SWISS-MODEL | Workspace | Model Results

SWISS-MODEL Homology Modelling Report

Model Building Report

This document lists the results for the homology modelling project "P56068" submitted to SWISS-MODEL workspace on Oct. 17, 2017, 7:12 p.m..The submitted primary amino acid sequence is given in Table T1.

If you use any results in your research, please cite the relevant publications:

Marco Biasini; Stefan Bienert; Andrew Waterhouse; Konstantin Arnold; Gabriel Studer; Tobias Schmidt; Florian Kiefer; Tiziano Gallo Cassarino; Martino Bertoni; Lorenza Bordoli; Torsten Schwede. (2014). SWISS-MODEL: modelling protein tertiary and quaternary structure using evolutionary information. Nucleic Acids Research (1 July 2014) 42 (W1): W252-W258; doi: 10.1093/nar/gku340.
Arnold, K., Bordoli, L., Kopp, J. and Schwede, T. (2006) The SWISS-MODEL workspace: a web-based environment for protein structure homology modelling. Bioinformatics, 22, 195-201.
Benkert, P., Biasini, M. and Schwede, T. (2011) Toward the estimation of the absolute quality of individual protein structure models. Bioinformatics, 27, 343-350

Results

The SWISS-MODEL template library (SMTL version 2017-10-11, PDB release 2017-10-06) was searched with Blast (Altschul et al., 1997) and HHBlits (Remmert, et al., 2011) for evolutionary related structures matching the target sequence in Table T1. For details on the template search, see Materials and Methods. Overall 768 templates were found (Table T2).

Models

The following models were built (see Materials and Methods "Model Building"):

Model #01	File	Built with	Oligo-State	Ligands	GMQE	QMEAN
	PDB	ProMod3 Version 1.0.2.	homo-dimer (matching prediction)	2 x DGL: D-GLUTAMIC ACID;	0.98	0.03

QMEAN	0.03
Cβ	2.52
All Atom	2.14
Solvation	1.69
Torsion	-0.81

Template	Seq Identity	Oligo-state	Found by	Method	Resolution	Seq Similarity	Range	Coverage	Description
5w1q.1.A	96.08	homo-dimer	HHblits	X-ray	1.95Å	0.59	1 - 254	1.00	Glutamate racemase

Ligand	Added to Model	Description
DGL	✓	D-GLUTAMIC ACID
DGL	✓	D-GLUTAMIC ACID
GOL	✕ - Not biologically relevant.	GLYCEROL
GOL	✕ - Not biologically relevant.	GLYCEROL
GOL	✕ - Not biologically relevant.	GLYCEROL
GOL	✕ - Not biologically relevant.	GLYCEROL
GOL	✕ - Not biologically relevant.	GLYCEROL

Target    MKIGVFDSGVGGFSVLKSLLKAQLFDEIIYYGDSARVPYGTKDPTTIKQFGLEALDFFKPHQIKLLIVACNTASALALEE
5w1q.1.A  MKIGVFDSGVGGFSVLKSLLKAQIFDKIIYYGDSARVPYGTKDPTTIKQFGLEALDFFKPHKIELLIVACNTASALALEE

Target    MQKHSKIPVVGVIEPSILAIKRQVKDKNAPILVLGTKATIQSNAYDNALKQQGYLNVSHLATSLFVPLIEESILEGELLE
5w1q.1.A  MQKHSKIPIVGVIEPSILAIKQQVKDKNAPILVLGTKATIQSNAYDNALKQQGYLNVSHLATSLFVPLIEENILEGELLE

Target    TCMRYYFTPLEILPEVVILGCTHFPLIAQKIEGYFMEHFALSTPPLLIHSGDAIVEYLQQNYALKKNACAFPKVEFHASG
5w1q.1.A  TCMRYYFTPLEILPEVVILGCTHFPLIAQKIEGYFMEHFALSTPPLLIHSGDAIVEYLQQKYTLKKNACTFPKVEFHASG

Target    DVVWLEKQAKEWLKL
5w1q.1.A  DVVWLEKQAKEWLKL

Model #02	File	Built with	Oligo-State	Ligands	GMQE	QMEAN
	PDB	ProMod3 Version 1.0.2.	MONOMER	None	0.10	-3.30

QMEAN	-3.30
Cβ	-3.79
All Atom	-1.21
Solvation	-2.36
Torsion	-1.92

Template	Seq Identity	Oligo-state	Found by	Method	Resolution	Seq Similarity	Range	Coverage	Description
1pxw.1.A	13.70	monomer	HHblits	X-ray	1.94Å	0.26	55 - 131	0.29	LSU ribosomal protein L7AE

The template contained no ligands.

Target    MKIGVFDSGVGGFSVLKSLLKAQLFDEIIYYGDSARVPYGTKDPTTIKQFGLEALDFFKPHQIKLLIVACNTASA---LA
1pxw.1.A  ------------------------------------------------------TKAVERGQAKLVIIAEDVDPEEIVAH

Target    LEEMQKHSKIPVVGVIEPSILAIKRQVKDKNA-PILVLG-TKATIQSNAYDNALKQQGYLNVSHLATSLFVPLIEESILE
1pxw.1.A  LPPLCEEKEIPYIYVP--SKKELGAA--AGIEVAAASVAIIEPGKARDLVEEIAMK------------------------

Target    GELLETCMRYYFTPLEILPEVVILGCTHFPLIAQKIEGYFMEHFALSTPPLLIHSGDAIVEYLQQNYALKKNACAFPKVE
1pxw.1.A  --------------------------------------------------------------------------------

Target    FHASGDVVWLEKQAKEWLKL
1pxw.1.A  --------------------

Materials and Methods

Template Search

Template search with Blast and HHBlits has been performed against the SWISS-MODEL template library (SMTL, last update: 2017-10-11, last included PDB release: 2017-10-06).

The target sequence was searched with BLAST (Altschul et al., 1997) against the primary amino acid sequence contained in the SMTL. A total of 37 templates were found.

An initial HHblits profile has been built using the procedure outlined in (Remmert, et al., 2011), followed by 1 iteration of HHblits against NR20. The obtained profile has then be searched against all profiles of the SMTL. A total of 749 templates were found.

Template Selection

For each identified template, the template's quality has been predicted from features of the target-template alignment. The templates with the highest quality have then been selected for model building.

Model Building

Models are built based on the target-template alignment using ProMod3. Coordinates which are conserved between the target and the template are copied from the template to the model. Insertions and deletions are remodelled using a fragment library. Side chains are then rebuilt. Finally, the geometry of the resulting model is regularized by using a force field. In case loop modelling with ProMod3 fails, an alternative model is built with PROMOD-II (Guex, et al., 1997).

Model Quality Estimation

The global and per-residue model quality has been assessed using the QMEAN scoring function (Benkert, et al., 2011) . For improved performance, weights of the individual QMEAN terms have been trained specifically for SWISS-MODEL.

Ligand Modelling

Ligands present in the template structure are transferred by homology to the model when the following criteria are met (Gallo -Casserino, to be published): (a) The ligands are annotated as biologically relevant in the template library, (b) the ligand is in contact with the model, (c) the ligand is not clashing with the protein, (d) the residues in contact with the ligand are conserved between the target and the template. If any of these four criteria is not satisfied, a certain ligand will not be included in the model. The model summary includes information on why and which ligand has not been included.

Oligomeric State Conservation

Homo-oligomeric structure of the target protein is predicted based on the analysis of pairwise interfaces of the identified template structures. For each relevant interface between polypeptide chains (interfaces with more than 10 residue-residue interactions), the QscoreOligomer (Mariani et al., 2011) is predicted from features such as similarity to target and frequency of observing this interface in the identified templates (Kiefer, Bertoni, Biasini, to be published). The prediction is performed with a random forest regressor using these features as input parameters to predict the probability of conservation for each interface. The QscoreOligomer of the whole complex is then calculated as the weight-averaged QscoreOligomer of the interfaces. The oligomeric state of the target is predicted to be the same as in the template when QscoreOligomer is predicted to be higher or equal to 0.5.

References

Altschul, S.F., Madden, T.L., Schaffer, A.A., Zhang, J., Zhang, Z., Miller, W. and Lipman, D.J. (1997) Gapped BLAST and PSI-BLAST: a new generation of protein database search programs. Nucleic Acids Res, 25, 3389-3402.
Remmert, M., Biegert, A., Hauser, A. and Soding, J. (2012) HHblits: lightning-fast iterative protein sequence searching by HMM-HMM alignment. Nat Methods, 9, 173-175.
Guex, N. and Peitsch, M.C. (1997) SWISS-MODEL and the Swiss-PdbViewer: an environment for comparative protein modeling. Electrophoresis, 18, 2714-2723.
Sali, A. and Blundell, T.L. (1993) Comparative protein modelling by satisfaction of spatial restraints. J Mol Biol, 234, 779-815.
Benkert, P., Biasini, M. and Schwede, T. (2011) Toward the estimation of the absolute quality of individual protein structure models. Bioinformatics, 27, 343-350.
Mariani, V., Kiefer, F., Schmidt, T., Haas, J. and Schwede, T. (2011) Assessment of template based protein structure predictions in CASP9. Proteins, 79 Suppl 10, 37-58.

Table T1:

Primary amino acid sequence for which templates were searched and models were built.

MKIGVFDSGVGGFSVLKSLLKAQLFDEIIYYGDSARVPYGTKDPTTIKQFGLEALDFFKPHQIKLLIVACNTASALALEEMQKHSKIPVVGVIEPSILAI
KRQVKDKNAPILVLGTKATIQSNAYDNALKQQGYLNVSHLATSLFVPLIEESILEGELLETCMRYYFTPLEILPEVVILGCTHFPLIAQKIEGYFMEHFA
LSTPPLLIHSGDAIVEYLQQNYALKKNACAFPKVEFHASGDVVWLEKQAKEWLKL

Table T2:

Template	Seq Identity	Oligo-state	Found by	Method	Resolution	Seq Similarity	Coverage	Description
5w1q.1.A	96.08	homo-dimer	HHblits	X-ray	1.95Å	0.59	1.00	Glutamate racemase
2jfy.1.B	93.73	homo-dimer	HHblits	X-ray	1.90Å	0.58	1.00	GLUTAMATE RACEMASE
2jfz.1.A	93.73	homo-dimer	HHblits	X-ray	1.86Å	0.58	1.00	GLUTAMATE RACEMASE
2jfx.1.A	93.73	homo-dimer	HHblits	X-ray	2.30Å	0.58	1.00	GLUTAMATE RACEMASE
2jfx.1.B	93.73	homo-dimer	HHblits	X-ray	2.30Å	0.58	1.00	GLUTAMATE RACEMASE
2jfy.1.A	93.73	homo-dimer	HHblits	X-ray	1.90Å	0.58	1.00	GLUTAMATE RACEMASE
4b1f.1.B	93.73	homo-dimer	HHblits	X-ray	2.05Å	0.58	1.00	GLUTAMATE RACEMASE
2w4i.1.A	93.73	homo-tetramer	HHblits	X-ray	1.87Å	0.58	1.00	GLUTAMATE RACEMASE
3uho.1.A	56.33	monomer	BLAST	X-ray	2.20Å	0.45	0.96	Glutamate racemase
3uhf.2.A	56.33	monomer	BLAST	X-ray	1.83Å	0.45	0.96	Glutamate racemase
3uhp.1.A	56.33	monomer	BLAST	X-ray	2.79Å	0.45	0.96	Glutamate racemase
3uho.1.A	54.10	monomer	HHblits	X-ray	2.20Å	0.44	0.96	Glutamate racemase
3uhf.2.A	54.10	monomer	HHblits	X-ray	1.83Å	0.44	0.96	Glutamate racemase
3uhp.1.A	54.10	monomer	HHblits	X-ray	2.79Å	0.44	0.96	Glutamate racemase
1zuw.1.A	35.51	homo-dimer	HHblits	X-ray	1.75Å	0.37	0.96	glutamate racemase 1
1zuw.1.B	35.51	homo-dimer	HHblits	X-ray	1.75Å	0.37	0.96	glutamate racemase 1
2vvt.1.A	36.73	homo-dimer	HHblits	X-ray	1.65Å	0.37	0.96	GLUTAMATE RACEMASE
2vvt.1.B	36.73	homo-dimer	HHblits	X-ray	1.65Å	0.37	0.96	GLUTAMATE RACEMASE
2jfq.1.A	35.10	homo-dimer	HHblits	X-ray	2.15Å	0.37	0.96	GLUTAMATE RACEMASE
2jfq.1.B	35.10	homo-dimer	HHblits	X-ray	2.15Å	0.37	0.96	GLUTAMATE RACEMASE
2gzm.1.A	35.10	homo-dimer	HHblits	X-ray	1.99Å	0.37	0.96	Glutamate racemase
2gzm.1.B	35.10	homo-dimer	HHblits	X-ray	1.99Å	0.37	0.96	Glutamate racemase
2gzm.2.B	35.10	homo-dimer	HHblits	X-ray	1.99Å	0.37	0.96	Glutamate racemase
2jfp.1.A	36.89	homo-dimer	HHblits	X-ray	1.98Å	0.37	0.96	GLUTAMATE RACEMASE
2jfo.1.B	36.89	homo-dimer	HHblits	X-ray	2.50Å	0.37	0.96	GLUTAMATE RACEMASE
3hfr.1.A	34.29	homo-dimer	HHblits	X-ray	2.30Å	0.37	0.96	Glutamate racemase
3hfr.1.B	34.29	homo-dimer	HHblits	X-ray	2.30Å	0.37	0.96	Glutamate racemase
2jfw.1.A	34.02	homo-dimer	HHblits	X-ray	2.00Å	0.36	0.96	GLUTAMATE RACEMASE
1b73.1.A	37.08	homo-dimer	HHblits	X-ray	2.30Å	0.38	0.94	GLUTAMATE RACEMASE
2dwu.1.A	33.61	homo-dimer	HHblits	X-ray	1.60Å	0.36	0.96	Glutamate racemase
2dwu.2.A	33.61	homo-dimer	HHblits	X-ray	1.60Å	0.36	0.96	Glutamate racemase
2ohv.1.A	29.80	homo-dimer	HHblits	X-ray	2.50Å	0.35	0.96	Glutamate Racemase
2ohg.1.A	29.80	homo-dimer	HHblits	X-ray	2.50Å	0.35	0.96	Glutamate racemase
2oho.1.A	29.80	homo-dimer	HHblits	X-ray	2.25Å	0.35	0.96	Glutamate Racemase
2oho.1.B	29.80	homo-dimer	HHblits	X-ray	2.25Å	0.35	0.96	Glutamate Racemase
3out.1.A	32.92	homo-hexamer	HHblits	X-ray	1.65Å	0.36	0.94	Glutamate racemase
5ijw.1.A	28.98	homo-dimer	HHblits	X-ray	1.76Å	0.34	0.96	Glutamate racemase
5ijw.1.B	28.98	homo-dimer	HHblits	X-ray	1.76Å	0.34	0.96	Glutamate racemase
5hj7.1.A	29.10	homo-dimer	HHblits	X-ray	2.30Å	0.35	0.96	Glutamate racemase
2vvt.1.A	36.80	homo-dimer	BLAST	X-ray	1.65Å	0.38	0.91	GLUTAMATE RACEMASE
2vvt.1.B	36.80	homo-dimer	BLAST	X-ray	1.65Å	0.38	0.91	GLUTAMATE RACEMASE
2jfp.1.A	36.80	homo-dimer	BLAST	X-ray	1.98Å	0.38	0.91	GLUTAMATE RACEMASE
2jfo.1.B	36.80	homo-dimer	BLAST	X-ray	2.50Å	0.38	0.91	GLUTAMATE RACEMASE
2jfw.1.A	33.62	homo-dimer	BLAST	X-ray	2.00Å	0.37	0.91	GLUTAMATE RACEMASE
1zuw.1.A	35.81	homo-dimer	BLAST	X-ray	1.75Å	0.38	0.90	glutamate racemase 1
1zuw.1.B	35.81	homo-dimer	BLAST	X-ray	1.75Å	0.38	0.90	glutamate racemase 1
3hfr.1.A	33.62	homo-dimer	BLAST	X-ray	2.30Å	0.37	0.91	Glutamate racemase
3hfr.1.B	33.62	homo-dimer	BLAST	X-ray	2.30Å	0.37	0.91	Glutamate racemase
2jfn.1.A	24.69	monomer	HHblits	X-ray	1.90Å	0.32	0.95	GLUTAMATE RACEMASE
2jfq.1.A	37.10	homo-dimer	BLAST	X-ray	2.15Å	0.38	0.87	GLUTAMATE RACEMASE
2jfq.1.B	37.10	homo-dimer	BLAST	X-ray	2.15Å	0.38	0.87	GLUTAMATE RACEMASE
5hj7.1.A	33.18	homo-dimer	BLAST	X-ray	2.30Å	0.36	0.87	Glutamate racemase
2dwu.1.A	33.33	homo-dimer	BLAST	X-ray	1.60Å	0.36	0.87	Glutamate racemase
2dwu.2.A	33.33	homo-dimer	BLAST	X-ray	1.60Å	0.36	0.87	Glutamate racemase
2gzm.1.A	39.57	homo-dimer	BLAST	X-ray	1.99Å	0.39	0.73	Glutamate racemase
2gzm.1.B	39.57	homo-dimer	BLAST	X-ray	1.99Å	0.39	0.73	Glutamate racemase
2gzm.2.B	39.57	homo-dimer	BLAST	X-ray	1.99Å	0.39	0.73	Glutamate racemase
5b19.1.A	17.79	homo-dimer	HHblits	X-ray	1.85Å	0.30	0.82	Aspartate racemase
5b19.1.B	17.79	homo-dimer	HHblits	X-ray	1.85Å	0.30	0.82	Aspartate racemase
3s81.1.A	19.21	homo-dimer	HHblits	X-ray	1.80Å	0.31	0.80	Putative aspartate racemase
2zsk.1.A	21.67	homo-dimer	HHblits	X-ray	2.55Å	0.30	0.80	226aa long hypothetical aspartate racemase
1jfl.1.A	21.39	homo-dimer	HHblits	X-ray	1.90Å	0.30	0.79	ASPARTATE RACEMASE
2dx7.1.A	20.90	homo-dimer	HHblits	X-ray	2.00Å	0.30	0.79	aspartate racemase
2dx7.1.B	20.90	homo-dimer	HHblits	X-ray	2.00Å	0.30	0.79	aspartate racemase
5elm.1.A	13.59	homo-dimer	HHblits	X-ray	2.00Å	0.27	0.81	Asp/Glu_racemase family protein
5elm.1.B	13.59	homo-dimer	HHblits	X-ray	2.00Å	0.27	0.81	Asp/Glu_racemase family protein
5elm.2.A	13.59	homo-dimer	HHblits	X-ray	2.00Å	0.27	0.81	Asp/Glu_racemase family protein
5elm.2.B	13.59	homo-dimer	HHblits	X-ray	2.00Å	0.27	0.81	Asp/Glu_racemase family protein
5ell.1.A	13.73	homo-dimer	HHblits	X-ray	1.80Å	0.27	0.80	Asp/Glu_racemase family protein
5ell.1.B	13.73	homo-dimer	HHblits	X-ray	1.80Å	0.27	0.80	Asp/Glu_racemase family protein
2xec.1.A	11.76	homo-dimer	HHblits	X-ray	2.20Å	0.27	0.80	PUTATIVE MALEATE ISOMERASE
5hqt.1.A	14.22	homo-dimer	HHblits	X-ray	1.60Å	0.27	0.80	aspartate/glutamate racemase
2xed.1.A	11.27	monomer	HHblits	X-ray	1.95Å	0.27	0.80	PUTATIVE MALEATE ISOMERASE
4fq7.1.A	8.82	homo-tetramer	HHblits	X-ray	3.00Å	0.26	0.80	Maleate cis-trans isomerase
1b73.1.A	43.11	homo-dimer	BLAST	X-ray	2.30Å	0.41	0.65	GLUTAMATE RACEMASE
4fq5.1.A	8.82	homo-tetramer	HHblits	X-ray	2.10Å	0.26	0.80	Maleate cis-trans isomerase
4fq5.1.B	8.82	homo-tetramer	HHblits	X-ray	2.10Å	0.26	0.80	Maleate cis-trans isomerase
4ix1.1.A	12.08	homo-dimer	HHblits	X-ray	2.80Å	0.24	0.81	hypothetical protein
4ix1.1.B	12.08	homo-dimer	HHblits	X-ray	2.80Å	0.24	0.81	hypothetical protein
3out.1.A	37.43	homo-hexamer	BLAST	X-ray	1.65Å	0.39	0.67	Glutamate racemase
3ojc.1.A	18.65	homo-tetramer	HHblits	X-ray	1.75Å	0.30	0.76	Putative aspartate/glutamate racemase
3ojc.1.B	18.65	homo-tetramer	HHblits	X-ray	1.75Å	0.30	0.76	Putative aspartate/glutamate racemase
3ojc.1.C	18.65	homo-tetramer	HHblits	X-ray	1.75Å	0.30	0.76	Putative aspartate/glutamate racemase
3ojc.1.D	18.65	homo-tetramer	HHblits	X-ray	1.75Å	0.30	0.76	Putative aspartate/glutamate racemase
2eq5.1.A	17.41	homo-dimer	HHblits	X-ray	2.20Å	0.26	0.79	228aa long hypothetical hydantoin racemase
2eq5.2.B	17.41	homo-dimer	HHblits	X-ray	2.20Å	0.26	0.79	228aa long hypothetical hydantoin racemase
2ohv.1.A	33.92	homo-dimer	BLAST	X-ray	2.50Å	0.38	0.67	Glutamate Racemase
2ohg.1.A	33.92	homo-dimer	BLAST	X-ray	2.50Å	0.38	0.67	Glutamate racemase
2oho.1.A	33.92	homo-dimer	BLAST	X-ray	2.25Å	0.38	0.67	Glutamate Racemase
2oho.1.B	33.92	homo-dimer	BLAST	X-ray	2.25Å	0.38	0.67	Glutamate Racemase
2dgd.1.A	12.50	homo-octamer	HHblits	X-ray	2.90Å	0.25	0.78	223aa long hypothetical arylmalonate decarboxylase
5ijw.1.A	39.02	homo-dimer	BLAST	X-ray	1.76Å	0.39	0.64	Glutamate racemase
5ijw.1.B	39.02	homo-dimer	BLAST	X-ray	1.76Å	0.39	0.64	Glutamate racemase
3qvj.1.A	15.43	homo-hexamer	HHblits	X-ray	2.10Å	0.27	0.74	Putative hydantoin racemase
5lfd.1.A	14.29	homo-hexamer	HHblits	X-ray	2.15Å	0.26	0.74	Allantoin racemase
3qvl.1.A	13.98	homo-hexamer	HHblits	X-ray	1.82Å	0.26	0.73	Putative hydantoin racemase
3ixm.1.A	7.98	monomer	HHblits	X-ray	1.90Å	0.24	0.74	Arylmalonate decarboxylase
2vlb.1.A	7.98	monomer	HHblits	X-ray	1.92Å	0.24	0.74	ARYLMALONATE DECARBOXYLASE
2vlb.2.A	7.98	monomer	HHblits	X-ray	1.92Å	0.24	0.74	ARYLMALONATE DECARBOXYLASE
2vlb.3.A	7.98	monomer	HHblits	X-ray	1.92Å	0.24	0.74	ARYLMALONATE DECARBOXYLASE
2vlb.4.A	7.98	monomer	HHblits	X-ray	1.92Å	0.24	0.74	ARYLMALONATE DECARBOXYLASE
3dtv.3.A	7.45	monomer	HHblits	X-ray	2.10Å	0.24	0.74	Arylmalonate decarboxylase
3dtv.2.A	7.45	monomer	HHblits	X-ray	2.10Å	0.24	0.74	Arylmalonate decarboxylase
3dtv.1.A	7.45	monomer	HHblits	X-ray	2.10Å	0.24	0.74	Arylmalonate decarboxylase
3dtv.4.A	7.45	monomer	HHblits	X-ray	2.10Å	0.24	0.74	Arylmalonate decarboxylase
3eis.1.A	7.45	monomer	HHblits	X-ray	2.10Å	0.24	0.74	Arylmalonate decarboxylase
3eis.2.A	7.45	monomer	HHblits	X-ray	2.10Å	0.24	0.74	Arylmalonate decarboxylase
3dg9.1.A	7.45	monomer	HHblits	X-ray	1.50Å	0.24	0.74	Arylmalonate decarboxylase
3ixl.1.A	6.91	monomer	HHblits	X-ray	1.45Å	0.24	0.74	Arylmalonate decarboxylase
2jfn.1.A	29.38	monomer	BLAST	X-ray	1.90Å	0.36	0.63	GLUTAMATE RACEMASE
4rwe.1.A	11.17	monomer	HHblits	X-ray	1.65Å	0.26	0.70	Sugar-binding transport protein
3zvm.1.A	11.48	monomer	HHblits	X-ray	2.00Å	0.24	0.72	BIFUNCTIONAL POLYNUCLEOTIDE PHOSPHATASE/KINASE
3zvm.2.A	11.48	monomer	HHblits	X-ray	2.00Å	0.24	0.72	BIFUNCTIONAL POLYNUCLEOTIDE PHOSPHATASE/KINASE
3zvl.1.A	11.48	monomer	HHblits	X-ray	1.65Å	0.24	0.72	BIFUNCTIONAL POLYNUCLEOTIDE PHOSPHATASE/KINASE
3l6u.1.A	10.67	homo-dimer	HHblits	X-ray	1.90Å	0.26	0.70	ABC-TYPE SUGAR TRANSPORT SYSTEM PERIPLASMIC COMPONENT
3l6u.1.B	10.67	homo-dimer	HHblits	X-ray	1.90Å	0.26	0.70	ABC-TYPE SUGAR TRANSPORT SYSTEM PERIPLASMIC COMPONENT
1jx6.1.A	11.89	monomer	HHblits	X-ray	1.50Å	0.26	0.56	LUXP PROTEIN
1uag.1.A	15.57	monomer	HHblits	X-ray	1.95Å	0.28	0.48	UDP-N-ACETYLMURAMOYL-L-ALANINE/:D-GLUTAMATE LIGASE
1eeh.1.A	15.57	monomer	HHblits	X-ray	1.90Å	0.28	0.48	UDP-N-ACETYLMURAMOYL-L-ALANINE:D-GLUTAMATE LIGASE
2uag.1.A	15.57	monomer	HHblits	X-ray	1.70Å	0.28	0.48	PROTEIN (UDP-N-ACETYLMURAMOYL-L-ALANINE:D-GLUTAMATE LIGASE)
1e0d.1.A	15.57	monomer	HHblits	X-ray	2.40Å	0.28	0.48	UDP-N-ACETYLMURAMOYLALANINE--D-GLUTAMATE LIGASE
5a5e.1.A	15.57	monomer	HHblits	X-ray	1.84Å	0.28	0.48	UDP-N-ACETYLMURAMOYLALANINE--D-GLUTAMATE LIGASE
2xpc.1.A	15.57	monomer	HHblits	X-ray	1.49Å	0.28	0.48	UDP-N-ACETYLMURAMOYLALANINE--D-GLUTAMATE LIGASE
5a5f.1.A	14.75	monomer	HHblits	X-ray	1.90Å	0.28	0.48	UDP-N-ACETYLMURAMOYLALANINE--D-GLUTAMATE LIGASE
1jhz.1.A	13.22	homo-dimer	HHblits	X-ray	2.40Å	0.27	0.47	PURINE NUCLEOTIDE SYNTHESIS REPRESSOR
1jhz.1.B	13.22	homo-dimer	HHblits	X-ray	2.40Å	0.27	0.47	PURINE NUCLEOTIDE SYNTHESIS REPRESSOR
2pud.1.B	14.17	homo-dimer	HHblits	X-ray	2.60Å	0.28	0.47	PROTEIN (PURINE REPRESSOR)
3bbl.1.A	12.50	homo-dimer	HHblits	X-ray	2.35Å	0.27	0.47	Regulatory protein of LacI family
1bdi.1.B	13.45	homo-dimer	HHblits	X-ray	3.00Å	0.27	0.47	PROTEIN (PURINE REPRESSOR)
4rk1.1.A	13.33	homo-dimer	HHblits	X-ray	1.90Å	0.26	0.47	Ribose transcriptional regulator
4rk5.1.A	13.56	homo-dimer	HHblits	X-ray	1.35Å	0.27	0.46	Transcriptional regulator, LacI family
4ywh.1.A	11.11	monomer	HHblits	X-ray	2.35Å	0.27	0.46	ABC TRANSPORTER SOLUTE BINDING PROTEIN
3o75.1.A	14.55	homo-dimer	HHblits	X-ray	2.30Å	0.29	0.43	Fructose transport system repressor FruR
3o74.1.B	14.55	homo-dimer	HHblits	X-ray	2.00Å	0.29	0.43	Fructose transport system repressor FruR
1jh9.1.B	12.73	homo-dimer	HHblits	X-ray	2.55Å	0.27	0.43	PURINE NUCLEOTIDE SYNTHESIS REPRESSOR
3dbi.1.A	10.00	homo-dimer	HHblits	X-ray	2.45Å	0.26	0.43	SUGAR-BINDING TRANSCRIPTIONAL REGULATOR, LACI FAMILY
4o5a.1.A	11.82	homo-dimer	HHblits	X-ray	1.78Å	0.26	0.43	LacI family transcription regulator
3brq.1.A	10.09	homo-dimer	HHblits	X-ray	2.00Å	0.26	0.43	HTH-type transcriptional regulator ascG
3brq.1.B	10.09	homo-dimer	HHblits	X-ray	2.00Å	0.26	0.43	HTH-type transcriptional regulator ascG
2p9h.1.A	9.01	homo-dimer	HHblits	X-ray	2.00Å	0.25	0.44	Lactose operon repressor
1lbi.1.A	9.01	homo-tetramer	HHblits	X-ray	2.70Å	0.25	0.44	LAC REPRESSOR
1lbi.1.B	9.01	homo-tetramer	HHblits	X-ray	2.70Å	0.25	0.44	LAC REPRESSOR
1lbi.1.C	9.01	homo-tetramer	HHblits	X-ray	2.70Å	0.25	0.44	LAC REPRESSOR
1lbi.1.D	9.01	homo-tetramer	HHblits	X-ray	2.70Å	0.25	0.44	LAC REPRESSOR
1lbh.1.A	9.01	homo-tetramer	HHblits	X-ray	3.20Å	0.25	0.44	INTACT LACTOSE OPERON REPRESSOR WITH GRATUITOUS INDUCER IPTG
1lbh.1.B	9.01	homo-tetramer	HHblits	X-ray	3.20Å	0.25	0.44	INTACT LACTOSE OPERON REPRESSOR WITH GRATUITOUS INDUCER IPTG
1lbh.1.C	9.01	homo-tetramer	HHblits	X-ray	3.20Å	0.25	0.44	INTACT LACTOSE OPERON REPRESSOR WITH GRATUITOUS INDUCER IPTG
1lbh.1.D	9.01	homo-tetramer	HHblits	X-ray	3.20Å	0.25	0.44	INTACT LACTOSE OPERON REPRESSOR WITH GRATUITOUS INDUCER IPTG
1jyf.1.A	9.01	homo-dimer	HHblits	X-ray	3.00Å	0.25	0.44	Lactose Operon Repressor
3edc.1.A	8.11	homo-tetramer	HHblits	X-ray	2.10Å	0.24	0.44	Lactose operon repressor
3edc.1.B	8.11	homo-tetramer	HHblits	X-ray	2.10Å	0.24	0.44	Lactose operon repressor
3edc.1.C	8.11	homo-tetramer	HHblits	X-ray	2.10Å	0.24	0.44	Lactose operon repressor
3edc.1.D	8.11	homo-tetramer	HHblits	X-ray	2.10Å	0.24	0.44	Lactose operon repressor
4rk0.1.A	14.29	homo-dimer	HHblits	X-ray	1.80Å	0.28	0.41	LacI family sugar-binding transcriptional regulator
4rk0.1.B	14.29	homo-dimer	HHblits	X-ray	1.80Å	0.28	0.41	LacI family sugar-binding transcriptional regulator
3ojc.1.A	15.69	homo-tetramer	HHblits	X-ray	1.75Å	0.28	0.40	Putative aspartate/glutamate racemase
3ojc.1.B	15.69	homo-tetramer	HHblits	X-ray	1.75Å	0.28	0.40	Putative aspartate/glutamate racemase
3ojc.1.C	15.69	homo-tetramer	HHblits	X-ray	1.75Å	0.28	0.40	Putative aspartate/glutamate racemase
3ojc.1.D	15.69	homo-tetramer	HHblits	X-ray	1.75Å	0.28	0.40	Putative aspartate/glutamate racemase
5elm.1.A	19.80	homo-dimer	HHblits	X-ray	2.00Å	0.28	0.40	Asp/Glu_racemase family protein
5elm.1.B	19.80	homo-dimer	HHblits	X-ray	2.00Å	0.28	0.40	Asp/Glu_racemase family protein
5elm.2.A	19.80	homo-dimer	HHblits	X-ray	2.00Å	0.28	0.40	Asp/Glu_racemase family protein
5elm.2.B	19.80	homo-dimer	HHblits	X-ray	2.00Å	0.28	0.40	Asp/Glu_racemase family protein
1jfl.1.A	12.75	homo-dimer	HHblits	X-ray	1.90Å	0.27	0.40	ASPARTATE RACEMASE
5lfd.1.A	12.00	homo-hexamer	HHblits	X-ray	2.15Å	0.28	0.39	Allantoin racemase
1iu9.1.A	21.43	monomer	HHblits	X-ray	2.04Å	0.30	0.38	aspartate racemase
5hqt.1.A	15.84	homo-dimer	HHblits	X-ray	1.60Å	0.27	0.40	aspartate/glutamate racemase
2zsk.1.A	11.76	homo-dimer	HHblits	X-ray	2.55Å	0.26	0.40	226aa long hypothetical aspartate racemase
3s81.1.A	11.65	homo-dimer	HHblits	X-ray	1.80Å	0.26	0.40	Putative aspartate racemase
5b19.1.A	8.82	homo-dimer	HHblits	X-ray	1.85Å	0.26	0.40	Aspartate racemase
5b19.1.B	8.82	homo-dimer	HHblits	X-ray	1.85Å	0.26	0.40	Aspartate racemase
5ell.1.A	16.00	homo-dimer	HHblits	X-ray	1.80Å	0.27	0.39	Asp/Glu_racemase family protein
5ell.1.B	16.00	homo-dimer	HHblits	X-ray	1.80Å	0.27	0.39	Asp/Glu_racemase family protein
2dx7.1.A	13.13	homo-dimer	HHblits	X-ray	2.00Å	0.27	0.39	aspartate racemase
2dx7.1.B	13.13	homo-dimer	HHblits	X-ray	2.00Å	0.27	0.39	aspartate racemase
2pju.1.B	11.00	homo-dimer	HHblits	X-ray	2.10Å	0.25	0.39	Propionate catabolism operon regulatory protein
2pju.1.A	11.00	homo-dimer	HHblits	X-ray	2.10Å	0.25	0.39	Propionate catabolism operon regulatory protein
2pju.2.B	11.00	homo-dimer	HHblits	X-ray	2.10Å	0.25	0.39	Propionate catabolism operon regulatory protein
2q5c.1.A	14.43	monomer	HHblits	X-ray	1.49Å	0.28	0.38	NtrC family transcriptional regulator
3dg9.1.A	13.40	monomer	HHblits	X-ray	1.50Å	0.27	0.38	Arylmalonate decarboxylase
3ixm.1.A	13.40	monomer	HHblits	X-ray	1.90Å	0.27	0.38	Arylmalonate decarboxylase
2vlb.1.A	13.40	monomer	HHblits	X-ray	1.92Å	0.26	0.38	ARYLMALONATE DECARBOXYLASE
2vlb.2.A	13.40	monomer	HHblits	X-ray	1.92Å	0.26	0.38	ARYLMALONATE DECARBOXYLASE
2vlb.3.A	13.40	monomer	HHblits	X-ray	1.92Å	0.26	0.38	ARYLMALONATE DECARBOXYLASE
2vlb.4.A	13.40	monomer	HHblits	X-ray	1.92Å	0.26	0.38	ARYLMALONATE DECARBOXYLASE
3dtv.3.A	13.83	monomer	HHblits	X-ray	2.10Å	0.26	0.37	Arylmalonate decarboxylase
3dtv.2.A	13.83	monomer	HHblits	X-ray	2.10Å	0.26	0.37	Arylmalonate decarboxylase
3dtv.1.A	13.83	monomer	HHblits	X-ray	2.10Å	0.26	0.37	Arylmalonate decarboxylase
3dtv.4.A	13.83	monomer	HHblits	X-ray	2.10Å	0.26	0.37	Arylmalonate decarboxylase
3eis.1.A	13.83	monomer	HHblits	X-ray	2.10Å	0.26	0.37	Arylmalonate decarboxylase
3eis.2.A	13.83	monomer	HHblits	X-ray	2.10Å	0.26	0.37	Arylmalonate decarboxylase
4zht.1.A	13.98	homo-tetramer	HHblits	X-ray	2.69Å	0.27	0.36	Bifunctional UDP-N-acetylglucosamine 2-epimerase/N-acetylmannosamine kinase
3h5t.1.A	8.51	monomer	HHblits	X-ray	2.53Å	0.26	0.37	Transcriptional regulator, LacI family
3okp.1.A	13.04	monomer	HHblits	X-ray	2.00Å	0.27	0.36	GDP-mannose-dependent alpha-(1-6)-phosphatidylinositol monomannoside mannosyltransferase
3oka.1.A	13.04	hetero-oligomer	HHblits	X-ray	2.20Å	0.27	0.36	GDP-mannose-dependent alpha-(1-6)-phosphatidylinositol monomannoside mannosyltransferase
1f6d.1.B	14.13	homo-dimer	HHblits	X-ray	2.50Å	0.26	0.36	UDP-N-ACETYLGLUCOSAMINE 2-EPIMERASE
1f6d.1.A	14.13	homo-dimer	HHblits	X-ray	2.50Å	0.26	0.36	UDP-N-ACETYLGLUCOSAMINE 2-EPIMERASE
1gso.1.A	14.29	monomer	HHblits	X-ray	1.60Å	0.27	0.36	PROTEIN (GLYCINAMIDE RIBONUCLEOTIDE SYNTHETASE)
3mjf.1.A	14.29	monomer	HHblits	X-ray	1.47Å	0.27	0.36	Phosphoribosylamine--glycine ligase
3lp8.1.A	19.32	monomer	HHblits	X-ray	2.15Å	0.29	0.35	Phosphoribosylamine-glycine ligase
1vgv.1.B	13.19	homo-dimer	HHblits	X-ray	2.31Å	0.26	0.36	UDP-N-acetylglucosamine 2-epimerase
1vgv.1.A	13.19	homo-dimer	HHblits	X-ray	2.31Å	0.26	0.36	UDP-N-acetylglucosamine 2-epimerase
1vgv.2.B	13.19	homo-dimer	HHblits	X-ray	2.31Å	0.26	0.36	UDP-N-acetylglucosamine 2-epimerase
2qk4.1.A	10.00	monomer	HHblits	X-ray	2.45Å	0.26	0.35	Trifunctional purine biosynthetic protein adenosine-3
3hbm.1.A	14.61	monomer	HHblits	X-ray	1.80Å	0.27	0.35	UDP-sugar hydrolase
3hbn.1.A	14.61	monomer	HHblits	X-ray	1.85Å	0.27	0.35	UDP-sugar hydrolase
2ys6.1.A	13.48	monomer	HHblits	X-ray	2.21Å	0.26	0.35	Phosphoribosylglycinamide synthetase
5hj7.1.A	13.79	homo-dimer	HHblits	X-ray	2.30Å	0.28	0.34	Glutamate racemase
2ip4.1.A	13.48	monomer	HHblits	X-ray	2.80Å	0.26	0.35	Phosphoribosylamine--glycine ligase
2ip4.2.A	13.48	monomer	HHblits	X-ray	2.80Å	0.26	0.35	Phosphoribosylamine--glycine ligase
2xcl.1.A	13.79	monomer	HHblits	X-ray	2.10Å	0.27	0.34	PHOSPHORIBOSYLAMINE--GLYCINE LIGASE
4r9x.1.A	17.65	homo-dimer	HHblits	X-ray	1.85Å	0.29	0.33	Copper homeostasis protein CutC
4r9x.1.B	17.65	homo-dimer	HHblits	X-ray	1.85Å	0.29	0.33	Copper homeostasis protein CutC
1zuw.1.A	16.28	homo-dimer	HHblits	X-ray	1.75Å	0.28	0.34	glutamate racemase 1
1zuw.1.B	16.28	homo-dimer	HHblits	X-ray	1.75Å	0.28	0.34	glutamate racemase 1
5ijw.1.A	12.64	homo-dimer	HHblits	X-ray	1.76Å	0.27	0.34	Glutamate racemase
5ijw.1.B	12.64	homo-dimer	HHblits	X-ray	1.76Å	0.27	0.34	Glutamate racemase
3out.1.A	15.12	homo-hexamer	HHblits	X-ray	1.65Å	0.27	0.34	Glutamate racemase
2yya.1.A	11.49	monomer	HHblits	X-ray	2.40Å	0.26	0.34	Phosphoribosylamine--glycine ligase
3hfr.1.A	15.12	homo-dimer	HHblits	X-ray	2.30Å	0.27	0.34	Glutamate racemase
3hfr.1.B	15.12	homo-dimer	HHblits	X-ray	2.30Å	0.27	0.34	Glutamate racemase
2jfp.1.A	11.76	homo-dimer	HHblits	X-ray	1.98Å	0.27	0.33	GLUTAMATE RACEMASE
2jfo.1.B	11.76	homo-dimer	HHblits	X-ray	2.50Å	0.27	0.33	GLUTAMATE RACEMASE
1x7i.1.A	12.94	homo-dimer	HHblits	X-ray	1.70Å	0.26	0.33	Copper homeostasis protein cutC
1x7i.1.B	12.94	homo-dimer	HHblits	X-ray	1.70Å	0.26	0.33	Copper homeostasis protein cutC
1twd.1.A	12.94	homo-dimer	HHblits	X-ray	1.70Å	0.26	0.33	Copper homeostasis protein cutC
1twd.1.B	12.94	homo-dimer	HHblits	X-ray	1.70Å	0.26	0.33	Copper homeostasis protein cutC
1kji.1.A	12.94	homo-dimer	HHblits	X-ray	1.60Å	0.26	0.33	phosphoribosylglycinamide formyltransferase 2
1kji.1.B	12.94	homo-dimer	HHblits	X-ray	1.60Å	0.26	0.33	phosphoribosylglycinamide formyltransferase 2
3hut.1.A	11.90	monomer	HHblits	X-ray	1.93Å	0.27	0.33	putative branched-chain amino acid ABC transporter
4x9s.1.A	19.28	monomer	HHblits	X-ray	1.60Å	0.28	0.33	Phosphoribosyl isomerase A
1o5o.1.A	16.05	homo-tetramer	HHblits	X-ray	2.30Å	0.29	0.32	Uracil phosphoribosyltransferase
2y88.1.A	16.47	monomer	HHblits	X-ray	1.33Å	0.26	0.33	PHOSPHORIBOSYL ISOMERASE A
2y89.1.A	16.47	monomer	HHblits	X-ray	2.50Å	0.26	0.33	PHOSPHORIBOSYL ISOMERASE A
1dbq.1.A	14.63	homo-dimer	HHblits	X-ray	2.20Å	0.28	0.32	PURINE REPRESSOR
1dbq.1.B	14.63	homo-dimer	HHblits	X-ray	2.20Å	0.28	0.32	PURINE REPRESSOR
4tx9.1.A	16.67	monomer	HHblits	X-ray	1.60Å	0.26	0.33	Phosphoribosyl isomerase A
2ohv.1.A	11.90	homo-dimer	HHblits	X-ray	2.50Å	0.26	0.33	Glutamate Racemase
2ohg.1.A	11.90	homo-dimer	HHblits	X-ray	2.50Å	0.26	0.33	Glutamate racemase
2ehj.1.A	17.50	homo-tetramer	HHblits	X-ray	2.80Å	0.30	0.31	Uracil phosphoribosyltransferase
2ehj.1.C	17.50	homo-tetramer	HHblits	X-ray	2.80Å	0.30	0.31	Uracil phosphoribosyltransferase
5e38.1.B	17.50	homo-tetramer	HHblits	X-ray	3.00Å	0.29	0.31	Uracil phosphoribosyltransferase
5e38.1.A	17.50	homo-tetramer	HHblits	X-ray	3.00Å	0.29	0.31	Uracil phosphoribosyltransferase
5e38.1.D	17.50	homo-tetramer	HHblits	X-ray	3.00Å	0.29	0.31	Uracil phosphoribosyltransferase
2pug.1.B	15.00	homo-dimer	HHblits	X-ray	2.70Å	0.29	0.31	PROTEIN (PURINE REPRESSOR)
2jfn.1.A	9.30	monomer	HHblits	X-ray	1.90Å	0.23	0.34	GLUTAMATE RACEMASE
2ipl.1.A	20.51	monomer	HHblits	X-ray	1.20Å	0.30	0.31	D-galactose-binding periplasmic protein
2oho.1.A	10.84	homo-dimer	HHblits	X-ray	2.25Å	0.26	0.33	Glutamate Racemase
2oho.1.B	10.84	homo-dimer	HHblits	X-ray	2.25Å	0.26	0.33	Glutamate Racemase
1jft.1.B	15.00	homo-dimer	HHblits	X-ray	2.50Å	0.28	0.31	PURINE NUCLEOTIDE SYNTHESIS REPRESSOR
1jfs.1.B	15.00	homo-dimer	HHblits	X-ray	2.90Å	0.28	0.31	PURINE NUCLEOTIDE SYNTHESIS REPRESSOR
1vpw.1.B	15.00	homo-dimer	HHblits	X-ray	2.70Å	0.28	0.31	PURINE REPRESSOR
1bdh.1.B	15.00	homo-dimer	HHblits	X-ray	2.70Å	0.28	0.31	PROTEIN (PURINE REPRESSOR)
5eqv.1.A	13.41	monomer	HHblits	X-ray	1.45Å	0.26	0.32	bifunctional 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase periplasmic precursor protein
4wd0.1.A	15.85	homo-hexamer	HHblits	X-ray	1.50Å	0.26	0.32	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase
2iks.1.A	13.92	homo-dimer	HHblits	X-ray	1.85Å	0.29	0.31	DNA-binding transcriptional dual regulator
2iks.1.B	13.92	homo-dimer	HHblits	X-ray	1.85Å	0.29	0.31	DNA-binding transcriptional dual regulator
3uk0.1.A	12.50	monomer	HHblits	X-ray	1.49Å	0.28	0.31	Extracellular ligand-binding receptor
4u28.1.A	16.05	monomer	HHblits	X-ray	1.33Å	0.27	0.32	Phosphoribosyl isomerase A
2ipm.1.A	19.23	monomer	HHblits	X-ray	1.12Å	0.29	0.31	D-galactose-binding periplasmic protein
3cea.1.A	10.98	homo-tetramer	HHblits	X-ray	2.40Å	0.25	0.32	Myo-inositol 2-dehydrogenase
3rc1.1.A	11.11	monomer	HHblits	X-ray	1.71Å	0.26	0.32	Sugar 3-ketoreductase
4n54.1.A	12.35	homo-tetramer	HHblits	X-ray	2.05Å	0.26	0.32	Inositol dehydrogenase
4n54.1.C	12.35	homo-tetramer	HHblits	X-ray	2.05Å	0.26	0.32	Inositol dehydrogenase
4n54.1.D	12.35	homo-tetramer	HHblits	X-ray	2.05Å	0.26	0.32	Inositol dehydrogenase
1vzw.1.A	16.05	monomer	HHblits	X-ray	1.80Å	0.26	0.32	PHOSPHORIBOSYL ISOMERASE A
2vep.1.A	16.05	monomer	HHblits	X-ray	1.80Å	0.26	0.32	PHOSPHORIBOSYL ISOMERASE A
5dn1.1.A	16.05	monomer	HHblits	X-ray	1.95Å	0.26	0.32	Phosphoribosyl isomerase A
2pe5.1.C	12.35	homo-dimer	HHblits	X-ray	3.50Å	0.26	0.32	Lactose operon repressor
1efa.1.C	12.35	homo-dimer	HHblits	X-ray	2.60Å	0.26	0.32	LAC REPRESSOR
1jwl.1.D	12.35	homo-dimer	HHblits	X-ray	4.00Å	0.26	0.32	Lactose Operon Repressor
3tx6.1.A	8.64	monomer	HHblits	X-ray	1.50Å	0.26	0.32	Putative branched-chain amino acid transport system substrate-binding protein
3i45.1.A	12.20	monomer	HHblits	X-ray	1.36Å	0.25	0.32	Twin-arginine translocation pathway signal protein
4rzt.1.A	11.11	homo-tetramer	HHblits	X-ray	3.10Å	0.26	0.32	Lac repressor
4rzs.1.B	11.11	homo-tetramer	HHblits	X-ray	2.71Å	0.26	0.32	Lac repressor
4rzs.1.C	11.11	homo-tetramer	HHblits	X-ray	2.71Å	0.26	0.32	Lac repressor
4rzs.1.D	11.11	homo-tetramer	HHblits	X-ray	2.71Å	0.26	0.32	Lac repressor
4rzs.1.A	11.11	homo-tetramer	HHblits	X-ray	2.71Å	0.26	0.32	Lac repressor
4rzt.1.B	11.11	homo-tetramer	HHblits	X-ray	3.10Å	0.26	0.32	Lac repressor
1xtu.1.A	16.25	homo-tetramer	HHblits	X-ray	2.80Å	0.26	0.31	Probable uracil phosphoribosyltransferase
3g6w.1.A	16.25	homo-tetramer	HHblits	X-ray	2.90Å	0.26	0.31	Uracil phosphoribosyltransferase
3g6w.1.B	16.25	homo-tetramer	HHblits	X-ray	2.90Å	0.26	0.31	Uracil phosphoribosyltransferase
1xtv.1.B	16.25	homo-tetramer	HHblits	X-ray	2.60Å	0.26	0.31	Probable uracil phosphoribosyltransferase
1xtv.1.C	16.25	homo-tetramer	HHblits	X-ray	2.60Å	0.26	0.31	Probable uracil phosphoribosyltransferase
1xtt.1.A	16.25	homo-tetramer	HHblits	X-ray	1.80Å	0.26	0.31	Probable uracil phosphoribosyltransferase
1xtt.1.B	16.25	homo-tetramer	HHblits	X-ray	1.80Å	0.26	0.31	Probable uracil phosphoribosyltransferase
1vst.1.A	16.25	homo-tetramer	HHblits	X-ray	2.80Å	0.26	0.31	Uracil phosphoribosyltransferase
4x2r.1.A	18.99	monomer	HHblits	X-ray	1.05Å	0.27	0.31	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase
1qh1.1.B	15.38	hetero-oligomer	HHblits	X-ray	1.60Å	0.28	0.31	PROTEIN (NITROGENASE MOLYBDENUM IRON PROTEIN)
1tlf.1.A	11.25	homo-tetramer	HHblits	X-ray	2.60Å	0.25	0.31	LAC REPRESSOR
1tlf.1.B	11.25	homo-tetramer	HHblits	X-ray	2.60Å	0.25	0.31	LAC REPRESSOR
1tlf.1.C	11.25	homo-tetramer	HHblits	X-ray	2.60Å	0.25	0.31	LAC REPRESSOR
1tlf.1.D	11.25	homo-tetramer	HHblits	X-ray	2.60Å	0.25	0.31	LAC REPRESSOR
1ez1.1.A	14.10	homo-dimer	HHblits	X-ray	1.75Å	0.27	0.31	PHOSPHORIBOSYLGLYCINAMIDE FORMYLTRANSFERASE 2
1ez1.1.B	14.10	homo-dimer	HHblits	X-ray	1.75Å	0.27	0.31	PHOSPHORIBOSYLGLYCINAMIDE FORMYLTRANSFERASE 2
3k9c.1.A	11.39	homo-dimer	HHblits	X-ray	2.14Å	0.26	0.31	Transcriptional regulator, LacI family protein
2x30.1.A	16.88	monomer	HHblits	X-ray	1.95Å	0.27	0.30	PHOSPHORIBOSYL ISOMERASE A
3q2i.1.A	14.10	homo-octamer	HHblits	X-ray	1.50Å	0.26	0.31	dehydrogenase
2hqb.1.A	5.00	monomer	HHblits	X-ray	2.70Å	0.24	0.31	Transcriptional activator of comK gene
4wxe.1.A	11.69	monomer	HHblits	X-ray	1.50Å	0.26	0.30	Transcriptional regulator, LacI family
5vev.1.A	9.09	monomer	HHblits	X-ray	1.90Å	0.26	0.30	Phosphoribosylamine--glycine ligase
3bo9.1.A	9.21	homo-dimer	HHblits	X-ray	2.71Å	0.27	0.30	Putative nitroalkan dioxygenase
5gvj.1.A	9.21	homo-dimer	HHblits	X-ray	1.90Å	0.27	0.30	Enoyl-[acyl-carrier-protein] reductase [FMN]
5gvh.1.A	9.21	homo-dimer	HHblits	X-ray	2.29Å	0.27	0.30	Enoyl-[acyl-carrier-protein] reductase [FMN]
5ab3.1.A	11.69	monomer	HHblits	X-ray	1.80Å	0.25	0.30	1-(5-PHOSPHORIBOSYL)-5-[(5-PHOSPHORIBOSYLAMINO)METHYLIDEN AMINO]IMIDAZOLE-4-CARBOXAMIDE ISOMERASE
1rdu.1.A	10.39	monomer	HHblits	NMR	NA	0.25	0.30	conserved hypothetical protein
4axk.1.A	11.84	monomer	HHblits	X-ray	2.25Å	0.26	0.30	1-(5-PHOSPHORIBOSYL)-5-((5'-PHOSPHORIBOSYLAMINO) METHYLIDENEAMINO)IMIDAZOLE-4-CARBOXAMIDE ISOMERASE
4axk.2.A	11.84	monomer	HHblits	X-ray	2.25Å	0.26	0.30	1-(5-PHOSPHORIBOSYL)-5-((5'-PHOSPHORIBOSYLAMINO) METHYLIDENEAMINO)IMIDAZOLE-4-CARBOXAMIDE ISOMERASE
2y85.1.A	11.69	monomer	HHblits	X-ray	2.40Å	0.25	0.30	PHOSPHORIBOSYL ISOMERASE A
3zs4.1.A	11.69	monomer	HHblits	X-ray	1.90Å	0.25	0.30	PHOSPHORIBOSYL ISOMERASE A
2abb.1.A	12.00	monomer	HHblits	X-ray	1.00Å	0.27	0.29	pentaerythritol tetranitrate reductase
2aba.1.A	7.89	monomer	HHblits	X-ray	1.05Å	0.26	0.30	pentaerythritol tetranitrate reductase
4fx7.1.A	6.58	monomer	HHblits	X-ray	2.08Å	0.25	0.30	Imidazole glycerol phosphate synthase subunit HisF
2z6j.1.A	9.21	homo-dimer	HHblits	X-ray	2.30Å	0.25	0.30	Trans-2-enoyl-ACP reductase II
2qiw.1.A	10.67	homo-dimer	HHblits	X-ray	1.80Å	0.26	0.29	PEP phosphonomutase
4x9s.1.A	14.29	monomer	HHblits	X-ray	1.60Å	0.24	0.30	Phosphoribosyl isomerase A
3w6u.1.A	16.44	monomer	HHblits	X-ray	2.00Å	0.28	0.29	6-phosphogluconate dehydrogenase, NAD-binding protein
3t7e.1.A	6.41	homo-dimer	HHblits	X-ray	2.25Å	0.23	0.31	Ubiquitin-like modifier-activating enzyme ATG7
4gnr.1.A	19.44	monomer	HHblits	X-ray	1.00Å	0.29	0.28	ABC transporter substrate-binding protein-branched chain amino acid transport
4mg4.1.A	13.33	homo-dimer	HHblits	X-ray	1.70Å	0.26	0.29	Phosphonomutase
4mg4.2.B	13.33	homo-dimer	HHblits	X-ray	1.70Å	0.26	0.29	Phosphonomutase
3p67.1.A	10.81	monomer	HHblits	X-ray	1.50Å	0.26	0.29	Pentaerythritol tetranitrate reductase
2y88.1.A	11.84	monomer	HHblits	X-ray	1.33Å	0.24	0.30	PHOSPHORIBOSYL ISOMERASE A
2y89.1.A	11.84	monomer	HHblits	X-ray	2.50Å	0.24	0.30	PHOSPHORIBOSYL ISOMERASE A
3gka.1.A	5.19	monomer	HHblits	X-ray	2.30Å	0.23	0.30	N-ethylmaleimide reductase
1vys.1.A	9.59	monomer	HHblits	X-ray	1.80Å	0.27	0.29	PENTAERYTHRITOL TETRANITRATE REDUCTASE
3p84.1.A	9.59	monomer	HHblits	X-ray	1.10Å	0.27	0.29	Pentaerythritol tetranitrate reductase
3n0x.1.A	14.86	monomer	HHblits	X-ray	1.50Å	0.25	0.29	Possible substrate binding protein of ABC transporter system
3cky.1.A	8.22	homo-tetramer	HHblits	X-ray	2.30Å	0.26	0.29	2-hydroxymethyl glutarate dehydrogenase
3cky.1.C	8.22	homo-tetramer	HHblits	X-ray	2.30Å	0.26	0.29	2-hydroxymethyl glutarate dehydrogenase
3p74.1.A	9.59	monomer	HHblits	X-ray	1.20Å	0.26	0.29	Pentaerythritol tetranitrate reductase
3p8i.1.A	9.59	monomer	HHblits	X-ray	1.19Å	0.26	0.29	Pentaerythritol tetranitrate reductase
1pxw.1.A	13.70	monomer	HHblits	X-ray	1.94Å	0.26	0.29	LSU ribosomal protein L7AE
1pxw.2.A	13.70	monomer	HHblits	X-ray	1.94Å	0.26	0.29	LSU ribosomal protein L7AE
3rui.1.A	6.58	hetero-oligomer	HHblits	X-ray	1.91Å	0.23	0.30	Ubiquitin-like modifier-activating enzyme ATG7
3p82.1.A	9.59	monomer	HHblits	X-ray	2.20Å	0.26	0.29	Pentaerythritol tetranitrate reductase
3khj.1.A	16.90	homo-tetramer	HHblits	X-ray	2.80Å	0.28	0.28	Inosine-5-monophosphate dehydrogenase
3khj.1.B	16.90	homo-tetramer	HHblits	X-ray	2.80Å	0.28	0.28	Inosine-5-monophosphate dehydrogenase
3khj.1.C	16.90	homo-tetramer	HHblits	X-ray	2.80Å	0.28	0.28	Inosine-5-monophosphate dehydrogenase
3i23.1.A	12.50	homo-dimer	HHblits	X-ray	2.30Å	0.26	0.28	Oxidoreductase, Gfo/Idh/MocA family
3qlv.1.C	21.43	hetero-oligomer	HHblits	X-ray	3.94Å	0.29	0.27	Glutamate receptor, ionotropic kainate 2
3h6g.1.A	21.43	homo-dimer	HHblits	X-ray	2.70Å	0.29	0.27	Glutamate receptor, ionotropic kainate 2
3h6h.1.A	21.43	homo-dimer	HHblits	X-ray	2.90Å	0.29	0.27	Glutamate receptor, ionotropic kainate 2
3nkl.1.A	20.29	homo-dimer	HHblits	X-ray	1.90Å	0.30	0.27	UDP-D-quinovosamine 4-dehydrogenase
3nkl.1.B	20.29	homo-dimer	HHblits	X-ray	1.90Å	0.30	0.27	UDP-D-quinovosamine 4-dehydrogenase
1vyp.1.A	8.33	monomer	HHblits	X-ray	1.27Å	0.26	0.28	PENTAERYTHRITOL TETRANITRATE REDUCTASE
3p8j.1.A	8.33	monomer	HHblits	X-ray	1.00Å	0.26	0.28	Pentaerythritol tetranitrate reductase
5lgx.1.A	8.33	monomer	HHblits	X-ray	1.50Å	0.26	0.28	Pentaerythritol tetranitrate reductase
3obb.1.A	13.70	homo-tetramer	HHblits	X-ray	2.20Å	0.25	0.29	Probable 3-hydroxyisobutyrate dehydrogenase
4ab4.1.A	6.67	monomer	HHblits	X-ray	1.50Å	0.22	0.29	XENOBIOTIC REDUCTASE B
3p62.1.A	8.33	monomer	HHblits	X-ray	1.40Å	0.26	0.28	Pentaerythritol tetranitrate reductase
3p81.1.A	8.33	monomer	HHblits	X-ray	1.20Å	0.25	0.28	Pentaerythritol tetranitrate reductase
3t8q.1.A	15.71	homo-dimer	HHblits	X-ray	2.00Å	0.28	0.27	Mandelate racemase/muconate lactonizing enzyme family protein
5w1q.1.A	8.45	homo-dimer	HHblits	X-ray	1.95Å	0.26	0.28	Glutamate racemase
3wgi.1.B	12.50	homo-dimer	HHblits	X-ray	3.25Å	0.25	0.28	Redox-sensing transcriptional repressor rex
3wg9.2.A	12.50	homo-dimer	HHblits	X-ray	1.97Å	0.25	0.28	Redox-sensing transcriptional repressor rex
3wg9.2.B	12.50	homo-dimer	HHblits	X-ray	1.97Å	0.25	0.28	Redox-sensing transcriptional repressor rex
3wgh.1.B	12.50	homo-dimer	HHblits	X-ray	2.05Å	0.25	0.28	Redox-sensing transcriptional repressor rex
3wgg.1.A	12.50	homo-dimer	HHblits	X-ray	2.10Å	0.25	0.28	Redox-sensing transcriptional repressor rex
3wgg.1.B	12.50	homo-dimer	HHblits	X-ray	2.10Å	0.25	0.28	Redox-sensing transcriptional repressor rex
3tji.1.A	12.86	homo-octamer	HHblits	X-ray	1.80Å	0.27	0.27	Mandelate racemase/muconate lactonizing enzyme, N-terminal domain protein
3t9p.1.A	15.71	homo-dimer	HHblits	X-ray	1.97Å	0.27	0.27	Mandelate racemase/muconate lactonizing enzyme family protein
3ec7.1.A	13.04	homo-tetramer	HHblits	X-ray	2.15Å	0.28	0.27	Putative Dehydrogenase
2pge.1.A	7.04	monomer	HHblits	X-ray	1.60Å	0.25	0.28	MenC
4iyj.1.A	14.71	homo-dimer	HHblits	X-ray	1.37Å	0.29	0.27	GDSL-like protein
2gf2.1.A	8.33	homo-dimer	HHblits	X-ray	2.38Å	0.24	0.28	3-hydroxyisobutyrate dehydrogenase
3pef.1.A	8.11	homo-tetramer	HHblits	X-ray	2.07Å	0.22	0.29	6-phosphogluconate dehydrogenase, NAD-binding
3pef.2.C	8.11	homo-tetramer	HHblits	X-ray	2.07Å	0.22	0.29	6-phosphogluconate dehydrogenase, NAD-binding
2i9p.1.A	8.33	homo-tetramer	HHblits	X-ray	2.55Å	0.24	0.28	3-hydroxyisobutyrate dehydrogenase
3rr1.1.A	8.57	homo-octamer	HHblits	X-ray	1.95Å	0.26	0.27	Putative D-galactonate dehydratase
3gy1.1.A	10.00	homo-octamer	HHblits	X-ray	1.60Å	0.26	0.27	Mandelate racemase/muconate lactonizing protein
3r25.1.A	10.00	homo-dimer	HHblits	X-ray	1.60Å	0.25	0.27	mandelate racemase / muconate lactonizing enzyme
3sbf.1.A	11.43	homo-dimer	HHblits	X-ray	1.50Å	0.25	0.27	mandelate racemase / muconate lactonizing enzyme
3rcb.1.A	10.14	monomer	HHblits	X-ray	2.49Å	0.26	0.27	Sugar 3-ketoreductase
3p94.1.A	13.43	monomer	HHblits	X-ray	1.93Å	0.28	0.26	GDSL-like Lipase
4hf7.1.A	13.43	homo-dimer	HHblits	X-ray	1.77Å	0.28	0.26	Putative acylhydrolase
3hnp.1.A	11.59	homo-hexamer	HHblits	X-ray	2.60Å	0.26	0.27	Oxidoreductase
3hnp.1.D	11.59	homo-hexamer	HHblits	X-ray	2.60Å	0.26	0.27	Oxidoreductase
2ho5.1.A	15.15	homo-dimer	HHblits	X-ray	2.56Å	0.29	0.26	Oxidoreductase, Gfo/Idh/MocA family
4mkx.1.A	11.76	homo-tetramer	HHblits	X-ray	1.60Å	0.26	0.27	Inositol dehydrogenase
3nnd.1.A	14.49	homo-tetramer	HHblits	X-ray	2.80Å	0.25	0.27	Possible substrate binding protein of ABC transporter system
1v2g.1.A	16.42	monomer	HHblits	X-ray	2.00Å	0.27	0.26	Acyl-CoA thioesterase I
2o14.1.A	14.93	monomer	HHblits	X-ray	2.10Å	0.27	0.26	Hypothetical protein yxiM
4gir.1.A	8.70	homo-octamer	HHblits	X-ray	2.00Å	0.25	0.27	Enolase
4koa.1.A	7.35	homo-dimer	HHblits	X-ray	1.93Å	0.26	0.27	1,5-anhydro-D-fructose reductase
4ppy.1.A	13.64	homo-dimer	HHblits	X-ray	2.00Å	0.28	0.26	Putative acylhydrolase
3t4w.1.A	8.70	homo-octamer	HHblits	X-ray	2.52Å	0.25	0.27	Mandelate racemase/muconate lactonizing enzyme family protein
3rcy.1.A	8.70	homo-octamer	HHblits	X-ray	1.99Å	0.24	0.27	Mandelate racemase/muconate lactonizing enzyme-like protein
2glx.1.A	5.88	monomer	HHblits	X-ray	2.20Å	0.25	0.27	1,5-anhydro-D-fructose reductase
1yzf.1.A	12.12	monomer	HHblits	X-ray	1.90Å	0.27	0.26	lipase/acylhydrolase
1j00.1.A	18.46	monomer	HHblits	X-ray	2.00Å	0.28	0.25	Thioesterase I
1u8u.1.A	18.46	monomer	HHblits	X-ray	2.08Å	0.28	0.25	Acyl-CoA thioesterase I
3f4l.1.A	13.43	homo-dimer	HHblits	X-ray	2.00Å	0.26	0.26	Putative oxidoreductase yhhX
3qlt.1.A	23.44	homo-dimer	HHblits	X-ray	2.99Å	0.29	0.25	Glutamate receptor, ionotropic kainate 2
3qlu.1.B	23.44	hetero-oligomer	HHblits	X-ray	2.91Å	0.29	0.25	Glutamate receptor, ionotropic kainate 2
3hp4.1.A	8.96	monomer	HHblits	X-ray	1.35Å	0.25	0.26	GDSL-esterase
3iht.1.A	15.38	homo-dimer	HHblits	X-ray	1.80Å	0.27	0.25	S-adenosyl-L-methionine methyl transferase
3iht.1.B	15.38	homo-dimer	HHblits	X-ray	1.80Å	0.27	0.25	S-adenosyl-L-methionine methyl transferase
4c1b.2.A	9.09	homo-dimer	HHblits	X-ray	2.50Å	0.26	0.26	ORF1-ENCODED PROTEIN
4c1b.1.B	9.09	homo-dimer	HHblits	X-ray	2.50Å	0.26	0.26	ORF1-ENCODED PROTEIN
4c1b.1.A	9.09	homo-dimer	HHblits	X-ray	2.50Å	0.26	0.26	ORF1-ENCODED PROTEIN
3q2k.1.A	10.77	homo-octamer	HHblits	X-ray	2.13Å	0.27	0.25	oxidoreductase
3q2k.1.B	10.77	homo-octamer	HHblits	X-ray	2.13Å	0.27	0.25	oxidoreductase
2dwu.1.A	16.13	homo-dimer	HHblits	X-ray	1.60Å	0.29	0.24	Glutamate racemase
2dwu.2.A	16.13	homo-dimer	HHblits	X-ray	1.60Å	0.29	0.24	Glutamate racemase
3ixl.1.A	16.13	monomer	HHblits	X-ray	1.45Å	0.29	0.24	Arylmalonate decarboxylase
1mxs.1.A	20.63	homo-trimer	HHblits	X-ray	2.20Å	0.28	0.25	KDPG Aldolase
2ze3.1.A	6.06	homo-dimer	HHblits	X-ray	1.65Å	0.24	0.26	DFA0005
2gzm.1.A	14.52	homo-dimer	HHblits	X-ray	1.99Å	0.28	0.24	Glutamate racemase
2gzm.1.B	14.52	homo-dimer	HHblits	X-ray	1.99Å	0.28	0.24	Glutamate racemase
2gzm.2.B	14.52	homo-dimer	HHblits	X-ray	1.99Å	0.28	0.24	Glutamate racemase
5b5s.1.A	9.23	monomer	HHblits	X-ray	1.50Å	0.24	0.25	Acetic acid
4nas.1.A	8.06	homo-dimer	HHblits	X-ray	1.92Å	0.27	0.24	Ribulose-bisphosphate carboxylase
4u63.1.A	9.52	monomer	HHblits	X-ray	1.67Å	0.26	0.25	DNA photolyase
4e38.1.A	4.69	homo-trimer	HHblits	X-ray	1.64Å	0.24	0.25	Keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase
4e38.1.C	4.69	homo-trimer	HHblits	X-ray	1.64Å	0.24	0.25	Keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase
4r9x.1.A	13.11	homo-dimer	HHblits	X-ray	1.85Å	0.27	0.24	Copper homeostasis protein CutC
4r9x.1.B	13.11	homo-dimer	HHblits	X-ray	1.85Å	0.27	0.24	Copper homeostasis protein CutC
3qvj.1.A	6.67	homo-hexamer	HHblits	X-ray	2.10Å	0.28	0.24	Putative hydantoin racemase
3qvl.1.A	5.00	homo-hexamer	HHblits	X-ray	1.82Å	0.27	0.24	Putative hydantoin racemase
2p2q.1.A	9.68	monomer	HHblits	X-ray	2.42Å	0.23	0.24	Acetyl-coenzyme A synthetase
1b73.1.A	22.81	homo-dimer	HHblits	X-ray	2.30Å	0.30	0.22	GLUTAMATE RACEMASE
5o8e.1.A	6.56	monomer	HHblits	X-ray	1.70Å	0.24	0.24	Deoxyribodipyrimidine photolyase
2p2f.1.A	8.06	monomer	HHblits	X-ray	2.58Å	0.23	0.24	Acetyl-coenzyme A synthetase
1pg3.1.A	8.06	monomer	HHblits	X-ray	2.30Å	0.23	0.24	acetyl-CoA synthetase
2vvt.1.A	12.07	homo-dimer	HHblits	X-ray	1.65Å	0.28	0.23	GLUTAMATE RACEMASE
2vvt.1.B	12.07	homo-dimer	HHblits	X-ray	1.65Å	0.28	0.23	GLUTAMATE RACEMASE
2jfw.1.A	14.04	homo-dimer	HHblits	X-ray	2.00Å	0.28	0.22	GLUTAMATE RACEMASE
2eq5.1.A	14.04	homo-dimer	HHblits	X-ray	2.20Å	0.28	0.22	228aa long hypothetical hydantoin racemase
2eq5.2.B	14.04	homo-dimer	HHblits	X-ray	2.20Å	0.28	0.22	228aa long hypothetical hydantoin racemase
4rfv.1.A	17.24	homo-dimer	HHblits	X-ray	1.69Å	0.26	0.23	Bifunctional enzyme CysN/CysC
2jfq.1.A	10.34	homo-dimer	HHblits	X-ray	2.15Å	0.26	0.23	GLUTAMATE RACEMASE
2jfq.1.B	10.34	homo-dimer	HHblits	X-ray	2.15Å	0.26	0.23	GLUTAMATE RACEMASE
4pz9.1.B	5.08	homo-dimer	HHblits	X-ray	1.94Å	0.24	0.23	Glucosyl-3-phosphoglycerate phosphatase
4pz9.1.A	5.08	homo-dimer	HHblits	X-ray	1.94Å	0.24	0.23	Glucosyl-3-phosphoglycerate phosphatase
4pza.1.B	5.08	homo-dimer	HHblits	X-ray	1.78Å	0.24	0.23	Glucosyl-3-phosphoglycerate phosphatase
3uho.1.A	12.28	monomer	HHblits	X-ray	2.20Å	0.27	0.22	Glutamate racemase
3uhf.2.A	12.28	monomer	HHblits	X-ray	1.83Å	0.27	0.22	Glutamate racemase
3uhp.1.A	12.28	monomer	HHblits	X-ray	2.79Å	0.27	0.22	Glutamate racemase
3a5d.1.A	11.11	hetero-oligomer	HHblits	X-ray	4.80Å	0.31	0.21	V-type ATP synthase alpha chain
3a5d.1.B	11.11	hetero-oligomer	HHblits	X-ray	4.80Å	0.31	0.21	V-type ATP synthase alpha chain
3a5d.2.C	11.11	hetero-oligomer	HHblits	X-ray	4.80Å	0.31	0.21	V-type ATP synthase alpha chain
3noy.1.A	14.55	homo-dimer	HHblits	X-ray	2.70Å	0.28	0.22	4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
3noy.2.A	14.55	homo-dimer	HHblits	X-ray	2.70Å	0.28	0.22	4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
2xec.1.A	18.87	homo-dimer	HHblits	X-ray	2.20Å	0.31	0.21	PUTATIVE MALEATE ISOMERASE
1wau.1.A	14.29	homo-trimer	HHblits	X-ray	2.80Å	0.25	0.22	KHG/KDPG ALDOLASE
1wbh.1.A	14.29	homo-trimer	HHblits	X-ray	1.55Å	0.25	0.22	KHG/KDPG ALDOLASE
2p2m.1.A	6.90	monomer	HHblits	X-ray	2.11Å	0.22	0.23	Acetyl-coenzyme A synthetase
4ix1.1.A	7.14	homo-dimer	HHblits	X-ray	2.80Å	0.25	0.22	hypothetical protein
4ix1.1.B	7.14	homo-dimer	HHblits	X-ray	2.80Å	0.25	0.22	hypothetical protein
2xed.1.A	17.31	monomer	HHblits	X-ray	1.95Å	0.30	0.20	PUTATIVE MALEATE ISOMERASE
1fq0.1.A	14.55	homo-trimer	HHblits	X-ray	2.10Å	0.25	0.22	KDPG ALDOLASE
1eua.1.C	14.55	homo-trimer	HHblits	X-ray	1.95Å	0.25	0.22	KDPG ALDOLASE
2dgd.1.A	13.21	homo-octamer	HHblits	X-ray	2.90Å	0.28	0.21	223aa long hypothetical arylmalonate decarboxylase
4fq7.1.A	11.54	homo-tetramer	HHblits	X-ray	3.00Å	0.29	0.20	Maleate cis-trans isomerase
1smk.1.B	8.93	homo-dimer	HHblits	X-ray	2.50Å	0.23	0.22	Malate dehydrogenase, glyoxysomal
1smk.1.A	8.93	homo-dimer	HHblits	X-ray	2.50Å	0.23	0.22	Malate dehydrogenase, glyoxysomal
1smk.2.A	8.93	homo-dimer	HHblits	X-ray	2.50Å	0.23	0.22	Malate dehydrogenase, glyoxysomal
1smk.2.B	8.93	homo-dimer	HHblits	X-ray	2.50Å	0.23	0.22	Malate dehydrogenase, glyoxysomal
1smk.3.B	8.93	homo-dimer	HHblits	X-ray	2.50Å	0.23	0.22	Malate dehydrogenase, glyoxysomal
1smk.4.A	8.93	homo-dimer	HHblits	X-ray	2.50Å	0.23	0.22	Malate dehydrogenase, glyoxysomal
1smk.4.B	8.93	homo-dimer	HHblits	X-ray	2.50Å	0.23	0.22	Malate dehydrogenase, glyoxysomal
1mxs.1.A	11.11	homo-trimer	HHblits	X-ray	2.20Å	0.26	0.21	KDPG Aldolase
2yw4.1.A	10.91	homo-trimer	HHblits	X-ray	2.53Å	0.24	0.22	4-hydroxy-2-oxoglutarate aldolase/2-deydro-3-deoxyphosphogluconate aldolase
1yht.1.A	9.43	monomer	HHblits	X-ray	2.00Å	0.27	0.21	DspB
4a3u.1.A	9.09	monomer	HHblits	X-ray	1.70Å	0.24	0.22	NADH\:FLAVIN OXIDOREDUCTASE/NADH OXIDASE
2q3r.1.A	15.09	monomer	HHblits	X-ray	2.00Å	0.26	0.21	12-oxophytodienoate reductase 1
4bk9.1.A	17.31	homo-trimer	HHblits	X-ray	2.77Å	0.27	0.20	2-DEHYDRO-3-DEOXYPHOSPHOGLUCONATE ALDOLASE/4-HYDROXY-2-OXO GLUTARATE ALDOLASE
1wa3.1.A	11.11	homo-trimer	HHblits	X-ray	1.90Å	0.24	0.21	2-KETO-3-DEOXY-6-PHOSPHOGLUCONATE ALDOLASE
4mwa.1.A	15.69	homo-tetramer	HHblits	X-ray	1.85Å	0.29	0.20	4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
4mwa.1.B	15.69	homo-tetramer	HHblits	X-ray	1.85Å	0.29	0.20	4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
4mwa.1.C	15.69	homo-tetramer	HHblits	X-ray	1.85Å	0.29	0.20	4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
4mwa.1.D	15.69	homo-tetramer	HHblits	X-ray	1.85Å	0.29	0.20	4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
4mwa.2.B	15.69	homo-tetramer	HHblits	X-ray	1.85Å	0.29	0.20	4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
4mwa.2.D	15.69	homo-tetramer	HHblits	X-ray	1.85Å	0.29	0.20	4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
2jfy.1.B	3.77	homo-dimer	HHblits	X-ray	1.90Å	0.26	0.21	GLUTAMATE RACEMASE
2jfz.1.A	3.77	homo-dimer	HHblits	X-ray	1.86Å	0.26	0.21	GLUTAMATE RACEMASE
2jfx.1.A	3.77	homo-dimer	HHblits	X-ray	2.30Å	0.26	0.21	GLUTAMATE RACEMASE
2jfx.1.B	3.77	homo-dimer	HHblits	X-ray	2.30Å	0.26	0.21	GLUTAMATE RACEMASE
2jfy.1.A	3.77	homo-dimer	HHblits	X-ray	1.90Å	0.26	0.21	GLUTAMATE RACEMASE
4b1f.1.B	3.77	homo-dimer	HHblits	X-ray	2.05Å	0.26	0.21	GLUTAMATE RACEMASE
2w4i.1.A	3.77	homo-tetramer	HHblits	X-ray	1.87Å	0.26	0.21	GLUTAMATE RACEMASE
4ccz.1.A	15.38	monomer	HHblits	X-ray	2.70Å	0.27	0.20	METHIONINE SYNTHASE
3bol.1.A	15.69	homo-dimer	HHblits	X-ray	1.85Å	0.28	0.20	5-methyltetrahydrofolate S-homocysteine methyltransferase
1q7m.2.A	15.69	monomer	HHblits	X-ray	2.10Å	0.28	0.20	5-methyltetrahydrofolate S-homocysteine methyltransferase
1q7q.1.A	15.69	monomer	HHblits	X-ray	3.10Å	0.28	0.20	5-methyltetrahydrofolate S-homocysteine methyltransferase
1q8a.2.A	15.69	monomer	HHblits	X-ray	1.70Å	0.28	0.20	5-methyltetrahydrofolate S-homocysteine methyltransferase
1fwr.1.A	15.38	homo-trimer	HHblits	X-ray	2.70Å	0.26	0.20	KDPG ALDOLASE
4fq5.1.A	10.00	homo-tetramer	HHblits	X-ray	2.10Å	0.29	0.20	Maleate cis-trans isomerase
4fq5.1.B	10.00	homo-tetramer	HHblits	X-ray	2.10Å	0.29	0.20	Maleate cis-trans isomerase
4ot7.1.A	9.26	monomer	HHblits	X-ray	1.80Å	0.23	0.21	NADH:flavin oxidoreductase/NADH oxidase
1jx6.1.A	13.21	monomer	HHblits	X-ray	1.50Å	0.23	0.21	LUXP PROTEIN
4mg4.1.A	14.29	homo-dimer	HHblits	X-ray	1.70Å	0.27	0.19	Phosphonomutase
4mg4.2.B	14.29	homo-dimer	HHblits	X-ray	1.70Å	0.27	0.19	Phosphonomutase
4dm7.1.A	7.84	homo-dimer	HHblits	X-ray	1.36Å	0.23	0.20	Putative hydrolase
1a96.1.A	14.29	homo-tetramer	HHblits	X-ray	2.00Å	0.26	0.19	XANTHINE-GUANINE PHOSPHORIBOSYLTRANSFERASE
1a96.1.C	14.29	homo-tetramer	HHblits	X-ray	2.00Å	0.26	0.19	XANTHINE-GUANINE PHOSPHORIBOSYLTRANSFERASE
1nul.1.B	14.29	homo-tetramer	HHblits	X-ray	1.80Å	0.26	0.19	XANTHINE-GUANINE PHOSPHORIBOSYLTRANSFERASE
4jls.2.A	14.29	homo-tetramer	HHblits	X-ray	2.20Å	0.26	0.19	Xanthine phosphoribosyltransferase
1a98.1.A	10.20	homo-tetramer	HHblits	X-ray	2.25Å	0.24	0.19	XANTHINE-GUANINE PHOSPHORIBOSYLTRANSFERASE
5aun.1.B	17.39	hetero-oligomer	HHblits	X-ray	1.63Å	0.29	0.18	ATPase involved in chromosome partitioning, ParA/MinD family, Mrp homolog
3vx3.1.A	17.39	homo-dimer	HHblits	X-ray	2.10Å	0.29	0.18	ATPase involved in chromosome partitioning, ParA/MinD family, Mrp homolog
5auq.3.A	17.39	homo-dimer	HHblits	X-ray	2.53Å	0.29	0.18	ATPase involved in chromosome partitioning, ParA/MinD family, Mrp homolog
3vx3.1.B	17.39	homo-dimer	HHblits	X-ray	2.10Å	0.29	0.18	ATPase involved in chromosome partitioning, ParA/MinD family, Mrp homolog
1a97.1.A	12.50	homo-tetramer	HHblits	X-ray	2.60Å	0.26	0.19	XANTHINE-GUANINE PHOSPHORIBOSYLTRANSFERASE
5dmm.1.A	8.16	monomer	HHblits	X-ray	1.78Å	0.24	0.19	Homocysteine S-methyltransferase
5dmn.1.A	8.16	homo-dimer	HHblits	X-ray	2.89Å	0.24	0.19	Homocysteine S-methyltransferase
1vdm.1.B	4.08	homo-12-mer	HHblits	X-ray	2.50Å	0.23	0.19	purine phosphoribosyltransferase
1vdm.1.A	4.08	homo-12-mer	HHblits	X-ray	2.50Å	0.23	0.19	purine phosphoribosyltransferase
1vdm.1.E	4.08	homo-12-mer	HHblits	X-ray	2.50Å	0.23	0.19	purine phosphoribosyltransferase
4c22.1.A	13.33	homo-hexamer	HHblits	X-ray	2.70Å	0.29	0.18	L-FUCOSE ISOMERASE
2bq8.1.A	10.64	monomer	HHblits	X-ray	2.20Å	0.25	0.18	TARTRATE-RESISTANT ACID PHOSPHATASE TYPE 5
1war.1.A	10.64	monomer	HHblits	X-ray	2.22Å	0.25	0.18	HUMAN PURPLE ACID PHOSPHATASE
4uhc.1.A	11.11	monomer	HHblits	X-ray	1.03Å	0.28	0.18	ESTERASE
4uhd.1.A	11.11	monomer	HHblits	X-ray	1.07Å	0.28	0.18	ESTERASE
4irx.1.A	20.93	monomer	HHblits	X-ray	1.45Å	0.30	0.17	Sugar ABC transporter, periplasmic sugar-binding protein
3ef6.1.A	27.50	monomer	HHblits	X-ray	1.80Å	0.35	0.16	Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase
4emi.1.A	27.50	monomer	HHblits	X-ray	1.81Å	0.35	0.16	TodA
4emj.1.A	27.50	hetero-oligomer	HHblits	X-ray	2.40Å	0.35	0.16	TodA
1iu9.1.A	17.07	monomer	HHblits	X-ray	2.04Å	0.32	0.16	aspartate racemase
4v4b.1.Z	19.05	hetero-oligomer	HHblits	EM	NA	0.29	0.16	60S ribosomal protein L8-A
3hay.1.D	24.39	hetero-oligomer	HHblits	X-ray	4.99Å	0.31	0.16	50S ribosomal protein L7Ae
4h4r.1.A	27.50	homo-dimer	HHblits	X-ray	1.40Å	0.32	0.16	Biphenyl dioxygenase ferredoxin reductase subunit
4h4v.1.A	27.50	homo-dimer	HHblits	X-ray	1.40Å	0.32	0.16	Biphenyl dioxygenase ferredoxin reductase subunit
2yvg.1.A	27.50	homo-dimer	HHblits	X-ray	1.60Å	0.32	0.16	Ferredoxin reductase
2yvj.1.A	27.50	hetero-oligomer	HHblits	X-ray	1.90Å	0.32	0.16	Ferredoxin reductase
2yvj.1.C	27.50	hetero-oligomer	HHblits	X-ray	1.90Å	0.32	0.16	Ferredoxin reductase
1d7y.1.A	27.50	homo-dimer	HHblits	X-ray	2.10Å	0.32	0.16	FERREDOXIN REDUCTASE
4h4x.1.A	27.50	homo-dimer	HHblits	X-ray	1.50Å	0.32	0.16	Biphenyl dioxygenase ferredoxin reductase subunit
2gr3.1.A	27.50	homo-dimer	HHblits	X-ray	1.50Å	0.32	0.16	ferredoxin reductase
4h4t.1.A	27.50	homo-dimer	HHblits	X-ray	1.50Å	0.32	0.16	Biphenyl dioxygenase ferredoxin reductase subunit
4h4z.1.A	27.50	homo-dimer	HHblits	X-ray	1.95Å	0.32	0.16	Biphenyl dioxygenase ferredoxin reductase subunit
4h4p.1.A	27.50	homo-dimer	HHblits	X-ray	1.50Å	0.32	0.16	Biphenyl dioxygenase ferredoxin reductase subunit
3beo.1.A	16.28	homo-dimer	HHblits	X-ray	1.70Å	0.27	0.17	UDP-N-acetylglucosamine 2-epimerase
3jah.57.A	25.00	monomer	HHblits	EM	NA	0.32	0.16	eS12
5k0y.1.d	25.00	hetero-oligomer	HHblits	EM	NA	0.32	0.16	40S ribosomal protein S12
3ics.1.A	30.00	homo-dimer	HHblits	X-ray	1.94Å	0.32	0.16	Coenzyme A-Disulfide Reductase
4ocg.1.A	21.95	homo-dimer	HHblits	X-ray	2.75Å	0.30	0.16	FAD-dependent pyridine nucleotide-disulphide oxidoreductase
4em3.1.A	17.07	homo-dimer	HHblits	X-ray	1.98Å	0.30	0.16	Coenzyme A disulfide reductase
1nhr.1.A	28.21	monomer	HHblits	X-ray	2.10Å	0.33	0.15	NADH PEROXIDASE
1f8w.1.A	28.21	homo-tetramer	HHblits	X-ray	2.45Å	0.33	0.15	NADH PEROXIDASE
1nhs.1.A	28.21	monomer	HHblits	X-ray	2.00Å	0.33	0.15	NADH PEROXIDASE
1joa.1.A	28.21	monomer	HHblits	X-ray	2.80Å	0.33	0.15	NADH PEROXIDASE
1nhp.1.A	28.21	monomer	HHblits	X-ray	2.00Å	0.33	0.15	NADH PEROXIDASE
3cpq.1.A	30.77	homo-dimer	HHblits	X-ray	1.90Å	0.33	0.15	50S ribosomal protein L30e
3noy.1.A	27.50	homo-dimer	HHblits	X-ray	2.70Å	0.31	0.16	4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
3noy.2.A	27.50	homo-dimer	HHblits	X-ray	2.70Å	0.31	0.16	4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
3nvi.2.B	25.00	hetero-oligomer	HHblits	X-ray	2.71Å	0.31	0.16	50S ribosomal protein L7Ae
3nmu.1.D	25.00	hetero-oligomer	HHblits	X-ray	2.73Å	0.31	0.16	50S ribosomal protein L7Ae
3nvk.1.C	25.00	hetero-oligomer	HHblits	X-ray	3.21Å	0.31	0.16	50S ribosomal protein L7Ae
3nvk.1.D	25.00	hetero-oligomer	HHblits	X-ray	3.21Å	0.31	0.16	50S ribosomal protein L7Ae
3nmu.2.B	25.00	hetero-oligomer	HHblits	X-ray	2.73Å	0.31	0.16	50S ribosomal protein L7Ae
1q1r.1.A	20.00	monomer	HHblits	X-ray	1.91Å	0.31	0.16	Putidaredoxin reductase
1q1w.2.A	20.00	monomer	HHblits	X-ray	2.60Å	0.31	0.16	Putidaredoxin reductase
3lxd.1.A	17.50	monomer	HHblits	X-ray	2.50Å	0.31	0.16	FAD-dependent pyridine nucleotide-disulphide oxidoreductase
2bc1.1.A	20.00	homo-dimer	HHblits	X-ray	2.15Å	0.31	0.16	NADH Oxidase
1w3e.1.A	28.21	monomer	HHblits	X-ray	1.77Å	0.33	0.15	50S RIBOSOMAL PROTEIN L30E
2fc3.1.A	25.00	monomer	HHblits	X-ray	1.56Å	0.31	0.16	50S ribosomal protein L7Ae
1xbi.1.A	21.95	monomer	HHblits	X-ray	1.45Å	0.29	0.16	50S ribosomal protein L7Ae
1sds.1.D	21.95	homo-trimer	HHblits	X-ray	1.80Å	0.29	0.16	50S ribosomal protein L7Ae
4nv3.1.A	17.50	monomer	HHblits	X-ray	1.09Å	0.31	0.16	Amino acid/amide ABC transporter substrate-binding protein, HAAT family
4obb.1.A	17.50	monomer	HHblits	X-ray	1.53Å	0.31	0.16	Amino acid/amide ABC transporter substrate-binding protein, HAAT family
4mwa.1.A	20.00	homo-tetramer	HHblits	X-ray	1.85Å	0.30	0.16	4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
4mwa.1.B	20.00	homo-tetramer	HHblits	X-ray	1.85Å	0.30	0.16	4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
4mwa.1.C	20.00	homo-tetramer	HHblits	X-ray	1.85Å	0.30	0.16	4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
4mwa.1.D	20.00	homo-tetramer	HHblits	X-ray	1.85Å	0.30	0.16	4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
4mwa.2.B	20.00	homo-tetramer	HHblits	X-ray	1.85Å	0.30	0.16	4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
4mwa.2.D	20.00	homo-tetramer	HHblits	X-ray	1.85Å	0.30	0.16	4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
4uhh.1.A	9.76	monomer	HHblits	X-ray	1.06Å	0.28	0.16	ESTERASE
3td9.1.A	20.00	homo-dimer	HHblits	X-ray	1.90Å	0.30	0.16	Branched chain amino acid ABC transporter, periplasmic amino acid-binding protein
1yjn.1.H	17.50	hetero-oligomer	HHblits	X-ray	3.00Å	0.30	0.16	50S ribosomal protein L7AE
3nta.1.A	22.50	homo-dimer	HHblits	X-ray	2.01Å	0.30	0.16	FAD-dependent pyridine nucleotide-disulphide oxidoreductase
3ntd.1.A	22.50	homo-dimer	HHblits	X-ray	1.99Å	0.30	0.16	FAD-dependent pyridine nucleotide-disulphide oxidoreductase
3nt6.1.A	22.50	homo-dimer	HHblits	X-ray	2.00Å	0.30	0.16	FAD-dependent pyridine nucleotide-disulphide oxidoreductase
4u56.137.A	25.64	monomer	HHblits	X-ray	3.45Å	0.32	0.15	60S ribosomal protein L30
1nmu.2.B	25.64	hetero-oligomer	HHblits	X-ray	2.31Å	0.32	0.15	60S ribosomal protein L30
1cn7.1.A	25.64	monomer	HHblits	NMR	NA	0.32	0.15	60S RIBOSOMAL PROTEIN L30E
1ck2.1.A	25.64	monomer	HHblits	NMR	NA	0.32	0.15	60S RIBOSOMAL PROTEIN L30
1nmu.1.B	25.64	hetero-oligomer	HHblits	X-ray	2.31Å	0.32	0.15	60S ribosomal protein L30
4u4o.138.A	25.64	monomer	HHblits	X-ray	3.60Å	0.32	0.15	60S ribosomal protein L30
5dgf.62.A	25.64	monomer	HHblits	X-ray	3.30Å	0.32	0.15	60S ribosomal protein L30
5mei.70.A	25.64	monomer	HHblits	X-ray	3.50Å	0.32	0.15	60S ribosomal protein L30
5m1j.39.A	25.64	monomer	HHblits	EM	3.30Å	0.32	0.15	60S ribosomal protein L30
4x2r.1.A	20.00	monomer	HHblits	X-ray	1.05Å	0.30	0.16	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase
3ot5.1.A	9.30	monomer	HHblits	X-ray	2.20Å	0.24	0.17	UDP-N-acetylglucosamine 2-epimerase
3ot5.2.A	9.30	monomer	HHblits	X-ray	2.20Å	0.24	0.17	UDP-N-acetylglucosamine 2-epimerase
5fs9.1.A	12.50	monomer	HHblits	X-ray	1.75Å	0.30	0.16	APOPTOSIS-INDUCING FACTOR 1, MITOCHONDRIAL
4fdc.1.A	12.50	monomer	HHblits	X-ray	2.40Å	0.30	0.16	Apoptosis-inducing factor 1, mitochondrial
5fs6.1.A	12.50	monomer	HHblits	X-ray	1.90Å	0.30	0.16	APOPTOSIS-INDUCING FACTOR 1, MITOCHONDRIAL
4lii.1.A	12.50	monomer	HHblits	X-ray	1.88Å	0.30	0.16	Apoptosis-inducing factor 1, mitochondrial
5fs8.1.A	12.50	monomer	HHblits	X-ray	1.40Å	0.30	0.16	APOPTOSIS-INDUCING FACTOR 1, MITOCHONDRIAL
5fs7.1.A	12.50	monomer	HHblits	X-ray	1.85Å	0.30	0.16	APOPTOSIS-INDUCING FACTOR 1, MITOCHONDRIAL
5fmh.1.A	12.50	monomer	HHblits	X-ray	1.80Å	0.30	0.16	APOPTOSIS-INDUCING FACTOR 1, MITOCHONDRIAL
1m6i.1.A	12.50	monomer	HHblits	X-ray	1.80Å	0.30	0.16	Programmed cell death protein 8
3j7a.1.R	15.00	hetero-oligomer	HHblits	EM	NA	0.30	0.16	40S ribosomal protein eS12
4eqx.1.A	17.50	homo-dimer	HHblits	X-ray	1.70Å	0.30	0.16	Coenzyme A disulfide reductase
1yqz.1.A	17.50	homo-dimer	HHblits	X-ray	1.54Å	0.30	0.16	coenzyme A disulfide reductase
4emw.1.A	17.50	homo-dimer	HHblits	X-ray	2.39Å	0.30	0.16	Coenzyme A disulfide reductase
4eqw.1.A	17.50	homo-dimer	HHblits	X-ray	1.50Å	0.30	0.16	Coenzyme A disulfide reductase
5lyb.41.A	17.50	monomer	HHblits	X-ray	3.25Å	0.30	0.16	60S ribosomal protein L8-A
5tga.116.A	17.50	monomer	HHblits	X-ray	3.30Å	0.30	0.16	60S ribosomal protein L8-A
5m1j.47.A	17.50	monomer	HHblits	EM	3.30Å	0.30	0.16	60S ribosomal protein L8-A
5lzz.57.A	20.51	monomer	HHblits	EM	3.47Å	0.31	0.15	40S ribosomal protein S12
4ujc.57.A	20.51	monomer	HHblits	EM	9.50Å	0.31	0.15	40S RIBOSOMAL PROTEIN ES12
5aj0.58.A	20.51	monomer	HHblits	EM	3.50Å	0.31	0.15	40S ribosomal protein S12
4kzx.1.M	20.51	hetero-oligomer	HHblits	X-ray	7.81Å	0.31	0.15	40S ribosomal protein S12
5vyc.5.M	20.51	hetero-oligomer	HHblits	X-ray	6.00Å	0.31	0.15	40S ribosomal protein S12
3cge.1.A	9.76	homo-dimer	HHblits	X-ray	2.26Å	0.27	0.16	Pyridine nucleotide-disulfide oxidoreductase, class I
3pla.1.C	28.21	hetero-oligomer	HHblits	X-ray	3.15Å	0.31	0.15	50S ribosomal protein L7Ae
5jpq.1.U	28.21	hetero-oligomer	HHblits	EM	NA	0.31	0.15	Snu13
3lb8.1.A	20.51	hetero-oligomer	HHblits	X-ray	2.60Å	0.31	0.15	Putidaredoxin reductase
3lb8.2.A	20.51	hetero-oligomer	HHblits	X-ray	2.60Å	0.31	0.15	Putidaredoxin reductase
4kv7.1.A	15.38	monomer	HHblits	X-ray	1.20Å	0.31	0.15	Probable leucine/isoleucine/valine-binding protein
2czw.1.A	23.08	monomer	HHblits	X-ray	1.90Å	0.31	0.15	50S ribosomal protein L7Ae
3kd9.1.A	12.50	homo-dimer	HHblits	X-ray	2.75Å	0.29	0.16	Coenzyme A disulfide reductase
4fx9.1.A	12.50	homo-dimer	HHblits	X-ray	2.70Å	0.29	0.16	Coenzyme A disulfide reductase
3paf.1.A	22.50	monomer	HHblits	X-ray	1.70Å	0.29	0.16	50S ribosomal protein L7Ae
3paf.2.A	22.50	monomer	HHblits	X-ray	1.70Å	0.29	0.16	50S ribosomal protein L7Ae
4bts.100.A	20.00	monomer	HHblits	X-ray	3.70Å	0.29	0.16	40S RIBOSOMAL PROTEIN RPS12E
4v5o.2.3	20.00	hetero-oligomer	HHblits	X-ray	3.93Å	0.29	0.16	RIBOSOMAL PROTEIN L7AE CONTAINING PROTEIN
4v5o.1.3	20.00	hetero-oligomer	HHblits	X-ray	3.93Å	0.29	0.16	RIBOSOMAL PROTEIN L7AE CONTAINING PROTEIN
1rlg.1.B	17.50	monomer	HHblits	X-ray	2.70Å	0.28	0.16	50S ribosomal protein L7Ae
1rlg.2.B	17.50	monomer	HHblits	X-ray	2.70Å	0.28	0.16	50S ribosomal protein L7Ae
3i09.1.A	17.95	monomer	HHblits	X-ray	1.80Å	0.30	0.15	Periplasmic branched-chain amino acid-binding protein
3hjw.1.C	23.08	hetero-oligomer	HHblits	X-ray	2.35Å	0.30	0.15	50S ribosomal protein L7Ae
4by9.1.D	23.08	hetero-oligomer	HHblits	NMR	NA	0.30	0.15	50S RIBOSOMAL PROTEIN L7AE
4by9.1.G	23.08	hetero-oligomer	HHblits	NMR	NA	0.30	0.15	50S RIBOSOMAL PROTEIN L7AE
4by9.1.J	23.08	hetero-oligomer	HHblits	NMR	NA	0.30	0.15	50S RIBOSOMAL PROTEIN L7AE
4by9.1.M	23.08	hetero-oligomer	HHblits	NMR	NA	0.30	0.15	50S RIBOSOMAL PROTEIN L7AE
4eqr.1.A	17.95	homo-dimer	HHblits	X-ray	1.80Å	0.30	0.15	Coenzyme A disulfide reductase
1vzw.1.A	20.00	monomer	HHblits	X-ray	1.80Å	0.28	0.16	PHOSPHORIBOSYL ISOMERASE A
2vep.1.A	20.00	monomer	HHblits	X-ray	1.80Å	0.28	0.16	PHOSPHORIBOSYL ISOMERASE A
4bur.1.A	12.82	monomer	HHblits	X-ray	2.88Å	0.30	0.15	APOPTOSIS INDUCING FACTOR 1, MITOCHONDRIAL
4bur.3.A	12.82	monomer	HHblits	X-ray	2.88Å	0.30	0.15	APOPTOSIS INDUCING FACTOR 1, MITOCHONDRIAL
5kvi.1.A	12.82	monomer	HHblits	X-ray	2.00Å	0.30	0.15	Apoptosis-inducing factor 1, mitochondrial
1gv4.1.A	12.82	monomer	HHblits	X-ray	2.00Å	0.30	0.15	PROGRAMED CELL DEATH PROTEIN 8
3gd4.1.A	12.82	homo-dimer	HHblits	X-ray	2.24Å	0.30	0.15	Apoptosis-inducing factor 1, mitochondrial
3gd4.1.B	12.82	homo-dimer	HHblits	X-ray	2.24Å	0.30	0.15	Apoptosis-inducing factor 1, mitochondrial
3gd3.1.A	12.82	monomer	HHblits	X-ray	2.95Å	0.30	0.15	Apoptosis-inducing factor 1, mitochondrial
3gd3.2.A	12.82	monomer	HHblits	X-ray	2.95Å	0.30	0.15	Apoptosis-inducing factor 1, mitochondrial
3gd3.4.A	12.82	monomer	HHblits	X-ray	2.95Å	0.30	0.15	Apoptosis-inducing factor 1, mitochondrial
5kvh.1.A	12.82	homo-dimer	HHblits	X-ray	2.27Å	0.30	0.15	Apoptosis-inducing factor 1, mitochondrial
5miu.1.A	12.82	monomer	HHblits	X-ray	3.50Å	0.30	0.15	Apoptosis-inducing factor 1, mitochondrial
5miv.1.A	12.82	homo-dimer	HHblits	X-ray	3.10Å	0.30	0.15	Apoptosis-inducing factor 1, mitochondrial
5miv.1.B	12.82	homo-dimer	HHblits	X-ray	3.10Å	0.30	0.15	Apoptosis-inducing factor 1, mitochondrial
4v6w.7.A	23.08	monomer	HHblits	EM	NA	0.30	0.15	40S ribosomal protein S12
2v3a.1.A	10.00	monomer	HHblits	X-ray	2.40Å	0.28	0.16	RUBREDOXIN REDUCTASE
2v3b.1.A	10.00	hetero-oligomer	HHblits	X-ray	2.45Å	0.28	0.16	RUBREDOXIN REDUCTASE
3o85.1.A	20.51	monomer	HHblits	X-ray	1.81Å	0.30	0.15	Ribosomal protein L7Ae
4lck.1.A	20.51	monomer	HHblits	X-ray	3.20Å	0.30	0.15	Ribosomal protein YbxF
4lck.2.A	20.51	monomer	HHblits	X-ray	3.20Å	0.30	0.15	Ribosomal protein YbxF
3v7e.1.A	20.51	monomer	HHblits	X-ray	2.80Å	0.30	0.15	Ribosome-associated protein L7Ae-like
4tzz.2.A	20.51	monomer	HHblits	X-ray	3.64Å	0.30	0.15	Ribosome-associated protein L7Ae-like
4tzp.2.A	20.51	monomer	HHblits	X-ray	8.50Å	0.30	0.15	Ribosome-associated protein L7Ae-like
4tzw.1.A	20.51	monomer	HHblits	X-ray	4.67Å	0.30	0.15	Ribosome-associated protein L7Ae-like
1m90.1.H	15.38	hetero-oligomer	HHblits	X-ray	2.80Å	0.29	0.15	RIBOSOMAL PROTEIN L7AE
2cdu.1.A	15.38	homo-dimer	HHblits	X-ray	1.80Å	0.29	0.15	NADPH OXIDASE
4ys6.1.A	21.05	monomer	HHblits	X-ray	1.70Å	0.31	0.15	Putative solute-binding component of ABC transporter
3iwa.1.A	12.50	homo-dimer	HHblits	X-ray	2.30Å	0.27	0.16	FAD-dependent pyridine nucleotide-disulphide oxidoreductase
4evs.1.A	12.82	monomer	HHblits	X-ray	1.45Å	0.29	0.15	PUTATIVE ABC TRANSPORTER SUBUNIT, SUBSTRATE-BINDING COMPONENT
5dcv.1.A	23.68	monomer	HHblits	X-ray	3.40Å	0.31	0.15	50S ribosomal protein L7Ae
5dcv.2.A	23.68	monomer	HHblits	X-ray	3.40Å	0.31	0.15	50S ribosomal protein L7Ae
3n0x.1.A	20.00	monomer	HHblits	X-ray	1.50Å	0.27	0.16	Possible substrate binding protein of ABC transporter system
3sg0.1.A	15.38	monomer	HHblits	X-ray	1.20Å	0.29	0.15	Extracellular ligand-binding receptor
4gnr.1.A	5.00	monomer	HHblits	X-ray	1.00Å	0.27	0.16	ABC transporter substrate-binding protein-branched chain amino acid transport
3cgb.1.A	7.50	homo-dimer	HHblits	X-ray	1.90Å	0.27	0.16	Pyridine nucleotide-disulfide oxidoreductase, class I
3ukj.1.A	10.26	monomer	HHblits	X-ray	1.60Å	0.29	0.15	Extracellular ligand-binding receptor
3ipc.1.A	12.82	monomer	HHblits	X-ray	1.30Å	0.29	0.15	ABC transporter, substrate binding protein (Amino acid)
3tdn.1.A	2.44	homo-dimer	HHblits	X-ray	1.40Å	0.24	0.16	FLR SYMMETRIC ALPHA-BETA TIM BARREL
5fj4.1.C	15.38	hetero-oligomer	HHblits	X-ray	2.95Å	0.28	0.15	50S RIBOSOMAL PROTEIN L7AE
5fj4.2.C	15.38	hetero-oligomer	HHblits	X-ray	2.95Å	0.28	0.15	50S RIBOSOMAL PROTEIN L7AE
4mlc.1.A	15.00	monomer	HHblits	X-ray	2.71Å	0.26	0.16	Extracellular ligand-binding receptor
4q6b.1.A	15.00	monomer	HHblits	X-ray	1.67Å	0.26	0.16	Extracellular ligand-binding receptor
3h5l.1.A	12.82	monomer	HHblits	X-ray	1.70Å	0.28	0.15	putative Branched-chain amino acid ABC transporter
3hyv.1.A	21.05	homo-trimer	HHblits	X-ray	2.30Å	0.30	0.15	Sulfide-quinone reductase
3n0w.1.A	15.38	monomer	HHblits	X-ray	1.88Å	0.28	0.15	ABC branched chain amino acid family transporter, periplasmic ligand binding protein
5er0.1.A	18.42	homo-dimer	HHblits	X-ray	2.41Å	0.29	0.15	NADH oxidase
5voh.1.A	18.42	homo-tetramer	HHblits	X-ray	2.30Å	0.29	0.15	NADH oxidase
3nnd.1.A	20.51	homo-tetramer	HHblits	X-ray	2.80Å	0.27	0.15	Possible substrate binding protein of ABC transporter system
5l1n.1.A	13.16	homo-dimer	HHblits	X-ray	3.60Å	0.29	0.15	Coenzyme A disulfide reductase
4jb0.1.A	7.69	monomer	HHblits	X-ray	1.91Å	0.27	0.15	branched-chain amino acid transport system substrate-binding protein
4qwv.1.A	12.82	monomer	HHblits	X-ray	2.45Å	0.27	0.15	High-affinity leucine-specific transport system periplasmic binding protein, Chemotaxis protein CheY
3ipa.1.A	13.16	monomer	HHblits	X-ray	1.55Å	0.29	0.15	ABC transporter, substrate binding protein (Amino acid)
2x30.1.A	21.05	monomer	HHblits	X-ray	1.95Å	0.28	0.15	PHOSPHORIBOSYL ISOMERASE A
4kqc.1.A	18.92	monomer	HHblits	X-ray	1.62Å	0.30	0.15	Periplasmic binding protein/LacI transcriptional regulator
5l2e.1.A	18.42	homo-dimer	HHblits	X-ray	4.15Å	0.28	0.15	Glutamate receptor ionotropic, delta-2,Glutamate receptor ionotropic, delta-2
3qlt.1.A	10.26	homo-dimer	HHblits	X-ray	2.99Å	0.26	0.15	Glutamate receptor, ionotropic kainate 2
3qlu.1.B	10.26	hetero-oligomer	HHblits	X-ray	2.91Å	0.26	0.15	Glutamate receptor, ionotropic kainate 2
4eyk.1.A	10.53	monomer	HHblits	X-ray	1.90Å	0.27	0.15	Twin-arginine translocation pathway signal
1usi.1.A	13.16	monomer	HHblits	X-ray	1.80Å	0.27	0.15	LEUCINE-SPECIFIC BINDING PROTEIN
1usg.1.A	13.16	homo-dimer	HHblits	X-ray	1.53Å	0.27	0.15	LEUCINE-SPECIFIC BINDING PROTEIN
2lbp.1.A	13.16	monomer	HHblits	X-ray	2.40Å	0.27	0.15	LEUCINE-BINDING PROTEIN
1qnl.1.A	5.13	homo-tetramer	HHblits	X-ray	2.70Å	0.25	0.15	ALIPHATIC AMIDASE EXPRESSION-REGULATING PROTEIN
4q6w.1.A	7.89	monomer	HHblits	X-ray	1.84Å	0.26	0.15	Putative leu/ile/val-binding protein
1z16.1.A	13.16	monomer	HHblits	X-ray	1.72Å	0.26	0.15	Leu/Ile/Val-binding protein
1z15.1.A	13.16	monomer	HHblits	X-ray	1.70Å	0.26	0.15	Leu/Ile/Val-binding protein
2liv.1.A	13.16	monomer	HHblits	X-ray	2.40Å	0.26	0.15	LEUCINE
4f06.1.A	13.51	monomer	HHblits	X-ray	1.30Å	0.28	0.15	Extracellular ligand-binding receptor
4n0q.1.A	16.22	monomer	HHblits	X-ray	2.30Å	0.28	0.15	Leu/Ile/Val-binding protein homolog 3
3olz.1.A	5.13	homo-tetramer	HHblits	X-ray	2.75Å	0.24	0.15	Glutamate receptor, ionotropic kainate 3
3olz.1.B	5.13	homo-tetramer	HHblits	X-ray	2.75Å	0.24	0.15	Glutamate receptor, ionotropic kainate 3
4f06.1.A	5.26	monomer	HHblits	X-ray	1.30Å	0.26	0.15	Extracellular ligand-binding receptor
3i45.1.A	10.53	monomer	HHblits	X-ray	1.36Å	0.25	0.15	Twin-arginine translocation pathway signal protein
1zhh.1.A	15.79	hetero-oligomer	HHblits	X-ray	1.94Å	0.25	0.15	Autoinducer 2-binding periplasmic protein luxP
4evq.1.A	13.51	monomer	HHblits	X-ray	1.40Å	0.27	0.15	Putative ABC transporter subunit, substrate-binding component
3ukj.1.A	7.89	monomer	HHblits	X-ray	1.60Å	0.25	0.15	Extracellular ligand-binding receptor
3saj.1.A	2.50	homo-dimer	HHblits	X-ray	2.50Å	0.21	0.16	Glutamate receptor 1
3saj.1.B	2.50	homo-dimer	HHblits	X-ray	2.50Å	0.21	0.16	Glutamate receptor 1
3saj.2.A	2.50	homo-dimer	HHblits	X-ray	2.50Å	0.21	0.16	Glutamate receptor 1
3saj.2.B	2.50	homo-dimer	HHblits	X-ray	2.50Å	0.21	0.16	Glutamate receptor 1
3vrd.1.B	22.86	hetero-oligomer	HHblits	X-ray	1.50Å	0.31	0.14	Flavocytochrome c flavin subunit
4nv3.1.A	10.81	monomer	HHblits	X-ray	1.09Å	0.26	0.15	Amino acid/amide ABC transporter substrate-binding protein, HAAT family
4jb0.1.A	10.81	monomer	HHblits	X-ray	1.91Å	0.26	0.15	branched-chain amino acid transport system substrate-binding protein
3tx6.1.A	10.81	monomer	HHblits	X-ray	1.50Å	0.26	0.15	Putative branched-chain amino acid transport system substrate-binding protein
4maa.1.A	13.51	monomer	HHblits	X-ray	2.00Å	0.25	0.15	Putative branched-chain amino acid ABC transporter, periplasmic amino acid-binding protein
4maa.1.A	10.53	monomer	HHblits	X-ray	2.00Å	0.23	0.15	Putative branched-chain amino acid ABC transporter, periplasmic amino acid-binding protein
3td9.1.A	5.26	homo-dimer	HHblits	X-ray	1.90Å	0.23	0.15	Branched chain amino acid ABC transporter, periplasmic amino acid-binding protein
4evq.1.A	10.81	monomer	HHblits	X-ray	1.40Å	0.25	0.15	Putative ABC transporter subunit, substrate-binding component
2lbp.1.A	13.89	monomer	HHblits	X-ray	2.40Å	0.26	0.14	LEUCINE-BINDING PROTEIN
3uk0.1.A	8.11	monomer	HHblits	X-ray	1.49Å	0.24	0.15	Extracellular ligand-binding receptor
4dqd.1.A	11.11	monomer	HHblits	X-ray	1.60Å	0.26	0.14	Extracellular ligand-binding receptor
4kv7.1.A	11.11	monomer	HHblits	X-ray	1.20Å	0.26	0.14	Probable leucine/isoleucine/valine-binding protein
4mlc.1.A	8.57	monomer	HHblits	X-ray	2.71Å	0.28	0.14	Extracellular ligand-binding receptor
4q6b.1.A	8.57	monomer	HHblits	X-ray	1.67Å	0.28	0.14	Extracellular ligand-binding receptor
3h5l.1.A	11.11	monomer	HHblits	X-ray	1.70Å	0.26	0.14	putative Branched-chain amino acid ABC transporter
3ipa.1.A	14.29	monomer	HHblits	X-ray	1.55Å	0.27	0.14	ABC transporter, substrate binding protein (Amino acid)
1qo0.1.A	2.78	hetero-oligomer	HHblits	X-ray	2.25Å	0.25	0.14	AMIC
1pea.1.A	2.78	homo-dimer	HHblits	X-ray	2.10Å	0.25	0.14	AMIDASE OPERON
1nvm.1.B	17.65	hetero-oligomer	HHblits	X-ray	1.70Å	0.29	0.13	acetaldehyde dehydrogenase (acylating)
1nvm.2.B	17.65	hetero-oligomer	HHblits	X-ray	1.70Å	0.29	0.13	acetaldehyde dehydrogenase (acylating)
3sg0.1.A	8.33	monomer	HHblits	X-ray	1.20Å	0.25	0.14	Extracellular ligand-binding receptor
4mmw.1.A	14.29	homo-dimer	HHblits	X-ray	1.65Å	0.26	0.14	Isomerase/lactonizing enzyme
3hut.1.A	21.21	monomer	HHblits	X-ray	1.93Å	0.31	0.13	putative branched-chain amino acid ABC transporter
3ijd.1.A	14.71	homo-dimer	HHblits	X-ray	2.00Å	0.28	0.13	uncharacterized protein
1qnl.1.A	5.71	homo-tetramer	HHblits	X-ray	2.70Å	0.25	0.14	ALIPHATIC AMIDASE EXPRESSION-REGULATING PROTEIN
1usi.1.A	21.21	monomer	HHblits	X-ray	1.80Å	0.29	0.13	LEUCINE-SPECIFIC BINDING PROTEIN
1usg.1.A	21.21	homo-dimer	HHblits	X-ray	1.53Å	0.29	0.13	LEUCINE-SPECIFIC BINDING PROTEIN
5fwy.1.B	8.33	hetero-oligomer	HHblits	X-ray	2.12Å	0.21	0.14	GLUTAMATE RECEPTOR 3
2rdm.1.A	21.21	homo-hexamer	HHblits	X-ray	1.76Å	0.28	0.13	Response regulator receiver protein
2rdm.1.B	21.21	homo-hexamer	HHblits	X-ray	1.76Å	0.28	0.13	Response regulator receiver protein
2rdm.1.C	21.21	homo-hexamer	HHblits	X-ray	1.76Å	0.28	0.13	Response regulator receiver protein
4mp3.1.A	21.88	homo-dimer	HHblits	X-ray	2.11Å	0.30	0.13	Putative ornithine cyclodeaminase
2q5c.1.A	15.15	monomer	HHblits	X-ray	1.49Å	0.27	0.13	NtrC family transcriptional regulator
3o2j.1.A	2.86	homo-dimer	HHblits	X-ray	1.95Å	0.22	0.14	Glutamate receptor 2
3o2j.1.B	2.86	homo-dimer	HHblits	X-ray	1.95Å	0.22	0.14	Glutamate receptor 2
3ipc.1.A	12.50	monomer	HHblits	X-ray	1.30Å	0.27	0.13	ABC transporter, substrate binding protein (Amino acid)
2vdc.1.G	23.33	hetero-oligomer	HHblits	EM	9.50Å	0.32	0.12	GLUTAMATE SYNTHASE [NADPH] SMALL CHAIN
4e38.1.A	26.67	homo-trimer	HHblits	X-ray	1.64Å	0.32	0.12	Keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase
4e38.1.C	26.67	homo-trimer	HHblits	X-ray	1.64Å	0.32	0.12	Keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase
3nzg.1.A	3.13	homo-octamer	HHblits	X-ray	2.00Å	0.24	0.13	Putative racemase
5jca.1.A	25.00	hetero-oligomer	HHblits	X-ray	1.50Å	0.34	0.11	NADH-dependent Ferredoxin:NADP Oxidoreductase (NfnI) subunit alpha
2hqb.1.A	13.33	monomer	HHblits	X-ray	2.70Å	0.29	0.12	Transcriptional activator of comK gene
4mld.1.A	14.29	homo-dimer	HHblits	X-ray	2.88Å	0.29	0.11	Response regulator
4mld.1.B	14.29	homo-dimer	HHblits	X-ray	2.88Å	0.29	0.11	Response regulator
4mld.2.A	14.29	homo-dimer	HHblits	X-ray	2.88Å	0.29	0.11	Response regulator
4mld.2.B	14.29	homo-dimer	HHblits	X-ray	2.88Å	0.29	0.11	Response regulator
5n6y.1.B	13.79	hetero-oligomer	HHblits	X-ray	1.35Å	0.26	0.11	Nitrogenase vanadium-iron protein beta chain
2liv.1.A	23.08	monomer	HHblits	X-ray	2.40Å	0.29	0.10	LEUCINE
3i6r.1.A	26.09	monomer	HHblits	X-ray	2.50Å	0.33	0.09	Dihydroorotate dehydrogenase homolog, mitochondrial
3i68.1.A	26.09	monomer	HHblits	X-ray	2.40Å	0.33	0.09	Dihydroorotate dehydrogenase homolog, mitochondrial
5boo.1.A	26.09	monomer	HHblits	X-ray	2.80Å	0.33	0.09	Dihydroorotate dehydrogenase (quinone), mitochondrial
4zpj.1.A	8.00	monomer	HHblits	X-ray	2.24Å	0.25	0.10	Extracellular ligand-binding receptor
4n0q.1.A	13.04	monomer	HHblits	X-ray	2.30Å	0.26	0.09	Leu/Ile/Val-binding protein homolog 3
3vcr.1.A	22.73	homo-trimer	HHblits	X-ray	1.84Å	0.29	0.09	putative Kdpg (2-keto-3-deoxy-6-phosphogluconate) aldolase
3tq0.1.A	8.70	homo-dimer	HHblits	X-ray	1.90Å	0.24	0.09	Dihydroorotate dehydrogenase
1z16.1.A	19.05	monomer	HHblits	X-ray	1.72Å	0.28	0.08	Leu/Ile/Val-binding protein
1z15.1.A	19.05	monomer	HHblits	X-ray	1.70Å	0.28	0.08	Leu/Ile/Val-binding protein
4rv8.1.A	11.76	homo-tetramer	HHblits	X-ray	2.05Å	0.21	0.07	Inosine-5'-monophosphate dehydrogenase