	X-ray	3.51Å	0.33	0.06	Chromosomal replication initiator protein dnaA
2hcb.1.B	30.00	homo-tetramer	HHblits	X-ray	3.51Å	0.33	0.06	Chromosomal replication initiator protein dnaA
2hcb.1.C	30.00	homo-tetramer	HHblits	X-ray	3.51Å	0.33	0.06	Chromosomal replication initiator protein dnaA
2hcb.1.D	30.00	homo-tetramer	HHblits	X-ray	3.51Å	0.33	0.06	Chromosomal replication initiator protein dnaA
3v9p.1.A	25.81	monomer	HHblits	X-ray	1.90Å	0.31	0.06	Thymidylate kinase
1f48.1.A	18.75	monomer	HHblits	X-ray	2.30Å	0.28	0.07	ARSENITE-TRANSLOCATING ATPASE
2yof.1.A	18.75	monomer	HHblits	X-ray	1.82Å	0.27	0.07	THYMIDYLATE KINASE
2yof.3.A	18.75	monomer	HHblits	X-ray	1.82Å	0.27	0.07	THYMIDYLATE KINASE
2yog.1.A	18.75	monomer	HHblits	X-ray	1.50Å	0.27	0.07	THYMIDYLATE KINASE
2yog.2.A	18.75	monomer	HHblits	X-ray	1.50Å	0.27	0.07	THYMIDYLATE KINASE
2wwg.2.B	18.75	homo-dimer	HHblits	X-ray	2.40Å	0.27	0.07	THYMIDILATE KINASE, PUTATIVE
2wwg.2.A	18.75	homo-dimer	HHblits	X-ray	2.40Å	0.27	0.07	THYMIDILATE KINASE, PUTATIVE
1de0.1.A	34.48	homo-dimer	HHblits	X-ray	2.40Å	0.35	0.06	NITROGENASE IRON PROTEIN
1xcp.1.A	34.48	homo-dimer	HHblits	X-ray	3.20Å	0.35	0.06	Nitrogenase iron protein 1
1xcp.2.A	34.48	homo-dimer	HHblits	X-ray	3.20Å	0.35	0.06	Nitrogenase iron protein 1
1m34.1.E	34.48	hetero-oligomer	HHblits	X-ray	2.30Å	0.35	0.06	Nitrogenase Iron Protein 1
1m1y.1.E	34.48	hetero-oligomer	HHblits	X-ray	3.20Å	0.35	0.06	nitrogenase IRON protein 1
1m1y.1.F	34.48	hetero-oligomer	HHblits	X-ray	3.20Å	0.35	0.06	nitrogenase IRON protein 1
2afi.1.E	34.48	hetero-oligomer	HHblits	X-ray	3.10Å	0.35	0.06	Nitrogenase iron protein 1
2afh.1.E	34.48	hetero-oligomer	HHblits	X-ray	2.10Å	0.35	0.06	Nitrogenase iron protein 1
2afh.1.F	34.48	hetero-oligomer	HHblits	X-ray	2.10Å	0.35	0.06	Nitrogenase iron protein 1
1g5p.1.A	34.48	homo-dimer	HHblits	X-ray	2.20Å	0.35	0.06	NITROGENASE IRON PROTEIN
1g5p.1.B	34.48	homo-dimer	HHblits	X-ray	2.20Å	0.35	0.06	NITROGENASE IRON PROTEIN
1g1m.1.A	34.48	homo-dimer	HHblits	X-ray	2.25Å	0.35	0.06	NITROGENASE IRON PROTEIN
1g1m.1.B	34.48	homo-dimer	HHblits	X-ray	2.25Å	0.35	0.06	NITROGENASE IRON PROTEIN
1fp6.1.A	34.48	homo-dimer	HHblits	X-ray	2.15Å	0.35	0.06	NITROGENASE IRON PROTEIN
1nip.1.A	34.48	homo-dimer	HHblits	X-ray	2.90Å	0.35	0.06	NITROGENASE IRON PROTEIN
1nip.1.B	34.48	homo-dimer	HHblits	X-ray	2.90Å	0.35	0.06	NITROGENASE IRON PROTEIN
3uwo.1.A	19.35	monomer	HHblits	X-ray	1.70Å	0.29	0.06	Thymidylate kinase
3uwk.1.A	19.35	monomer	HHblits	X-ray	1.91Å	0.29	0.06	Thymidylate kinase
4bzp.1.A	34.48	homo-dimer	HHblits	X-ray	1.47Å	0.34	0.06	BIFUNCTIONAL ENZYME CYSN/CYSC
3igf.1.A	19.35	homo-dimer	HHblits	X-ray	2.00Å	0.29	0.06	All4481 protein
3igf.1.B	19.35	homo-dimer	HHblits	X-ray	2.00Å	0.29	0.06	All4481 protein
5bq5.1.A	19.35	monomer	HHblits	X-ray	2.10Å	0.29	0.06	Insertion sequence IS5376 putative ATP-binding protein
2pbr.1.B	27.59	homo-dimer	HHblits	X-ray	1.96Å	0.34	0.06	Thymidylate kinase
2pbr.1.A	27.59	homo-dimer	HHblits	X-ray	1.96Å	0.34	0.06	Thymidylate kinase
4s35.1.B	27.59	homo-dimer	HHblits	X-ray	1.55Å	0.34	0.06	Thymidylate kinase
5xb2.1.B	27.59	homo-dimer	HHblits	X-ray	2.16Å	0.34	0.06	Thymidylate kinase
1ki9.1.A	31.03	homo-trimer	HHblits	X-ray	2.76Å	0.33	0.06	adenylate kinase
1ki9.1.B	31.03	homo-trimer	HHblits	X-ray	2.76Å	0.33	0.06	adenylate kinase
1ki9.1.C	31.03	homo-trimer	HHblits	X-ray	2.76Å	0.33	0.06	adenylate kinase
1xd9.1.A	32.14	homo-dimer	HHblits	X-ray	2.80Å	0.34	0.06	Nitrogenase iron protein 1
1xdb.1.A	32.14	homo-dimer	HHblits	X-ray	2.80Å	0.34	0.06	Nitrogenase iron protein 1
4wza.1.E	32.14	hetero-oligomer	HHblits	X-ray	1.90Å	0.34	0.06	Nitrogenase iron protein 1
4wza.1.F	32.14	hetero-oligomer	HHblits	X-ray	1.90Å	0.34	0.06	Nitrogenase iron protein 1
2c8v.1.A	32.14	monomer	HHblits	X-ray	2.50Å	0.34	0.06	NITROGENASE IRON PROTEIN 1
5he9.1.A	20.00	hetero-oligomer	HHblits	X-ray	1.90Å	0.28	0.06	Helicase loader
5he8.2.B	20.00	homo-dimer	HHblits	X-ray	2.60Å	0.28	0.06	Helicase loader
5he8.2.A	20.00	homo-dimer	HHblits	X-ray	2.60Å	0.28	0.06	Helicase loader
5he8.6.B	20.00	homo-dimer	HHblits	X-ray	2.60Å	0.28	0.06	Helicase loader
5he8.3.B	20.00	homo-dimer	HHblits	X-ray	2.60Å	0.28	0.06	Helicase loader
5he8.3.A	20.00	homo-dimer	HHblits	X-ray	2.60Å	0.28	0.06	Helicase loader
5he8.6.A	20.00	homo-dimer	HHblits	X-ray	2.60Å	0.28	0.06	Helicase loader
5he8.5.A	20.00	homo-dimer	HHblits	X-ray	2.60Å	0.28	0.06	Helicase loader
5he8.5.B	20.00	homo-dimer	HHblits	X-ray	2.60Å	0.28	0.06	Helicase loader
5he8.1.A	20.00	homo-dimer	HHblits	X-ray	2.60Å	0.28	0.06	Helicase loader
5he8.4.A	20.00	homo-dimer	HHblits	X-ray	2.60Å	0.28	0.06	Helicase loader
5he8.4.B	20.00	homo-dimer	HHblits	X-ray	2.60Å	0.28	0.06	Helicase loader
5he8.1.B	20.00	homo-dimer	HHblits	X-ray	2.60Å	0.28	0.06	Helicase loader
1cp2.1.A	25.00	homo-dimer	HHblits	X-ray	1.93Å	0.33	0.06	NITROGENASE IRON PROTEIN
1cp2.1.B	25.00	homo-dimer	HHblits	X-ray	1.93Å	0.33	0.06	NITROGENASE IRON PROTEIN
3ec2.1.A	24.14	monomer	HHblits	X-ray	2.70Å	0.30	0.06	DNA replication protein DnaC
4ba6.1.A	25.93	monomer	HHblits	X-ray	1.42Å	0.35	0.06	ENDOGLUCANASE CEL5A
5afe.1.A	25.93	monomer	HHblits	X-ray	2.60Å	0.35	0.06	ENDOGLUCANASE CEL5A
1kht.1.A	37.04	homo-trimer	HHblits	X-ray	2.50Å	0.34	0.06	adenylate kinase
1kht.1.B	37.04	homo-trimer	HHblits	X-ray	2.50Å	0.34	0.06	adenylate kinase
1kht.1.C	37.04	homo-trimer	HHblits	X-ray	2.50Å	0.34	0.06	adenylate kinase
2xzp.1.A	28.57	homo-trimer	HHblits	X-ray	2.72Å	0.31	0.06	REGULATOR OF NONSENSE TRANSCRIPTS 1
2xzo.1.A	28.57	monomer	HHblits	X-ray	2.39Å	0.31	0.06	REGULATOR OF NONSENSE TRANSCRIPTS 1
3tqc.1.A	25.93	homo-dimer	HHblits	X-ray	2.30Å	0.33	0.06	Pantothenate kinase
2plr.1.A	29.63	homo-dimer	HHblits	X-ray	1.60Å	0.33	0.06	Probable thymidylate kinase
2plr.1.B	29.63	homo-dimer	HHblits	X-ray	1.60Å	0.33	0.06	Probable thymidylate kinase
4rzu.1.A	29.63	homo-dimer	HHblits	X-ray	2.80Å	0.33	0.06	Probable thymidylate kinase
4rzu.1.B	29.63	homo-dimer	HHblits	X-ray	2.80Å	0.33	0.06	Probable thymidylate kinase
4rzx.1.B	29.63	homo-dimer	HHblits	X-ray	2.30Å	0.33	0.06	Probable thymidylate kinase
3h86.2.A	34.62	homo-trimer	HHblits	X-ray	2.50Å	0.35	0.05	Adenylate kinase
3h86.1.B	34.62	homo-trimer	HHblits	X-ray	2.50Å	0.35	0.05	Adenylate kinase
3h86.1.C	34.62	homo-trimer	HHblits	X-ray	2.50Å	0.35	0.05	Adenylate kinase
3h86.1.A	34.62	homo-trimer	HHblits	X-ray	2.50Å	0.35	0.05	Adenylate kinase
3kjg.2.A	21.43	homo-dimer	HHblits	X-ray	2.30Å	0.29	0.06	CO dehydrogenase/acetyl-CoA synthase complex, accessory protein CooC
3kjg.1.A	21.43	monomer	HHblits	X-ray	2.30Å	0.29	0.06	CO dehydrogenase/acetyl-CoA synthase complex, accessory protein CooC
3kji.1.A	21.43	homo-dimer	HHblits	X-ray	2.13Å	0.29	0.06	CO dehydrogenase/acetyl-CoA synthase complex, accessory protein CooC
3kji.2.A	21.43	homo-dimer	HHblits	X-ray	2.13Å	0.29	0.06	CO dehydrogenase/acetyl-CoA synthase complex, accessory protein CooC
3kjh.1.A	21.43	homo-dimer	HHblits	X-ray	1.90Å	0.29	0.06	CO dehydrogenase/acetyl-CoA synthase complex, accessory protein CooC
3kje.1.A	21.43	monomer	HHblits	X-ray	2.30Å	0.29	0.06	CO dehydrogenase/acetyl-CoA synthase complex, accessory protein CooC
1esm.1.A	18.52	homo-dimer	HHblits	X-ray	2.50Å	0.31	0.06	PANTOTHENATE KINASE
1esm.1.B	18.52	homo-dimer	HHblits	X-ray	2.50Å	0.31	0.06	PANTOTHENATE KINASE
1esn.1.A	18.52	homo-dimer	HHblits	X-ray	2.60Å	0.31	0.06	PANTOTHENATE KINASE
1esn.1.B	18.52	homo-dimer	HHblits	X-ray	2.60Å	0.31	0.06	PANTOTHENATE KINASE
1esn.2.B	18.52	homo-dimer	HHblits	X-ray	2.60Å	0.31	0.06	PANTOTHENATE KINASE
3avo.1.A	22.22	homo-dimer	HHblits	X-ray	2.55Å	0.31	0.06	Pantothenate kinase
4ypn.1.A	24.00	monomer	HHblits	X-ray	2.07Å	0.36	0.05	Lon protease
2qby.1.C	30.77	hetero-oligomer	HHblits	X-ray	3.35Å	0.32	0.05	Cell division control protein 6 homolog 1
2ypj.1.A	24.00	monomer	HHblits	X-ray	2.35Å	0.34	0.05	ENDOGLUCANASE CEL5A
2i3b.1.A	28.00	monomer	HHblits	NMR	NA	0.34	0.05	Human Cancer-Related NTPase
2eww.1.A	28.00	homo-hexamer	HHblits	X-ray	3.20Å	0.34	0.05	twitching motility protein PilT
4aek.1.A	29.17	monomer	HHblits	X-ray	1.75Å	0.36	0.05	ENDOGLUCANASE CEL5A
1p9r.1.A	32.00	monomer	HHblits	X-ray	2.50Å	0.33	0.05	General secretion pathway protein E
1y63.1.A	43.48	monomer	HHblits	X-ray	1.70Å	0.39	0.05	Lmaj004144AAA protein
1e94.3.A	34.78	homo-hexamer	HHblits	X-ray	2.80Å	0.39	0.05	HEAT SHOCK PROTEIN HSLU
4pht.1.B	32.00	hetero-oligomer	HHblits	X-ray	2.83Å	0.33	0.05	General secretory pathway protein E
4kss.1.A	32.00	homo-hexamer	HHblits	X-ray	7.58Å	0.33	0.05	Type II secretion system protein E, hemolysin-coregulated protein
4kss.1.B	32.00	homo-hexamer	HHblits	X-ray	7.58Å	0.33	0.05	Type II secretion system protein E, hemolysin-coregulated protein
4kss.1.C	32.00	homo-hexamer	HHblits	X-ray	7.58Å	0.33	0.05	Type II secretion system protein E, hemolysin-coregulated protein
4kss.1.D	32.00	homo-hexamer	HHblits	X-ray	7.58Å	0.33	0.05	Type II secretion system protein E, hemolysin-coregulated protein
4kss.1.E	32.00	homo-hexamer	HHblits	X-ray	7.58Å	0.33	0.05	Type II secretion system protein E, hemolysin-coregulated protein
4kss.1.F	32.00	homo-hexamer	HHblits	X-ray	7.58Å	0.33	0.05	Type II secretion system protein E, hemolysin-coregulated protein
1q3t.1.A	25.00	monomer	HHblits	NMR	NA	0.35	0.05	Cytidylate kinase
3hr7.1.A	29.17	homo-dimer	HHblits	X-ray	1.80Å	0.35	0.05	Shikimate kinase
3hr7.1.B	29.17	homo-dimer	HHblits	X-ray	1.80Å	0.35	0.05	Shikimate kinase
1zui.1.A	29.17	monomer	HHblits	X-ray	2.30Å	0.35	0.05	Shikimate kinase
1zuh.1.A	29.17	monomer	HHblits	X-ray	1.80Å	0.35	0.05	Shikimate kinase
3muf.1.A	29.17	monomer	HHblits	X-ray	2.30Å	0.35	0.05	Shikimate kinase
1tmk.1.A	29.17	homo-dimer	HHblits	X-ray	2.10Å	0.34	0.05	THYMIDYLATE KINASE
3tmk.1.A	29.17	homo-dimer	HHblits	X-ray	2.00Å	0.34	0.05	THYMIDYLATE KINASE
3tmk.1.B	29.17	homo-dimer	HHblits	X-ray	2.00Å	0.34	0.05	THYMIDYLATE KINASE
3mrs.1.A	29.17	monomer	HHblits	X-ray	2.40Å	0.34	0.05	Shikimate kinase
4ksr.1.A	33.33	homo-hexamer	HHblits	X-ray	4.20Å	0.34	0.05	Type II secretion system protein E, Hemolysin-coregulated protein
4ksr.1.B	33.33	homo-hexamer	HHblits	X-ray	4.20Å	0.34	0.05	Type II secretion system protein E, Hemolysin-coregulated protein
4ksr.1.C	33.33	homo-hexamer	HHblits	X-ray	4.20Å	0.34	0.05	Type II secretion system protein E, Hemolysin-coregulated protein
5uj7.1.A	25.00	hetero-oligomer	HHblits	X-ray	3.39Å	0.33	0.05	Origin recognition complex subunit 1
5uj7.2.A	25.00	hetero-oligomer	HHblits	X-ray	3.39Å	0.33	0.05	Origin recognition complex subunit 1
2v54.1.A	25.00	homo-dimer	HHblits	X-ray	2.40Å	0.33	0.05	THYMIDYLATE KINASE
1e6c.1.A	34.78	monomer	HHblits	X-ray	1.80Å	0.35	0.05	SHIKIMATE KINASE
2qby.1.D	25.00	hetero-oligomer	HHblits	X-ray	3.35Å	0.32	0.05	Cell division control protein 6 homolog 3
1we2.1.A	26.09	monomer	HHblits	X-ray	2.30Å	0.34	0.05	Shikimate kinase
1zyu.1.A	26.09	monomer	HHblits	X-ray	2.90Å	0.34	0.05	Shikimate kinase
3baf.1.A	26.09	monomer	HHblits	X-ray	2.25Å	0.34	0.05	Shikimate kinase
2g1j.1.A	26.09	monomer	HHblits	X-ray	2.00Å	0.34	0.05	Shikimate kinase
2g1j.2.A	26.09	monomer	HHblits	X-ray	2.00Å	0.34	0.05	Shikimate kinase
2dfn.1.A	26.09	monomer	HHblits	X-ray	1.93Å	0.34	0.05	Shikimate kinase
2dft.1.A	26.09	homo-tetramer	HHblits	X-ray	2.80Å	0.34	0.05	Shikimate kinase
2dft.1.B	26.09	homo-tetramer	HHblits	X-ray	2.80Å	0.34	0.05	Shikimate kinase
2dft.1.C	26.09	homo-tetramer	HHblits	X-ray	2.80Å	0.34	0.05	Shikimate kinase
4bqs.2.A	26.09	monomer	HHblits	X-ray	2.15Å	0.34	0.05	SHIKIMATE KINASE
4bqs.3.A	26.09	monomer	HHblits	X-ray	2.15Å	0.34	0.05	SHIKIMATE KINASE
4ttq.1.A	27.27	monomer	HHblits	X-ray	2.20Å	0.38	0.05	Dephospho-CoA kinase
4ttp.1.A	27.27	monomer	HHblits	X-ray	2.20Å	0.38	0.05	Dephospho-CoA kinase
3d8b.1.A	36.36	homo-dimer	HHblits	X-ray	2.00Å	0.38	0.05	Fidgetin-like protein 1
3d8b.1.B	36.36	homo-dimer	HHblits	X-ray	2.00Å	0.38	0.05	Fidgetin-like protein 1
5ujm.1.D	20.83	hetero-oligomer	HHblits	EM	NA	0.30	0.05	Origin recognition complex subunit 4
5uj7.2.B	20.83	hetero-oligomer	HHblits	X-ray	3.39Å	0.30	0.05	Origin recognition complex subunit 4
1uf9.1.A	38.10	monomer	HHblits	X-ray	2.80Å	0.40	0.04	TT1252 protein
1uf9.2.A	38.10	monomer	HHblits	X-ray	2.80Å	0.40	0.04	TT1252 protein
1uf9.3.A	38.10	monomer	HHblits	X-ray	2.80Å	0.40	0.04	TT1252 protein
4y0a.1.A	36.36	monomer	HHblits	X-ray	1.91Å	0.35	0.05	Shikimate kinase
4e22.1.A	31.82	monomer	HHblits	X-ray	2.32Å	0.35	0.05	Cytidylate kinase
1g6o.1.A	21.74	homo-hexamer	HHblits	X-ray	2.50Å	0.32	0.05	CAG-ALPHA
2pt7.1.A	21.74	hetero-oligomer	HHblits	X-ray	2.40Å	0.32	0.05	Cag-alfa
2pt7.1.B	21.74	hetero-oligomer	HHblits	X-ray	2.40Å	0.32	0.05	Cag-alfa
2pt7.1.C	21.74	hetero-oligomer	HHblits	X-ray	2.40Å	0.32	0.05	Cag-alfa
1nlz.1.A	21.74	homo-hexamer	HHblits	X-ray	3.00Å	0.32	0.05	virB11 homolog
1nlz.1.B	21.74	homo-hexamer	HHblits	X-ray	3.00Å	0.32	0.05	virB11 homolog
1nlz.1.C	21.74	homo-hexamer	HHblits	X-ray	3.00Å	0.32	0.05	virB11 homolog
3iim.1.A	36.36	monomer	HHblits	X-ray	2.00Å	0.35	0.05	Coilin-interacting nuclear ATPase protein
5jzv.1.A	36.36	monomer	HHblits	X-ray	2.07Å	0.35	0.05	Adenylate kinase isoenzyme 6
2iys.1.A	27.27	monomer	HHblits	X-ray	1.40Å	0.35	0.05	SHIKIMATE KINASE
2iyv.1.A	27.27	monomer	HHblits	X-ray	1.35Å	0.35	0.05	SHIKIMATE KINASE
2iyx.1.A	27.27	monomer	HHblits	X-ray	1.49Å	0.35	0.05	SHIKIMATE KINASE
2iyq.1.A	27.27	monomer	HHblits	X-ray	1.80Å	0.35	0.05	SHIKIMATE KINASE
2iyr.1.A	27.27	monomer	HHblits	X-ray	1.98Å	0.35	0.05	SHIKIMATE KINASE
2iyr.2.A	27.27	monomer	HHblits	X-ray	1.98Å	0.35	0.05	SHIKIMATE KINASE
3vaa.1.A	36.36	monomer	HHblits	X-ray	1.70Å	0.35	0.05	Shikimate kinase
3vaa.2.A	36.36	monomer	HHblits	X-ray	1.70Å	0.35	0.05	Shikimate kinase
3vaa.3.A	36.36	monomer	HHblits	X-ray	1.70Å	0.35	0.05	Shikimate kinase
1kag.1.A	31.82	monomer	HHblits	X-ray	2.05Å	0.35	0.05	Shikimate kinase I
1kag.2.A	31.82	monomer	HHblits	X-ray	2.05Å	0.35	0.05	Shikimate kinase I
3n2e.1.A	31.82	monomer	HHblits	X-ray	2.53Å	0.35	0.05	Shikimate kinase
3trf.1.A	36.36	homo-dimer	HHblits	X-ray	2.60Å	0.35	0.05	Shikimate kinase
3hdt.1.A	21.74	homo-dimer	HHblits	X-ray	2.79Å	0.30	0.05	putative kinase
3hdt.1.B	21.74	homo-dimer	HHblits	X-ray	2.79Å	0.30	0.05	putative kinase
2pt5.2.A	33.33	monomer	HHblits	X-ray	2.10Å	0.37	0.04	Shikimate kinase
2pt5.1.A	33.33	monomer	HHblits	X-ray	2.10Å	0.37	0.04	Shikimate kinase
2pt5.3.A	33.33	monomer	HHblits	X-ray	2.10Å	0.37	0.04	Shikimate kinase
2pt5.4.A	33.33	monomer	HHblits	X-ray	2.10Å	0.37	0.04	Shikimate kinase
5vhj.1.E	33.33	hetero-oligomer	HHblits	EM	NA	0.33	0.04	26S proteasome regulatory subunit 10B
5vhm.1.E	33.33	hetero-oligomer	HHblits	EM	NA	0.33	0.04	26S proteasome regulatory subunit 10B
5vho.1.E	33.33	hetero-oligomer	HHblits	EM	NA	0.33	0.04	26S proteasome regulatory subunit 10B
5vhp.1.E	33.33	hetero-oligomer	HHblits	EM	NA	0.33	0.04	26S proteasome regulatory subunit 10B
5vhq.1.E	33.33	hetero-oligomer	HHblits	EM	NA	0.33	0.04	26S proteasome regulatory subunit 10B
5vhr.1.E	33.33	hetero-oligomer	HHblits	EM	NA	0.33	0.04	26S proteasome regulatory subunit 10B
4c8a.1.A	31.25	homo-dimer	HHblits	X-ray	2.70Å	0.36	0.03	E3 UBIQUITIN-PROTEIN LIGASE ZNRF3
4c86.1.B	31.25	homo-dimer	HHblits	X-ray	2.00Å	0.36	0.03	E3 UBIQUITIN-PROTEIN LIGASE ZNRF3
4c86.1.A	31.25	homo-dimer	HHblits	X-ray	2.00Å	0.36	0.03	E3 UBIQUITIN-PROTEIN LIGASE ZNRF3
4c8a.2.A	31.25	homo-dimer	HHblits	X-ray	2.70Å	0.36	0.03	E3 UBIQUITIN-PROTEIN LIGASE ZNRF3
4c8a.2.B	31.25	homo-dimer	HHblits	X-ray	2.70Å	0.36	0.03	E3 UBIQUITIN-PROTEIN LIGASE ZNRF3
4c8c.1.A	31.25	homo-dimer	HHblits	X-ray	2.40Å	0.36	0.03	E3 UBIQUITIN-PROTEIN LIGASE ZNRF3
4c8f.1.A	31.25	homo-dimer	HHblits	X-ray	2.69Å	0.36	0.03	E3 UBIQUITIN-PROTEIN LIGASE ZNRF3
4c8f.1.B	31.25	homo-dimer	HHblits	X-ray	2.69Å	0.36	0.03	E3 UBIQUITIN-PROTEIN LIGASE ZNRF3
4c8f.2.A	31.25	homo-dimer	HHblits	X-ray	2.69Å	0.36	0.03	E3 UBIQUITIN-PROTEIN LIGASE ZNRF3
4c8f.2.B	31.25	homo-dimer	HHblits	X-ray	2.69Å	0.36	0.03	E3 UBIQUITIN-PROTEIN LIGASE ZNRF3
4c9a.1.C	31.25	hetero-oligomer	HHblits	X-ray	2.40Å	0.36	0.03	E3 UBIQUITIN-PROTEIN LIGASE ZNRF3
4c9e.1.A	31.25	hetero-oligomer	HHblits	X-ray	3.00Å	0.36	0.03	E3 UBIQUITIN-PROTEIN LIGASE ZNRF3
4ufs.1.C	31.25	hetero-oligomer	HHblits	X-ray	4.80Å	0.36	0.03	E3 UBIQUITIN-PROTEIN LIGASE ZNRF3