SWISS-MODEL | Workspace | Model Results

SWISS-MODEL Homology Modelling Report

Model Building Report

This document lists the results for the homology modelling project "A4XR64" submitted to SWISS-MODEL workspace on Oct. 18, 2017, 4:49 p.m..The submitted primary amino acid sequence is given in Table T1.

If you use any results in your research, please cite the relevant publications:

Marco Biasini; Stefan Bienert; Andrew Waterhouse; Konstantin Arnold; Gabriel Studer; Tobias Schmidt; Florian Kiefer; Tiziano Gallo Cassarino; Martino Bertoni; Lorenza Bordoli; Torsten Schwede. (2014). SWISS-MODEL: modelling protein tertiary and quaternary structure using evolutionary information. Nucleic Acids Research (1 July 2014) 42 (W1): W252-W258; doi: 10.1093/nar/gku340.
Arnold, K., Bordoli, L., Kopp, J. and Schwede, T. (2006) The SWISS-MODEL workspace: a web-based environment for protein structure homology modelling. Bioinformatics, 22, 195-201.
Benkert, P., Biasini, M. and Schwede, T. (2011) Toward the estimation of the absolute quality of individual protein structure models. Bioinformatics, 27, 343-350

Results

The SWISS-MODEL template library (SMTL version 2017-10-11, PDB release 2017-10-06) was searched with Blast (Altschul et al., 1997) and HHBlits (Remmert, et al., 2011) for evolutionary related structures matching the target sequence in Table T1. For details on the template search, see Materials and Methods. Overall 922 templates were found (Table T2).

Models

The following model was built (see Materials and Methods "Model Building"):

Model #01	File	Built with	Oligo-State	Ligands	GMQE	QMEAN
	PDB	ProMod3 Version 1.1.0.	MONOMER (matching prediction)	1 x DGL: D-GLUTAMIC ACID;	0.75	-1.39

QMEAN	-1.39
Cβ	-0.63
All Atom	0.24
Solvation	0.68
Torsion	-1.47

Template	Seq Identity	Oligo-state	Found by	Method	Resolution	Seq Similarity	Range	Coverage	Description
5ijw.1.A	40.00	homo-dimer	HHblits	X-ray	1.76Å	0.39	1 - 257	0.97	Glutamate racemase

Ligand	Added to Model	Description
DGL	✓	D-GLUTAMIC ACID
DGL	✕ - Binding site not conserved.	D-GLUTAMIC ACID
IOD	✕ - Not biologically relevant.	IODIDE ION
IOD	✕ - Not biologically relevant.	IODIDE ION
IOD	✕ - Not biologically relevant.	IODIDE ION

Target    MNQSQAPVGVFDSGVGGLSVLREIRQLLPNESLLYVADSGHVPYGEKSAEYIRERCVLITEHLLAQGAKALVLACNTATA
5ijw.1.A  MSDRLAPIGIFDSGVGGLTVARAIIDQLPDEDIVYVGDTGNGPYGPLTIPQIRAHSLAIGDDLVSRGVKALVIACNTASS

Target    AAAAELRERYPQ-LPIVGM-EPAVKPAAAATRSGVVGVLATTGTLKSAKFAALLDRFASDVRVITQPCPGLVECIEAGAL
5ijw.1.A  ACLRDARERY-SPVPVVEVILPAVRRAVAATRNGRIGVIGTQATIASGAYQDAFAA-ARDTEVFTVACPRFVDFVERGVT

Target    QAPATRELLQGYVEPLLAEGCDTLILGCTHYPFLKPLLHSLVPDSVSLIDTGAAVARQLQRLLGQHELLATQ-P----AQ
5ijw.1.A  SGRQVLGLAEGYLEPLQLAEVDTLVLGCTHYPMLSGLIQLAMGDNVTLVSSAEETAKDLLRVLTELDLLRPHPDDPSVTA

Target    ATRYWSSGDIQRMQAVLPLLLGEQAQVHVF
5ijw.1.A  VRRFEATGDPEAFTALAARFLGPT------

Materials and Methods

Template Search

Template search with Blast and HHBlits has been performed against the SWISS-MODEL template library (SMTL, last update: 2017-10-11, last included PDB release: 2017-10-06).

The target sequence was searched with BLAST (Altschul et al., 1997) against the primary amino acid sequence contained in the SMTL. A total of 37 templates were found.

An initial HHblits profile has been built using the procedure outlined in (Remmert, et al., 2011), followed by 1 iteration of HHblits against NR20. The obtained profile has then be searched against all profiles of the SMTL. A total of 900 templates were found.

Template Selection

For each identified template, the template's quality has been predicted from features of the target-template alignment. The templates with the highest quality have then been selected for model building.

Model Building

Models are built based on the target-template alignment using ProMod3. Coordinates which are conserved between the target and the template are copied from the template to the model. Insertions and deletions are remodelled using a fragment library. Side chains are then rebuilt. Finally, the geometry of the resulting model is regularized by using a force field. In case loop modelling with ProMod3 fails, an alternative model is built with PROMOD-II (Guex, et al., 1997).

Model Quality Estimation

The global and per-residue model quality has been assessed using the QMEAN scoring function (Benkert, et al., 2011) . For improved performance, weights of the individual QMEAN terms have been trained specifically for SWISS-MODEL.

Ligand Modelling

Ligands present in the template structure are transferred by homology to the model when the following criteria are met (Gallo -Casserino, to be published): (a) The ligands are annotated as biologically relevant in the template library, (b) the ligand is in contact with the model, (c) the ligand is not clashing with the protein, (d) the residues in contact with the ligand are conserved between the target and the template. If any of these four criteria is not satisfied, a certain ligand will not be included in the model. The model summary includes information on why and which ligand has not been included.

Oligomeric State Conservation

Homo-oligomeric structure of the target protein is predicted based on the analysis of pairwise interfaces of the identified template structures. For each relevant interface between polypeptide chains (interfaces with more than 10 residue-residue interactions), the QscoreOligomer (Mariani et al., 2011) is predicted from features such as similarity to target and frequency of observing this interface in the identified templates (Kiefer, Bertoni, Biasini, to be published). The prediction is performed with a random forest regressor using these features as input parameters to predict the probability of conservation for each interface. The QscoreOligomer of the whole complex is then calculated as the weight-averaged QscoreOligomer of the interfaces. The oligomeric state of the target is predicted to be the same as in the template when QscoreOligomer is predicted to be higher or equal to 0.5.

References

Altschul, S.F., Madden, T.L., Schaffer, A.A., Zhang, J., Zhang, Z., Miller, W. and Lipman, D.J. (1997) Gapped BLAST and PSI-BLAST: a new generation of protein database search programs. Nucleic Acids Res, 25, 3389-3402.
Remmert, M., Biegert, A., Hauser, A. and Soding, J. (2012) HHblits: lightning-fast iterative protein sequence searching by HMM-HMM alignment. Nat Methods, 9, 173-175.
Guex, N. and Peitsch, M.C. (1997) SWISS-MODEL and the Swiss-PdbViewer: an environment for comparative protein modeling. Electrophoresis, 18, 2714-2723.
Sali, A. and Blundell, T.L. (1993) Comparative protein modelling by satisfaction of spatial restraints. J Mol Biol, 234, 779-815.
Benkert, P., Biasini, M. and Schwede, T. (2011) Toward the estimation of the absolute quality of individual protein structure models. Bioinformatics, 27, 343-350.
Mariani, V., Kiefer, F., Schmidt, T., Haas, J. and Schwede, T. (2011) Assessment of template based protein structure predictions in CASP9. Proteins, 79 Suppl 10, 37-58.

Table T1:

Primary amino acid sequence for which templates were searched and models were built.

MNQSQAPVGVFDSGVGGLSVLREIRQLLPNESLLYVADSGHVPYGEKSAEYIRERCVLITEHLLAQGAKALVLACNTATAAAAAELRERYPQLPIVGMEP
AVKPAAAATRSGVVGVLATTGTLKSAKFAALLDRFASDVRVITQPCPGLVECIEAGALQAPATRELLQGYVEPLLAEGCDTLILGCTHYPFLKPLLHSLV
PDSVSLIDTGAAVARQLQRLLGQHELLATQPAQATRYWSSGDIQRMQAVLPLLLGEQAQVHVF

Table T2:

Template	Seq Identity	Oligo-state	Found by	Method	Resolution	Seq Similarity	Coverage	Description
2vvt.1.A	34.88	homo-dimer	BLAST	X-ray	1.65Å	0.39	0.98	GLUTAMATE RACEMASE
2vvt.1.B	34.88	homo-dimer	BLAST	X-ray	1.65Å	0.39	0.98	GLUTAMATE RACEMASE
2jfp.1.A	34.88	homo-dimer	BLAST	X-ray	1.98Å	0.39	0.98	GLUTAMATE RACEMASE
2jfo.1.B	34.88	homo-dimer	BLAST	X-ray	2.50Å	0.39	0.98	GLUTAMATE RACEMASE
5ijw.1.A	40.00	homo-dimer	HHblits	X-ray	1.76Å	0.39	0.97	Glutamate racemase
5ijw.1.B	40.00	homo-dimer	HHblits	X-ray	1.76Å	0.39	0.97	Glutamate racemase
5ijw.1.A	41.67	homo-dimer	BLAST	X-ray	1.76Å	0.40	0.96	Glutamate racemase
5ijw.1.B	41.67	homo-dimer	BLAST	X-ray	1.76Å	0.40	0.96	Glutamate racemase
5hj7.1.A	39.06	homo-dimer	HHblits	X-ray	2.30Å	0.39	0.97	Glutamate racemase
5hj7.1.A	42.23	homo-dimer	BLAST	X-ray	2.30Å	0.40	0.95	Glutamate racemase
2jfp.1.A	34.65	homo-dimer	HHblits	X-ray	1.98Å	0.38	0.97	GLUTAMATE RACEMASE
2jfo.1.B	34.65	homo-dimer	HHblits	X-ray	2.50Å	0.38	0.97	GLUTAMATE RACEMASE
2ohv.1.A	33.86	homo-dimer	BLAST	X-ray	2.50Å	0.38	0.97	Glutamate Racemase
2ohg.1.A	33.86	homo-dimer	BLAST	X-ray	2.50Å	0.38	0.97	Glutamate racemase
2oho.1.A	33.86	homo-dimer	BLAST	X-ray	2.25Å	0.38	0.97	Glutamate Racemase
2oho.1.B	33.86	homo-dimer	BLAST	X-ray	2.25Å	0.38	0.97	Glutamate Racemase
2jfw.1.A	33.07	homo-dimer	HHblits	X-ray	2.00Å	0.38	0.97	GLUTAMATE RACEMASE
2vvt.1.A	34.92	homo-dimer	HHblits	X-ray	1.65Å	0.38	0.96	GLUTAMATE RACEMASE
2vvt.1.B	34.92	homo-dimer	HHblits	X-ray	1.65Å	0.38	0.96	GLUTAMATE RACEMASE
2dwu.1.A	33.07	homo-dimer	BLAST	X-ray	1.60Å	0.37	0.98	Glutamate racemase
2dwu.2.A	33.07	homo-dimer	BLAST	X-ray	1.60Å	0.37	0.98	Glutamate racemase
3hfr.1.A	34.92	homo-dimer	HHblits	X-ray	2.30Å	0.38	0.96	Glutamate racemase
3hfr.1.B	34.92	homo-dimer	HHblits	X-ray	2.30Å	0.38	0.96	Glutamate racemase
2jfn.1.A	40.00	monomer	BLAST	X-ray	1.90Å	0.38	0.95	GLUTAMATE RACEMASE
2gzm.1.A	34.92	homo-dimer	HHblits	X-ray	1.99Å	0.38	0.96	Glutamate racemase
2gzm.1.B	34.92	homo-dimer	HHblits	X-ray	1.99Å	0.38	0.96	Glutamate racemase
2gzm.2.B	34.92	homo-dimer	HHblits	X-ray	1.99Å	0.38	0.96	Glutamate racemase
2ohv.1.A	31.89	homo-dimer	HHblits	X-ray	2.50Å	0.37	0.97	Glutamate Racemase
2ohg.1.A	31.89	homo-dimer	HHblits	X-ray	2.50Å	0.37	0.97	Glutamate racemase
2oho.1.A	31.89	homo-dimer	HHblits	X-ray	2.25Å	0.37	0.97	Glutamate Racemase
2oho.1.B	31.89	homo-dimer	HHblits	X-ray	2.25Å	0.37	0.97	Glutamate Racemase
1zuw.1.A	32.94	homo-dimer	HHblits	X-ray	1.75Å	0.37	0.97	glutamate racemase 1
1zuw.1.B	32.94	homo-dimer	HHblits	X-ray	1.75Å	0.37	0.97	glutamate racemase 1
2gzm.1.A	36.29	homo-dimer	BLAST	X-ray	1.99Å	0.38	0.94	Glutamate racemase
2gzm.1.B	36.29	homo-dimer	BLAST	X-ray	1.99Å	0.38	0.94	Glutamate racemase
2gzm.2.B	36.29	homo-dimer	BLAST	X-ray	1.99Å	0.38	0.94	Glutamate racemase
2dwu.1.A	33.20	homo-dimer	HHblits	X-ray	1.60Å	0.37	0.96	Glutamate racemase
2dwu.2.A	33.20	homo-dimer	HHblits	X-ray	1.60Å	0.37	0.96	Glutamate racemase
2jfq.1.A	33.20	homo-dimer	BLAST	X-ray	2.15Å	0.37	0.96	GLUTAMATE RACEMASE
2jfq.1.B	33.20	homo-dimer	BLAST	X-ray	2.15Å	0.37	0.96	GLUTAMATE RACEMASE
2jfw.1.A	34.41	homo-dimer	BLAST	X-ray	2.00Å	0.39	0.94	GLUTAMATE RACEMASE
2jfn.1.A	38.40	monomer	HHblits	X-ray	1.90Å	0.37	0.95	GLUTAMATE RACEMASE
3hfr.1.A	36.33	homo-dimer	BLAST	X-ray	2.30Å	0.39	0.93	Glutamate racemase
3hfr.1.B	36.33	homo-dimer	BLAST	X-ray	2.30Å	0.39	0.93	Glutamate racemase
2jfq.1.A	33.60	homo-dimer	HHblits	X-ray	2.15Å	0.36	0.95	GLUTAMATE RACEMASE
2jfq.1.B	33.60	homo-dimer	HHblits	X-ray	2.15Å	0.36	0.95	GLUTAMATE RACEMASE
3out.1.A	29.20	homo-hexamer	HHblits	X-ray	1.65Å	0.36	0.95	Glutamate racemase
3out.1.A	30.52	homo-hexamer	BLAST	X-ray	1.65Å	0.36	0.95	Glutamate racemase
1b73.1.A	32.79	homo-dimer	BLAST	X-ray	2.30Å	0.37	0.93	GLUTAMATE RACEMASE
1b73.1.A	31.97	homo-dimer	HHblits	X-ray	2.30Å	0.37	0.93	GLUTAMATE RACEMASE
3uho.1.A	29.29	monomer	BLAST	X-ray	2.20Å	0.36	0.91	Glutamate racemase
3uhf.2.A	29.29	monomer	BLAST	X-ray	1.83Å	0.36	0.91	Glutamate racemase
3uhp.1.A	29.29	monomer	BLAST	X-ray	2.79Å	0.36	0.91	Glutamate racemase
5w1q.1.A	27.76	homo-dimer	HHblits	X-ray	1.95Å	0.34	0.93	Glutamate racemase
3uho.1.A	26.75	monomer	HHblits	X-ray	2.20Å	0.34	0.92	Glutamate racemase
3uhf.2.A	26.75	monomer	HHblits	X-ray	1.83Å	0.34	0.92	Glutamate racemase
3uhp.1.A	26.75	monomer	HHblits	X-ray	2.79Å	0.34	0.92	Glutamate racemase
2jfy.1.B	27.05	homo-dimer	HHblits	X-ray	1.90Å	0.34	0.93	GLUTAMATE RACEMASE
2jfz.1.A	27.05	homo-dimer	HHblits	X-ray	1.86Å	0.34	0.93	GLUTAMATE RACEMASE
2jfx.1.A	27.05	homo-dimer	HHblits	X-ray	2.30Å	0.34	0.93	GLUTAMATE RACEMASE
2jfx.1.B	27.05	homo-dimer	HHblits	X-ray	2.30Å	0.34	0.93	GLUTAMATE RACEMASE
2jfy.1.A	27.05	homo-dimer	HHblits	X-ray	1.90Å	0.34	0.93	GLUTAMATE RACEMASE
4b1f.1.B	27.05	homo-dimer	HHblits	X-ray	2.05Å	0.34	0.93	GLUTAMATE RACEMASE
2w4i.1.A	27.05	homo-tetramer	HHblits	X-ray	1.87Å	0.34	0.93	GLUTAMATE RACEMASE
5w1q.1.A	29.79	homo-dimer	BLAST	X-ray	1.95Å	0.35	0.89	Glutamate racemase
1zuw.1.A	36.73	homo-dimer	BLAST	X-ray	1.75Å	0.38	0.86	glutamate racemase 1
1zuw.1.B	36.73	homo-dimer	BLAST	X-ray	1.75Å	0.38	0.86	glutamate racemase 1
2jfy.1.B	31.74	homo-dimer	BLAST	X-ray	1.90Å	0.36	0.87	GLUTAMATE RACEMASE
2jfz.1.A	31.74	homo-dimer	BLAST	X-ray	1.86Å	0.36	0.87	GLUTAMATE RACEMASE
2jfx.1.A	31.74	homo-dimer	BLAST	X-ray	2.30Å	0.36	0.87	GLUTAMATE RACEMASE
2jfx.1.B	31.74	homo-dimer	BLAST	X-ray	2.30Å	0.36	0.87	GLUTAMATE RACEMASE
2jfy.1.A	31.74	homo-dimer	BLAST	X-ray	1.90Å	0.36	0.87	GLUTAMATE RACEMASE
4b1f.1.B	31.74	homo-dimer	BLAST	X-ray	2.05Å	0.36	0.87	GLUTAMATE RACEMASE
2w4i.1.A	31.74	homo-tetramer	BLAST	X-ray	1.87Å	0.36	0.87	GLUTAMATE RACEMASE
2dx7.1.A	24.02	homo-dimer	HHblits	X-ray	2.00Å	0.32	0.78	aspartate racemase
2dx7.1.B	24.02	homo-dimer	HHblits	X-ray	2.00Å	0.32	0.78	aspartate racemase
1jfl.1.A	24.63	homo-dimer	HHblits	X-ray	1.90Å	0.32	0.77	ASPARTATE RACEMASE
3s81.1.A	20.10	homo-dimer	HHblits	X-ray	1.80Å	0.31	0.78	Putative aspartate racemase
2eq5.1.A	19.90	homo-dimer	HHblits	X-ray	2.20Å	0.30	0.78	228aa long hypothetical hydantoin racemase
2eq5.2.B	19.90	homo-dimer	HHblits	X-ray	2.20Å	0.30	0.78	228aa long hypothetical hydantoin racemase
4fq7.1.A	16.27	homo-tetramer	HHblits	X-ray	3.00Å	0.28	0.79	Maleate cis-trans isomerase
4fq5.1.A	15.24	homo-tetramer	HHblits	X-ray	2.10Å	0.27	0.80	Maleate cis-trans isomerase
4fq5.1.B	15.24	homo-tetramer	HHblits	X-ray	2.10Å	0.27	0.80	Maleate cis-trans isomerase
5hqt.1.A	18.54	homo-dimer	HHblits	X-ray	1.60Å	0.29	0.78	aspartate/glutamate racemase
2zsk.1.A	20.30	homo-dimer	HHblits	X-ray	2.55Å	0.30	0.77	226aa long hypothetical aspartate racemase
2xed.1.A	14.98	monomer	HHblits	X-ray	1.95Å	0.28	0.79	PUTATIVE MALEATE ISOMERASE
2xec.1.A	15.53	homo-dimer	HHblits	X-ray	2.20Å	0.28	0.78	PUTATIVE MALEATE ISOMERASE
5elm.1.A	17.07	homo-dimer	HHblits	X-ray	2.00Å	0.28	0.78	Asp/Glu_racemase family protein
5elm.1.B	17.07	homo-dimer	HHblits	X-ray	2.00Å	0.28	0.78	Asp/Glu_racemase family protein
5elm.2.A	17.07	homo-dimer	HHblits	X-ray	2.00Å	0.28	0.78	Asp/Glu_racemase family protein
5elm.2.B	17.07	homo-dimer	HHblits	X-ray	2.00Å	0.28	0.78	Asp/Glu_racemase family protein
5b19.1.A	21.21	homo-dimer	HHblits	X-ray	1.85Å	0.31	0.75	Aspartate racemase
5b19.1.B	21.21	homo-dimer	HHblits	X-ray	1.85Å	0.31	0.75	Aspartate racemase
5ell.1.A	19.40	homo-dimer	HHblits	X-ray	1.80Å	0.29	0.76	Asp/Glu_racemase family protein
5ell.1.B	19.40	homo-dimer	HHblits	X-ray	1.80Å	0.29	0.76	Asp/Glu_racemase family protein
3ojc.1.A	19.60	homo-tetramer	HHblits	X-ray	1.75Å	0.30	0.76	Putative aspartate/glutamate racemase
3ojc.1.B	19.60	homo-tetramer	HHblits	X-ray	1.75Å	0.30	0.76	Putative aspartate/glutamate racemase
3ojc.1.C	19.60	homo-tetramer	HHblits	X-ray	1.75Å	0.30	0.76	Putative aspartate/glutamate racemase
3ojc.1.D	19.60	homo-tetramer	HHblits	X-ray	1.75Å	0.30	0.76	Putative aspartate/glutamate racemase
3qvl.1.A	18.81	homo-hexamer	HHblits	X-ray	1.82Å	0.28	0.77	Putative hydantoin racemase
4ix1.1.A	14.56	homo-dimer	HHblits	X-ray	2.80Å	0.26	0.78	hypothetical protein
4ix1.1.B	14.56	homo-dimer	HHblits	X-ray	2.80Å	0.26	0.78	hypothetical protein
3qvj.1.A	18.91	homo-hexamer	HHblits	X-ray	2.10Å	0.28	0.76	Putative hydantoin racemase
4zjp.1.A	15.92	monomer	HHblits	X-ray	1.63Å	0.28	0.76	Monosaccharide-transporting ATPase
5kws.1.A	17.82	monomer	HHblits	X-ray	1.32Å	0.28	0.77	Galactose-binding protein
2dgd.1.A	13.24	homo-octamer	HHblits	X-ray	2.90Å	0.26	0.78	223aa long hypothetical arylmalonate decarboxylase
2gx6.1.A	13.93	monomer	HHblits	X-ray	1.97Å	0.27	0.76	D-ribose-binding periplasmic protein
4rs3.1.A	13.00	monomer	HHblits	X-ray	1.40Å	0.27	0.76	ABC transporter, carbohydrate uptake transporter-2 (CUT2) family, periplasmic sugar-binding protein
3ma0.1.A	10.89	monomer	HHblits	X-ray	2.20Å	0.26	0.77	D-xylose-binding periplasmic protein
3m9w.1.A	10.89	monomer	HHblits	X-ray	2.15Å	0.26	0.77	D-xylose-binding periplasmic protein
5lfd.1.A	16.58	homo-hexamer	HHblits	X-ray	2.15Å	0.28	0.76	Allantoin racemase
4yv7.1.A	12.44	monomer	HHblits	X-ray	2.30Å	0.27	0.76	Periplasmic binding protein/LacI transcriptional regulator
3ixm.1.A	19.10	monomer	HHblits	X-ray	1.90Å	0.27	0.76	Arylmalonate decarboxylase
4ry9.1.A	12.87	monomer	HHblits	X-ray	1.40Å	0.26	0.77	Periplasmic binding protein/LacI transcriptional regulator
4y9t.1.A	12.94	monomer	HHblits	X-ray	1.80Å	0.27	0.76	ABC transporter, solute binding protein
3dtv.3.A	18.59	monomer	HHblits	X-ray	2.10Å	0.27	0.76	Arylmalonate decarboxylase
3dtv.2.A	18.59	monomer	HHblits	X-ray	2.10Å	0.27	0.76	Arylmalonate decarboxylase
3dtv.1.A	18.59	monomer	HHblits	X-ray	2.10Å	0.27	0.76	Arylmalonate decarboxylase
3dtv.4.A	18.59	monomer	HHblits	X-ray	2.10Å	0.27	0.76	Arylmalonate decarboxylase
3eis.1.A	18.59	monomer	HHblits	X-ray	2.10Å	0.27	0.76	Arylmalonate decarboxylase
3eis.2.A	18.59	monomer	HHblits	X-ray	2.10Å	0.27	0.76	Arylmalonate decarboxylase
3dg9.1.A	18.59	monomer	HHblits	X-ray	1.50Å	0.27	0.76	Arylmalonate decarboxylase
2vlb.1.A	18.59	monomer	HHblits	X-ray	1.92Å	0.27	0.76	ARYLMALONATE DECARBOXYLASE
2vlb.2.A	18.59	monomer	HHblits	X-ray	1.92Å	0.27	0.76	ARYLMALONATE DECARBOXYLASE
2vlb.3.A	18.59	monomer	HHblits	X-ray	1.92Å	0.27	0.76	ARYLMALONATE DECARBOXYLASE
2vlb.4.A	18.59	monomer	HHblits	X-ray	1.92Å	0.27	0.76	ARYLMALONATE DECARBOXYLASE
3ixl.1.A	18.09	monomer	HHblits	X-ray	1.45Å	0.27	0.76	Arylmalonate decarboxylase
5ix8.1.A	10.34	monomer	HHblits	X-ray	1.60Å	0.25	0.77	Putative sugar ABC transport system, substrate-binding protein
3hzr.1.A	14.87	homo-dimer	HHblits	X-ray	3.00Å	0.28	0.74	Tryptophanyl-tRNA synthetase
5dkv.1.A	10.89	monomer	HHblits	X-ray	1.68Å	0.25	0.77	ABC transporter substrate binding protein (Ribose)
5dkv.4.A	10.89	monomer	HHblits	X-ray	1.68Å	0.25	0.77	ABC transporter substrate binding protein (Ribose)
2qu7.1.A	12.82	homo-dimer	HHblits	X-ray	2.30Å	0.27	0.74	Putative transcriptional regulator
3ctp.1.A	12.76	homo-dimer	HHblits	X-ray	1.41Å	0.26	0.75	Periplasmic binding protein/LacI transcriptional regulator
2q5c.1.A	9.52	monomer	HHblits	X-ray	1.49Å	0.26	0.64	NtrC family transcriptional regulator
5odc.1.B	10.98	hetero-oligomer	HHblits	X-ray	2.30Å	0.26	0.62	Heterodisulfide reductase, subunit B
4rsm.1.A	16.46	monomer	HHblits	X-ray	1.60Å	0.29	0.60	Periplasmic binding protein/LacI transcriptional regulator
4wzz.1.A	12.42	monomer	HHblits	X-ray	1.70Å	0.27	0.61	Putative sugar ABC transporter, substrate-binding protein
3k9c.1.A	13.38	homo-dimer	HHblits	X-ray	2.14Å	0.27	0.60	Transcriptional regulator, LacI family protein
4ccz.1.A	16.56	monomer	HHblits	X-ray	2.70Å	0.28	0.57	METHIONINE SYNTHASE
3fwn.1.A	13.87	homo-dimer	HHblits	X-ray	1.50Å	0.27	0.52	6-phosphogluconate dehydrogenase, decarboxylating
3fwn.1.B	13.87	homo-dimer	HHblits	X-ray	1.50Å	0.27	0.52	6-phosphogluconate dehydrogenase, decarboxylating
5dmm.1.A	18.98	monomer	HHblits	X-ray	1.78Å	0.26	0.52	Homocysteine S-methyltransferase
5dmn.1.A	18.98	homo-dimer	HHblits	X-ray	2.89Å	0.26	0.52	Homocysteine S-methyltransferase
2w8z.1.A	11.11	homo-dimer	HHblits	X-ray	2.30Å	0.26	0.51	6-PHOSPHOGLUCONATE DEHYDROGENASE, DECARBOXYLATING
5a9r.1.A	19.38	homo-dimer	HHblits	X-ray	1.55Å	0.29	0.49	IMINE REDUCTASE
5a9s.1.A	19.38	hetero-oligomer	HHblits	X-ray	2.06Å	0.29	0.49	IMINE REDUCTASE
5fwn.1.B	19.38	homo-dimer	HHblits	X-ray	2.14Å	0.29	0.49	IMINE REDUCTASE
3obb.1.A	15.50	homo-tetramer	HHblits	X-ray	2.20Å	0.28	0.49	Probable 3-hydroxyisobutyrate dehydrogenase
3pef.1.A	13.95	homo-tetramer	HHblits	X-ray	2.07Å	0.27	0.49	6-phosphogluconate dehydrogenase, NAD-binding
3pef.2.C	13.95	homo-tetramer	HHblits	X-ray	2.07Å	0.27	0.49	6-phosphogluconate dehydrogenase, NAD-binding
2gf2.1.A	16.41	homo-dimer	HHblits	X-ray	2.38Å	0.27	0.49	3-hydroxyisobutyrate dehydrogenase
4mwa.1.A	17.60	homo-tetramer	HHblits	X-ray	1.85Å	0.28	0.48	4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
4mwa.1.B	17.60	homo-tetramer	HHblits	X-ray	1.85Å	0.28	0.48	4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
4mwa.1.C	17.60	homo-tetramer	HHblits	X-ray	1.85Å	0.28	0.48	4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
4mwa.1.D	17.60	homo-tetramer	HHblits	X-ray	1.85Å	0.28	0.48	4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
4mwa.2.B	17.60	homo-tetramer	HHblits	X-ray	1.85Å	0.28	0.48	4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
4mwa.2.D	17.60	homo-tetramer	HHblits	X-ray	1.85Å	0.28	0.48	4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
4fx7.1.A	14.96	monomer	HHblits	X-ray	2.08Å	0.27	0.48	Imidazole glycerol phosphate synthase subunit HisF
5bra.1.A	14.40	monomer	HHblits	X-ray	2.97Å	0.28	0.48	Putative periplasmic binding protein with substrate ribose
3t95.1.A	13.60	monomer	HHblits	X-ray	1.75Å	0.27	0.48	Autoinducer 2-binding protein lsrB
3tdn.1.A	15.20	homo-dimer	HHblits	X-ray	1.40Å	0.27	0.48	FLR SYMMETRIC ALPHA-BETA TIM BARREL
3rot.1.A	13.71	homo-dimer	HHblits	X-ray	1.91Å	0.27	0.47	ABC sugar transporter, periplasmic sugar binding protein
3gbv.1.A	9.60	homo-dimer	HHblits	X-ray	2.20Å	0.26	0.48	Putative LacI-family transcriptional regulator
3gbv.1.B	9.60	homo-dimer	HHblits	X-ray	2.20Å	0.26	0.48	Putative LacI-family transcriptional regulator
4gj1.1.A	15.32	monomer	HHblits	X-ray	2.15Å	0.26	0.47	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase
4axk.1.A	16.53	monomer	HHblits	X-ray	2.25Å	0.27	0.46	1-(5-PHOSPHORIBOSYL)-5-((5'-PHOSPHORIBOSYLAMINO) METHYLIDENEAMINO)IMIDAZOLE-4-CARBOXAMIDE ISOMERASE
4axk.2.A	16.53	monomer	HHblits	X-ray	2.25Å	0.27	0.46	1-(5-PHOSPHORIBOSYL)-5-((5'-PHOSPHORIBOSYLAMINO) METHYLIDENEAMINO)IMIDAZOLE-4-CARBOXAMIDE ISOMERASE
4x9s.1.A	19.83	monomer	HHblits	X-ray	1.60Å	0.27	0.46	Phosphoribosyl isomerase A
1vzw.1.A	18.33	monomer	HHblits	X-ray	1.80Å	0.28	0.46	PHOSPHORIBOSYL ISOMERASE A
2vep.1.A	18.33	monomer	HHblits	X-ray	1.80Å	0.28	0.46	PHOSPHORIBOSYL ISOMERASE A
2y88.1.A	16.39	monomer	HHblits	X-ray	1.33Å	0.26	0.46	PHOSPHORIBOSYL ISOMERASE A
2y89.1.A	16.39	monomer	HHblits	X-ray	2.50Å	0.26	0.46	PHOSPHORIBOSYL ISOMERASE A
2y85.1.A	16.39	monomer	HHblits	X-ray	2.40Å	0.26	0.46	PHOSPHORIBOSYL ISOMERASE A
3zs4.1.A	16.39	monomer	HHblits	X-ray	1.90Å	0.26	0.46	PHOSPHORIBOSYL ISOMERASE A
4ywh.1.A	8.94	monomer	HHblits	X-ray	2.35Å	0.26	0.47	ABC TRANSPORTER SOLUTE BINDING PROTEIN
4wxe.1.A	13.22	monomer	HHblits	X-ray	1.50Å	0.27	0.46	Transcriptional regulator, LacI family
4rk3.1.A	13.22	homo-dimer	HHblits	X-ray	1.80Å	0.26	0.46	Transcriptional regulator, LacI family
2x30.1.A	18.49	monomer	HHblits	X-ray	1.95Å	0.28	0.45	PHOSPHORIBOSYL ISOMERASE A
5dn1.1.A	18.49	monomer	HHblits	X-ray	1.95Å	0.28	0.45	Phosphoribosyl isomerase A
4wd0.1.A	15.00	homo-hexamer	HHblits	X-ray	1.50Å	0.27	0.46	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase
4u28.1.A	18.49	monomer	HHblits	X-ray	1.33Å	0.28	0.45	Phosphoribosyl isomerase A
3lft.1.A	18.10	monomer	HHblits	X-ray	1.35Å	0.29	0.44	uncharacterized protein
1j6u.1.A	14.41	monomer	HHblits	X-ray	2.30Å	0.28	0.45	UDP-N-acetylmuramate-alanine ligase MurC
4rk5.1.A	12.40	homo-dimer	HHblits	X-ray	1.35Å	0.26	0.46	Transcriptional regulator, LacI family
5ide.1.B	8.20	hetero-oligomer	HHblits	EM	NA	0.25	0.46	Glutamate receptor 3
5ide.1.D	8.20	hetero-oligomer	HHblits	EM	NA	0.25	0.46	Glutamate receptor 3
5idf.1.B	8.20	hetero-oligomer	HHblits	EM	NA	0.25	0.46	Glutamate receptor 3
5idf.1.D	8.20	hetero-oligomer	HHblits	EM	NA	0.25	0.46	Glutamate receptor 3
2lbp.1.A	14.66	monomer	HHblits	X-ray	2.40Å	0.28	0.44	LEUCINE-BINDING PROTEIN
3tze.1.A	8.40	homo-dimer	HHblits	X-ray	2.60Å	0.26	0.45	Tryptophanyl-tRNA synthetase
3e61.1.A	9.40	homo-tetramer	HHblits	X-ray	2.00Å	0.26	0.44	Putative transcriptional repressor of ribose operon
3g85.1.A	11.86	monomer	HHblits	X-ray	1.84Å	0.26	0.45	Transcriptional regulator (LacI family)
4f06.1.A	14.78	monomer	HHblits	X-ray	1.30Å	0.28	0.44	Extracellular ligand-binding receptor
1z16.1.A	13.79	monomer	HHblits	X-ray	1.72Å	0.27	0.44	Leu/Ile/Val-binding protein
1z15.1.A	13.79	monomer	HHblits	X-ray	1.70Å	0.27	0.44	Leu/Ile/Val-binding protein
4evs.1.A	13.04	monomer	HHblits	X-ray	1.45Å	0.28	0.44	PUTATIVE ABC TRANSPORTER SUBUNIT, SUBSTRATE-BINDING COMPONENT
3bbl.1.A	9.32	homo-dimer	HHblits	X-ray	2.35Å	0.25	0.45	Regulatory protein of LacI family
3nd9.1.A	17.27	monomer	HHblits	X-ray	3.10Å	0.29	0.42	V-type ATP synthase alpha chain
1iu9.1.A	26.92	monomer	HHblits	X-ray	2.04Å	0.32	0.40	aspartate racemase
3eiu.1.A	16.51	homo-dimer	HHblits	X-ray	3.43Å	0.28	0.41	V-type ATP synthase beta chain
3eiu.1.B	16.51	homo-dimer	HHblits	X-ray	3.43Å	0.28	0.41	V-type ATP synthase beta chain
3b2q.1.A	16.51	homo-dimer	HHblits	X-ray	2.10Å	0.28	0.41	V-type ATP synthase beta chain
3b2q.1.B	16.51	homo-dimer	HHblits	X-ray	2.10Å	0.28	0.41	V-type ATP synthase beta chain
2rkw.1.A	16.51	homo-dimer	HHblits	X-ray	2.81Å	0.28	0.41	V-type ATP synthase beta chain
2rkw.1.B	16.51	homo-dimer	HHblits	X-ray	2.81Å	0.28	0.41	V-type ATP synthase beta chain
2qsj.1.A	12.73	homo-dimer	HHblits	X-ray	2.10Å	0.26	0.42	DNA-binding response regulator, LuxR family
3s81.1.A	16.50	homo-dimer	HHblits	X-ray	1.80Å	0.31	0.39	Putative aspartate racemase
2eq5.1.A	13.46	homo-dimer	HHblits	X-ray	2.20Å	0.29	0.40	228aa long hypothetical hydantoin racemase
2eq5.2.B	13.46	homo-dimer	HHblits	X-ray	2.20Å	0.29	0.40	228aa long hypothetical hydantoin racemase
1jfl.1.A	19.80	homo-dimer	HHblits	X-ray	1.90Å	0.30	0.38	ASPARTATE RACEMASE
2iz1.1.B	14.02	homo-dimer	HHblits	X-ray	2.30Å	0.26	0.41	6-PHOSPHOGLUCONATE DEHYDROGENASE, DECARBOXYLATING
2iz1.1.A	14.02	homo-dimer	HHblits	X-ray	2.30Å	0.26	0.41	6-PHOSPHOGLUCONATE DEHYDROGENASE, DECARBOXYLATING
2iyp.1.B	14.95	homo-dimer	HHblits	X-ray	2.79Å	0.25	0.41	6-PHOSPHOGLUCONATE DEHYDROGENASE, DECARBOXYLATING
2iyp.1.A	14.95	homo-dimer	HHblits	X-ray	2.79Å	0.25	0.41	6-PHOSPHOGLUCONATE DEHYDROGENASE, DECARBOXYLATING
2iyo.1.A	14.02	homo-dimer	HHblits	X-ray	2.40Å	0.25	0.41	6-PHOSPHOGLUCONATE DEHYDROGENASE, DECARBOXYLATING
3ojc.1.A	9.62	homo-tetramer	HHblits	X-ray	1.75Å	0.28	0.40	Putative aspartate/glutamate racemase
3ojc.1.B	9.62	homo-tetramer	HHblits	X-ray	1.75Å	0.28	0.40	Putative aspartate/glutamate racemase
3ojc.1.C	9.62	homo-tetramer	HHblits	X-ray	1.75Å	0.28	0.40	Putative aspartate/glutamate racemase
3ojc.1.D	9.62	homo-tetramer	HHblits	X-ray	1.75Å	0.28	0.40	Putative aspartate/glutamate racemase
2dx7.1.A	18.81	homo-dimer	HHblits	X-ray	2.00Å	0.30	0.38	aspartate racemase
2dx7.1.B	18.81	homo-dimer	HHblits	X-ray	2.00Å	0.30	0.38	aspartate racemase
5ell.1.A	13.59	homo-dimer	HHblits	X-ray	1.80Å	0.28	0.39	Asp/Glu_racemase family protein
5ell.1.B	13.59	homo-dimer	HHblits	X-ray	1.80Å	0.28	0.39	Asp/Glu_racemase family protein
5elm.1.A	14.56	homo-dimer	HHblits	X-ray	2.00Å	0.28	0.39	Asp/Glu_racemase family protein
5elm.1.B	14.56	homo-dimer	HHblits	X-ray	2.00Å	0.28	0.39	Asp/Glu_racemase family protein
5elm.2.A	14.56	homo-dimer	HHblits	X-ray	2.00Å	0.28	0.39	Asp/Glu_racemase family protein
5elm.2.B	14.56	homo-dimer	HHblits	X-ray	2.00Å	0.28	0.39	Asp/Glu_racemase family protein
5hqt.1.A	14.71	homo-dimer	HHblits	X-ray	1.60Å	0.28	0.39	aspartate/glutamate racemase
2jfq.1.A	15.69	homo-dimer	HHblits	X-ray	2.15Å	0.28	0.39	GLUTAMATE RACEMASE
2jfq.1.B	15.69	homo-dimer	HHblits	X-ray	2.15Å	0.28	0.39	GLUTAMATE RACEMASE
5hj7.1.A	17.82	homo-dimer	HHblits	X-ray	2.30Å	0.28	0.38	Glutamate racemase
5ijw.1.A	15.84	homo-dimer	HHblits	X-ray	1.76Å	0.28	0.38	Glutamate racemase
5ijw.1.B	15.84	homo-dimer	HHblits	X-ray	1.76Å	0.28	0.38	Glutamate racemase
2pn1.1.A	14.42	homo-dimer	HHblits	X-ray	2.00Å	0.26	0.40	Carbamoylphosphate synthase large subunit
2zsk.1.A	10.78	homo-dimer	HHblits	X-ray	2.55Å	0.27	0.39	226aa long hypothetical aspartate racemase
3cz5.1.A	13.59	monomer	HHblits	X-ray	2.70Å	0.26	0.39	Two-component response regulator, LuxR family
3cz5.4.A	13.59	monomer	HHblits	X-ray	2.70Å	0.26	0.39	Two-component response regulator, LuxR family
5b19.1.A	13.86	homo-dimer	HHblits	X-ray	1.85Å	0.28	0.38	Aspartate racemase
5b19.1.B	13.86	homo-dimer	HHblits	X-ray	1.85Å	0.28	0.38	Aspartate racemase
3pdu.1.A	18.00	homo-tetramer	HHblits	X-ray	1.89Å	0.28	0.38	3-hydroxyisobutyrate dehydrogenase family protein
2gzm.1.A	16.00	homo-dimer	HHblits	X-ray	1.99Å	0.28	0.38	Glutamate racemase
2gzm.1.B	16.00	homo-dimer	HHblits	X-ray	1.99Å	0.28	0.38	Glutamate racemase
2gzm.2.B	16.00	homo-dimer	HHblits	X-ray	1.99Å	0.28	0.38	Glutamate racemase
2vvt.1.A	12.87	homo-dimer	HHblits	X-ray	1.65Å	0.27	0.38	GLUTAMATE RACEMASE
2vvt.1.B	12.87	homo-dimer	HHblits	X-ray	1.65Å	0.27	0.38	GLUTAMATE RACEMASE
2dwu.1.A	16.83	homo-dimer	HHblits	X-ray	1.60Å	0.27	0.38	Glutamate racemase
2dwu.2.A	16.83	homo-dimer	HHblits	X-ray	1.60Å	0.27	0.38	Glutamate racemase
2oho.1.A	12.87	homo-dimer	HHblits	X-ray	2.25Å	0.27	0.38	Glutamate Racemase
2oho.1.B	12.87	homo-dimer	HHblits	X-ray	2.25Å	0.27	0.38	Glutamate Racemase
2jfp.1.A	11.88	homo-dimer	HHblits	X-ray	1.98Å	0.27	0.38	GLUTAMATE RACEMASE
2jfo.1.B	11.88	homo-dimer	HHblits	X-ray	2.50Å	0.27	0.38	GLUTAMATE RACEMASE
5lfd.1.A	19.39	homo-hexamer	HHblits	X-ray	2.15Å	0.29	0.37	Allantoin racemase
2ohv.1.A	13.00	homo-dimer	HHblits	X-ray	2.50Å	0.27	0.38	Glutamate Racemase
2ohg.1.A	13.00	homo-dimer	HHblits	X-ray	2.50Å	0.27	0.38	Glutamate racemase
2jfw.1.A	12.00	homo-dimer	HHblits	X-ray	2.00Å	0.27	0.38	GLUTAMATE RACEMASE
3out.1.A	14.00	homo-hexamer	HHblits	X-ray	1.65Å	0.27	0.38	Glutamate racemase
3hfr.1.A	10.89	homo-dimer	HHblits	X-ray	2.30Å	0.26	0.38	Glutamate racemase
3hfr.1.B	10.89	homo-dimer	HHblits	X-ray	2.30Å	0.26	0.38	Glutamate racemase
3q3c.1.A	15.15	homo-tetramer	HHblits	X-ray	2.30Å	0.27	0.38	Probable 3-hydroxyisobutyrate dehydrogenase
5w1q.1.A	10.00	homo-dimer	HHblits	X-ray	1.95Å	0.26	0.38	Glutamate racemase
2vlb.1.A	16.33	monomer	HHblits	X-ray	1.92Å	0.28	0.37	ARYLMALONATE DECARBOXYLASE
2vlb.2.A	16.33	monomer	HHblits	X-ray	1.92Å	0.28	0.37	ARYLMALONATE DECARBOXYLASE
2vlb.3.A	16.33	monomer	HHblits	X-ray	1.92Å	0.28	0.37	ARYLMALONATE DECARBOXYLASE
2vlb.4.A	16.33	monomer	HHblits	X-ray	1.92Å	0.28	0.37	ARYLMALONATE DECARBOXYLASE
3uho.1.A	14.00	monomer	HHblits	X-ray	2.20Å	0.26	0.38	Glutamate racemase
3uhf.2.A	14.00	monomer	HHblits	X-ray	1.83Å	0.26	0.38	Glutamate racemase
3uhp.1.A	14.00	monomer	HHblits	X-ray	2.79Å	0.26	0.38	Glutamate racemase
3qvl.1.A	12.00	homo-hexamer	HHblits	X-ray	1.82Å	0.26	0.38	Putative hydantoin racemase
1b73.1.A	11.22	homo-dimer	HHblits	X-ray	2.30Å	0.27	0.37	GLUTAMATE RACEMASE
3lp8.1.A	12.50	monomer	HHblits	X-ray	2.15Å	0.27	0.37	Phosphoribosylamine-glycine ligase
2dgd.1.A	14.58	homo-octamer	HHblits	X-ray	2.90Å	0.27	0.37	223aa long hypothetical arylmalonate decarboxylase
3cu5.1.A	9.00	homo-dimer	HHblits	X-ray	2.60Å	0.24	0.38	Two component transcriptional regulator, AraC family
3cu5.1.B	9.00	homo-dimer	HHblits	X-ray	2.60Å	0.24	0.38	Two component transcriptional regulator, AraC family
2qxy.1.A	10.20	homo-dimer	HHblits	X-ray	1.95Å	0.25	0.37	Response regulator
2qxy.1.B	10.20	homo-dimer	HHblits	X-ray	1.95Å	0.25	0.37	Response regulator
3dg9.1.A	13.54	monomer	HHblits	X-ray	1.50Å	0.26	0.37	Arylmalonate decarboxylase
2jfn.1.A	13.68	monomer	HHblits	X-ray	1.90Å	0.27	0.36	GLUTAMATE RACEMASE
2xec.1.A	9.38	homo-dimer	HHblits	X-ray	2.20Å	0.26	0.37	PUTATIVE MALEATE ISOMERASE
2w90.1.A	12.50	homo-dimer	HHblits	X-ray	2.20Å	0.26	0.37	6-PHOSPHOGLUCONATE DEHYDROGENASE, DECARBOXYLATING
2w90.1.B	12.50	homo-dimer	HHblits	X-ray	2.20Å	0.26	0.37	6-PHOSPHOGLUCONATE DEHYDROGENASE, DECARBOXYLATING
3ixl.1.A	11.46	monomer	HHblits	X-ray	1.45Å	0.25	0.37	Arylmalonate decarboxylase
2c00.1.A	19.57	monomer	HHblits	X-ray	2.50Å	0.28	0.35	BIOTIN CARBOXYLASE
2c00.2.A	19.57	monomer	HHblits	X-ray	2.50Å	0.28	0.35	BIOTIN CARBOXYLASE
2vqd.1.A	19.57	monomer	HHblits	X-ray	2.41Å	0.28	0.35	BIOTIN CARBOXYLASE
5odc.1.B	15.22	hetero-oligomer	HHblits	X-ray	2.30Å	0.27	0.35	Heterodisulfide reductase, subunit B
2yl2.1.A	15.38	monomer	HHblits	X-ray	2.30Å	0.28	0.35	ACETYL-COA CARBOXYLASE 1
2yl2.2.A	15.38	monomer	HHblits	X-ray	2.30Å	0.28	0.35	ACETYL-COA CARBOXYLASE 1
5mlk.1.A	20.00	homo-dimer	HHblits	X-ray	1.94Å	0.29	0.34	Acetyl-COA carboxylase
3gid.1.A	14.29	monomer	HHblits	X-ray	2.30Å	0.27	0.35	Acetyl-CoA carboxylase 2
3gid.2.A	14.29	monomer	HHblits	X-ray	2.30Å	0.27	0.35	Acetyl-CoA carboxylase 2
3glk.1.A	14.29	monomer	HHblits	X-ray	2.10Å	0.27	0.35	Acetyl-CoA carboxylase 2
5kkn.2.A	14.29	monomer	HHblits	X-ray	2.60Å	0.27	0.35	Acetyl-CoA carboxylase 2
5kkn.1.A	14.29	monomer	HHblits	X-ray	2.60Å	0.27	0.35	Acetyl-CoA carboxylase 2
1nvm.1.B	13.19	hetero-oligomer	HHblits	X-ray	1.70Å	0.27	0.35	acetaldehyde dehydrogenase (acylating)
1nvm.2.B	13.19	hetero-oligomer	HHblits	X-ray	1.70Å	0.27	0.35	acetaldehyde dehydrogenase (acylating)
3d4o.1.A	17.58	homo-dimer	HHblits	X-ray	2.10Å	0.27	0.35	Dipicolinate synthase subunit A
3d4o.1.B	17.58	homo-dimer	HHblits	X-ray	2.10Å	0.27	0.35	Dipicolinate synthase subunit A
2gps.1.A	21.11	monomer	HHblits	X-ray	2.80Å	0.28	0.34	Biotin carboxylase
2vpq.1.A	16.85	homo-dimer	HHblits	X-ray	2.10Å	0.29	0.34	ACETYL-COA CARBOXYLASE
2gpw.1.A	21.35	monomer	HHblits	X-ray	2.20Å	0.29	0.34	Biotin carboxylase
2gpw.4.A	21.35	monomer	HHblits	X-ray	2.20Å	0.29	0.34	Biotin carboxylase
4mv4.2.A	21.35	monomer	HHblits	X-ray	1.61Å	0.29	0.34	Biotin carboxylase
3g8d.1.A	20.22	monomer	HHblits	X-ray	1.90Å	0.29	0.34	Biotin carboxylase
2bdq.1.A	16.48	homo-dimer	HHblits	X-ray	2.30Å	0.27	0.35	copper homeostasis protein CutC
3g8c.1.A	20.45	monomer	HHblits	X-ray	2.00Å	0.29	0.33	Biotin carboxylase
3g8c.2.A	20.45	monomer	HHblits	X-ray	2.00Å	0.29	0.33	Biotin carboxylase
3mjf.1.A	12.09	monomer	HHblits	X-ray	1.47Å	0.26	0.35	Phosphoribosylamine--glycine ligase
1gso.1.A	12.09	monomer	HHblits	X-ray	1.60Å	0.26	0.35	PROTEIN (GLYCINAMIDE RIBONUCLEOTIDE SYNTHETASE)
3rv4.1.A	20.22	homo-dimer	HHblits	X-ray	1.98Å	0.28	0.34	Biotin carboxylase
1dv2.1.A	19.10	monomer	HHblits	X-ray	2.50Å	0.28	0.34	BIOTIN CARBOXYLASE
3lp8.1.A	16.85	monomer	HHblits	X-ray	2.15Å	0.28	0.34	Phosphoribosylamine-glycine ligase
1h7x.1.A	19.77	homo-dimer	HHblits	X-ray	2.01Å	0.30	0.33	DIHYDROPYRIMIDINE DEHYDROGENASE
2w6m.1.A	19.32	monomer	HHblits	X-ray	2.00Å	0.28	0.33	BIOTIN CARBOXYLASE
1bnc.1.B	19.32	homo-dimer	HHblits	X-ray	2.40Å	0.28	0.33	BIOTIN CARBOXYLASE
1bnc.1.A	19.32	homo-dimer	HHblits	X-ray	2.40Å	0.28	0.33	BIOTIN CARBOXYLASE
4hr7.1.A	19.32	hetero-oligomer	HHblits	X-ray	2.50Å	0.28	0.33	Biotin carboxylase
4hr7.1.C	19.32	hetero-oligomer	HHblits	X-ray	2.50Å	0.28	0.33	Biotin carboxylase
4hr7.1.E	19.32	hetero-oligomer	HHblits	X-ray	2.50Å	0.28	0.33	Biotin carboxylase
4hr7.1.F	19.32	hetero-oligomer	HHblits	X-ray	2.50Å	0.28	0.33	Biotin carboxylase
2j9g.2.A	19.32	monomer	HHblits	X-ray	2.05Å	0.28	0.33	BIOTIN CARBOXYLASE
2vr1.2.A	19.32	monomer	HHblits	X-ray	2.60Å	0.28	0.33	BIOTIN CARBOXYLASE
3rv3.1.A	19.32	homo-dimer	HHblits	X-ray	1.91Å	0.28	0.33	Biotin carboxylase
2qk4.1.A	12.09	monomer	HHblits	X-ray	2.45Å	0.26	0.35	Trifunctional purine biosynthetic protein adenosine-3
1v9s.1.B	20.69	homo-tetramer	HHblits	X-ray	2.10Å	0.29	0.33	uracil phosphoribosyltransferase
1v9s.1.A	20.69	homo-tetramer	HHblits	X-ray	2.10Å	0.29	0.33	uracil phosphoribosyltransferase
1v9s.1.D	20.69	homo-tetramer	HHblits	X-ray	2.10Å	0.29	0.33	uracil phosphoribosyltransferase
1iu9.1.A	15.12	monomer	HHblits	X-ray	2.04Å	0.30	0.33	aspartate racemase
3ktd.1.A	13.19	homo-dimer	HHblits	X-ray	2.60Å	0.25	0.35	Prephenate dehydrogenase
1xtu.1.A	9.20	homo-tetramer	HHblits	X-ray	2.80Å	0.28	0.33	Probable uracil phosphoribosyltransferase
3g6w.1.A	9.20	homo-tetramer	HHblits	X-ray	2.90Å	0.28	0.33	Uracil phosphoribosyltransferase
3g6w.1.B	9.20	homo-tetramer	HHblits	X-ray	2.90Å	0.28	0.33	Uracil phosphoribosyltransferase
1xtv.1.B	9.20	homo-tetramer	HHblits	X-ray	2.60Å	0.28	0.33	Probable uracil phosphoribosyltransferase
1xtv.1.C	9.20	homo-tetramer	HHblits	X-ray	2.60Å	0.28	0.33	Probable uracil phosphoribosyltransferase
1xtt.1.A	9.20	homo-tetramer	HHblits	X-ray	1.80Å	0.28	0.33	Probable uracil phosphoribosyltransferase
1xtt.1.B	9.20	homo-tetramer	HHblits	X-ray	1.80Å	0.28	0.33	Probable uracil phosphoribosyltransferase
1vst.1.A	9.20	homo-tetramer	HHblits	X-ray	2.80Å	0.28	0.33	Uracil phosphoribosyltransferase
2ip4.1.A	18.18	monomer	HHblits	X-ray	2.80Å	0.27	0.33	Phosphoribosylamine--glycine ligase
2ip4.2.A	18.18	monomer	HHblits	X-ray	2.80Å	0.27	0.33	Phosphoribosylamine--glycine ligase
2ys6.1.A	15.73	monomer	HHblits	X-ray	2.21Å	0.26	0.34	Phosphoribosylglycinamide synthetase
2yya.1.A	17.24	monomer	HHblits	X-ray	2.40Å	0.28	0.33	Phosphoribosylamine--glycine ligase
2pn1.1.A	10.11	homo-dimer	HHblits	X-ray	2.00Å	0.26	0.34	Carbamoylphosphate synthase large subunit
5h80.1.A	14.61	homo-dimer	HHblits	X-ray	1.70Å	0.26	0.34	Carboxylase
3nd9.1.A	22.22	monomer	HHblits	X-ray	3.10Å	0.33	0.31	V-type ATP synthase alpha chain
3trh.1.A	16.28	homo-octamer	HHblits	X-ray	2.20Å	0.28	0.33	Phosphoribosylaminoimidazole carboxylase carboxyltransferase subunit
3wgi.1.B	11.24	homo-dimer	HHblits	X-ray	3.25Å	0.26	0.34	Redox-sensing transcriptional repressor rex
3wg9.2.A	11.24	homo-dimer	HHblits	X-ray	1.97Å	0.26	0.34	Redox-sensing transcriptional repressor rex
3wg9.2.B	11.24	homo-dimer	HHblits	X-ray	1.97Å	0.26	0.34	Redox-sensing transcriptional repressor rex
3wgh.1.B	11.24	homo-dimer	HHblits	X-ray	2.05Å	0.26	0.34	Redox-sensing transcriptional repressor rex
3wgg.1.A	11.24	homo-dimer	HHblits	X-ray	2.10Å	0.26	0.34	Redox-sensing transcriptional repressor rex
3wgg.1.B	11.24	homo-dimer	HHblits	X-ray	2.10Å	0.26	0.34	Redox-sensing transcriptional repressor rex
1o5o.1.A	24.10	homo-tetramer	HHblits	X-ray	2.30Å	0.31	0.32	Uracil phosphoribosyltransferase
2ehj.1.A	20.73	homo-tetramer	HHblits	X-ray	2.80Å	0.32	0.31	Uracil phosphoribosyltransferase
2ehj.1.C	20.73	homo-tetramer	HHblits	X-ray	2.80Å	0.32	0.31	Uracil phosphoribosyltransferase
4f3y.1.A	15.12	homo-tetramer	HHblits	X-ray	2.10Å	0.28	0.33	Dihydrodipicolinate reductase
3opq.1.A	21.69	homo-octamer	HHblits	X-ray	2.00Å	0.31	0.32	Phosphoribosylaminoimidazole carboxylase,catalytic subunit
5e38.1.B	20.73	homo-tetramer	HHblits	X-ray	3.00Å	0.31	0.31	Uracil phosphoribosyltransferase
5e38.1.A	20.73	homo-tetramer	HHblits	X-ray	3.00Å	0.31	0.31	Uracil phosphoribosyltransferase
5e38.1.D	20.73	homo-tetramer	HHblits	X-ray	3.00Å	0.31	0.31	Uracil phosphoribosyltransferase
1i5e.1.A	21.95	homo-dimer	HHblits	X-ray	3.00Å	0.31	0.31	URACIL PHOSPHORIBOSYLTRANSFERASE
2hjs.1.A	15.12	homo-dimer	HHblits	X-ray	2.20Å	0.28	0.33	USG-1 protein homolog
2xcl.1.A	7.95	monomer	HHblits	X-ray	2.10Å	0.25	0.33	PHOSPHORIBOSYLAMINE--GLYCINE LIGASE
3oow.1.A	21.95	homo-octamer	HHblits	X-ray	1.75Å	0.31	0.31	Phosphoribosylaminoimidazole carboxylase,catalytic subunit
1xmp.1.A	18.07	homo-octamer	HHblits	X-ray	1.80Å	0.30	0.32	phosphoribosylaminoimidazole carboxylase
3gdo.1.A	11.49	homo-dimer	HHblits	X-ray	2.03Å	0.26	0.33	Uncharacterized oxidoreductase yvaA
2fqx.1.A	16.67	monomer	HHblits	X-ray	1.70Å	0.28	0.32	Membrane lipoprotein tmpC
2ipn.1.A	24.10	monomer	HHblits	X-ray	1.15Å	0.29	0.32	D-galactose-binding periplasmic protein
4grd.1.A	18.07	homo-octamer	HHblits	X-ray	1.85Å	0.29	0.32	Phosphoribosylaminoimidazole carboxylase catalytic subunit
1kji.1.A	16.47	homo-dimer	HHblits	X-ray	1.60Å	0.27	0.32	phosphoribosylglycinamide formyltransferase 2
1kji.1.B	16.47	homo-dimer	HHblits	X-ray	1.60Å	0.27	0.32	phosphoribosylglycinamide formyltransferase 2
2ipm.1.A	24.10	monomer	HHblits	X-ray	1.12Å	0.29	0.32	D-galactose-binding periplasmic protein
2ipl.1.A	24.10	monomer	HHblits	X-ray	1.20Å	0.29	0.32	D-galactose-binding periplasmic protein
1o4v.1.A	18.29	homo-octamer	HHblits	X-ray	1.77Å	0.30	0.31	phosphoribosylaminoimidazole mutase PurE
3ors.1.A	16.87	homo-octamer	HHblits	X-ray	1.45Å	0.29	0.32	N5-Carboxyaminoimidazole Ribonucleotide Mutase
3ors.1.B	16.87	homo-octamer	HHblits	X-ray	1.45Å	0.29	0.32	N5-Carboxyaminoimidazole Ribonucleotide Mutase
3ors.1.E	16.87	homo-octamer	HHblits	X-ray	1.45Å	0.29	0.32	N5-Carboxyaminoimidazole Ribonucleotide Mutase
2hph.1.A	22.89	monomer	HHblits	X-ray	1.33Å	0.29	0.32	D-galactose-binding periplasmic protein
3lp6.1.B	18.07	homo-octamer	HHblits	X-ray	1.70Å	0.29	0.32	Phosphoribosylaminoimidazole carboxylase catalytic subunit
3lp6.1.A	18.07	homo-octamer	HHblits	X-ray	1.70Å	0.29	0.32	Phosphoribosylaminoimidazole carboxylase catalytic subunit
2jfy.1.B	9.30	homo-dimer	HHblits	X-ray	1.90Å	0.26	0.33	GLUTAMATE RACEMASE
2jfz.1.A	9.30	homo-dimer	HHblits	X-ray	1.86Å	0.26	0.33	GLUTAMATE RACEMASE
2jfx.1.A	9.30	homo-dimer	HHblits	X-ray	2.30Å	0.26	0.33	GLUTAMATE RACEMASE
2jfx.1.B	9.30	homo-dimer	HHblits	X-ray	2.30Å	0.26	0.33	GLUTAMATE RACEMASE
2jfy.1.A	9.30	homo-dimer	HHblits	X-ray	1.90Å	0.26	0.33	GLUTAMATE RACEMASE
4b1f.1.B	9.30	homo-dimer	HHblits	X-ray	2.05Å	0.26	0.33	GLUTAMATE RACEMASE
2w4i.1.A	9.30	homo-tetramer	HHblits	X-ray	1.87Å	0.26	0.33	GLUTAMATE RACEMASE
4fee.1.A	19.05	homo-tetramer	HHblits	X-ray	1.13Å	0.28	0.32	Pyruvate oxidase
4iil.1.A	15.48	monomer	HHblits	X-ray	1.30Å	0.27	0.32	Membrane lipoprotein TpN38(b)
3s99.1.A	13.25	monomer	HHblits	X-ray	2.05Å	0.28	0.32	Basic membrane lipoprotein
5bw9.2.G	24.36	hetero-oligomer	HHblits	X-ray	7.00Å	0.33	0.30	V-type proton ATPase catalytic subunit A
5voz.1.A	24.36	hetero-oligomer	HHblits	EM	NA	0.33	0.30	V-type proton ATPase catalytic subunit A,V-type proton ATPase catalytic subunit A
5voz.1.E	24.36	hetero-oligomer	HHblits	EM	NA	0.33	0.30	V-type proton ATPase catalytic subunit A,V-type proton ATPase catalytic subunit A
5voy.1.A	24.36	hetero-oligomer	HHblits	EM	NA	0.33	0.30	V-type proton ATPase catalytic subunit A,V-type proton ATPase catalytic subunit A
5voy.1.C	24.36	hetero-oligomer	HHblits	EM	NA	0.33	0.30	V-type proton ATPase catalytic subunit A,V-type proton ATPase catalytic subunit A
5voz.1.C	24.36	hetero-oligomer	HHblits	EM	NA	0.33	0.30	V-type proton ATPase catalytic subunit A,V-type proton ATPase catalytic subunit A
5d80.1.C	24.36	hetero-oligomer	HHblits	X-ray	6.20Å	0.33	0.30	V-type proton ATPase catalytic subunit A
5vox.1.A	24.36	hetero-oligomer	HHblits	EM	NA	0.33	0.30	V-type proton ATPase catalytic subunit A,V-type proton ATPase catalytic subunit A
5vox.1.C	24.36	hetero-oligomer	HHblits	EM	NA	0.33	0.30	V-type proton ATPase catalytic subunit A,V-type proton ATPase catalytic subunit A
5bw9.2.H	24.36	hetero-oligomer	HHblits	X-ray	7.00Å	0.33	0.30	V-type proton ATPase catalytic subunit A
5voy.1.E	24.36	hetero-oligomer	HHblits	EM	NA	0.33	0.30	V-type proton ATPase catalytic subunit A,V-type proton ATPase catalytic subunit A
4pz0.1.A	7.23	monomer	HHblits	X-ray	1.25Å	0.28	0.32	sugar ABC transporter, sugar-binding protein
4ay3.1.A	17.07	homo-dimer	HHblits	X-ray	1.76Å	0.29	0.31	N5-CARBOXYAMINOIMIDAZOLE RIBONUCLEOTIDE MUTASE
4b4k.1.C	17.07	homo-octamer	HHblits	X-ray	2.50Å	0.29	0.31	N5-CARBOXYAMINOIMIDAZOLE RIBONUCLEOTIDE MUTASE
3evn.1.A	13.25	monomer	HHblits	X-ray	2.00Å	0.28	0.32	Oxidoreductase, Gfo/Idh/MocA family
1pow.1.A	19.28	homo-tetramer	HHblits	X-ray	2.50Å	0.28	0.32	PYRUVATE OXIDASE
2e55.1.A	14.63	homo-tetramer	HHblits	X-ray	2.15Å	0.29	0.31	Uracil phosphoribosyltransferase
3j9t.1.C	24.36	hetero-oligomer	HHblits	EM	NA	0.32	0.30	V-type proton ATPase catalytic subunit A
3j9t.1.E	24.36	hetero-oligomer	HHblits	EM	NA	0.32	0.30	V-type proton ATPase catalytic subunit A
3j9t.1.G	24.36	hetero-oligomer	HHblits	EM	NA	0.32	0.30	V-type proton ATPase catalytic subunit A
3j9u.1.C	24.36	hetero-oligomer	HHblits	EM	NA	0.32	0.30	V-type proton ATPase catalytic subunit A
3j9u.1.E	24.36	hetero-oligomer	HHblits	EM	NA	0.32	0.30	V-type proton ATPase catalytic subunit A
3j9u.1.G	24.36	hetero-oligomer	HHblits	EM	NA	0.32	0.30	V-type proton ATPase catalytic subunit A
3j9v.1.E	24.36	hetero-oligomer	HHblits	EM	NA	0.32	0.30	V-type proton ATPase catalytic subunit A
3j9v.1.G	24.36	hetero-oligomer	HHblits	EM	NA	0.32	0.30	V-type proton ATPase catalytic subunit A
3j9v.1.I	24.36	hetero-oligomer	HHblits	EM	NA	0.32	0.30	V-type proton ATPase catalytic subunit A
1pox.1.A	20.73	homo-tetramer	HHblits	X-ray	2.10Å	0.28	0.31	PYRUVATE OXIDASE
1zuw.1.A	11.76	homo-dimer	HHblits	X-ray	1.75Å	0.25	0.32	glutamate racemase 1
1zuw.1.B	11.76	homo-dimer	HHblits	X-ray	1.75Å	0.25	0.32	glutamate racemase 1
2ate.1.A	9.76	homo-octamer	HHblits	X-ray	1.80Å	0.28	0.31	Phosphoribosylaminoimidazole carboxylase catalytic subunit
1d7a.1.A	9.76	homo-octamer	HHblits	X-ray	2.50Å	0.28	0.31	PHOSPHORIBOSYLAMINOIMIDAZOLE CARBOXYLASE
2nsl.1.A	10.98	homo-octamer	HHblits	X-ray	2.00Å	0.28	0.31	Phosphoribosylaminoimidazole carboxylase catalytic subunit
4yle.1.A	14.81	monomer	HHblits	X-ray	1.70Å	0.28	0.31	Periplasmic binding protein/LacI transcriptional regulator
1glg.1.A	25.00	monomer	HHblits	X-ray	2.00Å	0.29	0.30	GALACTOSE/GLUCOSE-BINDING PROTEIN
2qw1.1.A	25.00	monomer	HHblits	X-ray	1.70Å	0.29	0.30	D-galactose-binding periplasmic protein
2fvy.1.A	25.00	monomer	HHblits	X-ray	0.92Å	0.29	0.30	D-galactose-binding periplasmic protein
4ew6.1.A	19.51	homo-dimer	HHblits	X-ray	2.30Å	0.27	0.31	D-galactose-1-dehydrogenase protein
5ktk.1.A	13.58	monomer	HHblits	X-ray	1.98Å	0.28	0.31	Polyketide synthase PksJ
3ec7.1.A	17.72	homo-tetramer	HHblits	X-ray	2.15Å	0.30	0.30	Putative Dehydrogenase
3cea.1.A	10.98	homo-tetramer	HHblits	X-ray	2.40Å	0.27	0.31	Myo-inositol 2-dehydrogenase
2wrz.1.A	16.46	monomer	HHblits	X-ray	2.20Å	0.29	0.30	L-ARABINOSE-BINDING PERIPLASMIC PROTEIN
2wrz.2.A	16.46	monomer	HHblits	X-ray	2.20Å	0.29	0.30	L-ARABINOSE-BINDING PERIPLASMIC PROTEIN
1zh8.1.A	14.81	homo-dimer	HHblits	X-ray	2.50Å	0.27	0.31	oxidoreductase
1v5e.1.A	17.50	homo-tetramer	HHblits	X-ray	1.60Å	0.28	0.30	Pyruvate oxidase
4ycs.1.A	13.75	monomer	HHblits	X-ray	1.98Å	0.28	0.30	Uncharacterized protein
4ycs.2.A	13.75	monomer	HHblits	X-ray	1.98Å	0.28	0.30	Uncharacterized protein
4n54.1.A	11.11	homo-tetramer	HHblits	X-ray	2.05Å	0.27	0.31	Inositol dehydrogenase
4n54.1.C	11.11	homo-tetramer	HHblits	X-ray	2.05Å	0.27	0.31	Inositol dehydrogenase
4n54.1.D	11.11	homo-tetramer	HHblits	X-ray	2.05Å	0.27	0.31	Inositol dehydrogenase
4joq.1.A	15.00	homo-dimer	HHblits	X-ray	1.90Å	0.27	0.30	ABC ribose transporter, periplasmic solute-binding protein
1evj.1.A	7.23	homo-dimer	HHblits	X-ray	2.70Å	0.24	0.32	GLUCOSE-FRUCTOSE OXIDOREDUCTASE
3q2k.1.A	15.19	homo-octamer	HHblits	X-ray	2.13Å	0.28	0.30	oxidoreductase
3q2k.1.B	15.19	homo-octamer	HHblits	X-ray	2.13Å	0.28	0.30	oxidoreductase
2hqb.1.A	13.75	monomer	HHblits	X-ray	2.70Å	0.27	0.30	Transcriptional activator of comK gene
3evn.1.A	17.95	monomer	HHblits	X-ray	2.00Å	0.29	0.30	Oxidoreductase, Gfo/Idh/MocA family
1gub.1.A	13.92	monomer	HHblits	X-ray	3.10Å	0.28	0.30	D-ALLOSE-BINDING PERIPLASMIC PROTEIN
1gud.1.A	13.92	monomer	HHblits	X-ray	1.71Å	0.28	0.30	D-ALLOSE-BINDING PERIPLASMIC PROTEIN
1gud.2.A	13.92	monomer	HHblits	X-ray	1.71Å	0.28	0.30	D-ALLOSE-BINDING PERIPLASMIC PROTEIN
1rpj.1.A	13.92	monomer	HHblits	X-ray	1.80Å	0.28	0.30	PROTEIN (PRECURSOR OF PERIPLASMIC SUGAR RECEPTOR)
4kvf.1.A	15.19	monomer	HHblits	X-ray	1.72Å	0.28	0.30	Rhamnose ABC transporter, periplasmic rhamnose-binding protein
4d5g.1.A	13.41	homo-tetramer	HHblits	X-ray	2.00Å	0.24	0.31	CYCLOHEXANE-1,2-DIONE HYDROLASE
4ru1.1.A	8.86	monomer	HHblits	X-ray	1.50Å	0.27	0.30	Monosaccharide ABC transporter substrate-binding protein, CUT2 family
2pgn.1.A	14.81	homo-tetramer	HHblits	X-ray	1.20Å	0.25	0.31	Cyclohexane-1,2-dione Hydrolase (Cdh)
4gj1.1.A	8.86	monomer	HHblits	X-ray	2.15Å	0.26	0.30	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase
3gdo.1.A	16.88	homo-dimer	HHblits	X-ray	2.03Å	0.28	0.29	Uncharacterized oxidoreductase yvaA
5vev.1.A	15.38	monomer	HHblits	X-ray	1.90Å	0.26	0.30	Phosphoribosylamine--glycine ligase
3q2i.1.A	17.11	homo-octamer	HHblits	X-ray	1.50Å	0.28	0.29	dehydrogenase
2lle.1.A	12.99	monomer	HHblits	NMR	NA	0.27	0.29	Chemotaxis protein CheY, Imidazole glycerol phosphate synthase subunit HisF chimera
3cwo.1.A	10.39	homo-dimer	HHblits	X-ray	3.10Å	0.26	0.29	beta/alpha-barrel protein based on 1THF and 1TMY
3e9m.1.A	15.58	homo-dimer	HHblits	X-ray	2.70Å	0.26	0.29	Oxidoreductase, Gfo/Idh/MocA family
3e9m.1.B	15.58	homo-dimer	HHblits	X-ray	2.70Å	0.26	0.29	Oxidoreductase, Gfo/Idh/MocA family
3e9m.2.A	15.58	homo-dimer	HHblits	X-ray	2.70Å	0.26	0.29	Oxidoreductase, Gfo/Idh/MocA family
3rc7.1.A	15.79	monomer	HHblits	X-ray	2.00Å	0.27	0.29	Sugar 3-ketoreductase
3rcb.1.A	15.79	monomer	HHblits	X-ray	2.49Å	0.27	0.29	Sugar 3-ketoreductase
2rdm.1.A	16.88	homo-hexamer	HHblits	X-ray	1.76Å	0.26	0.29	Response regulator receiver protein
2rdm.1.B	16.88	homo-hexamer	HHblits	X-ray	1.76Å	0.26	0.29	Response regulator receiver protein
2rdm.1.C	16.88	homo-hexamer	HHblits	X-ray	1.76Å	0.26	0.29	Response regulator receiver protein
4s2r.1.A	17.57	homo-dimer	HHblits	X-ray	1.95Å	0.28	0.28	Protein APP-1
5uhw.1.A	10.39	homo-dimer	HHblits	X-ray	2.24Å	0.25	0.29	Oxidoreductase protein
2qv0.1.A	11.69	homo-dimer	HHblits	X-ray	2.40Å	0.25	0.29	Protein mrkE
3nvi.2.B	14.86	hetero-oligomer	HHblits	X-ray	2.71Å	0.27	0.28	50S ribosomal protein L7Ae
3nmu.1.D	14.86	hetero-oligomer	HHblits	X-ray	2.73Å	0.27	0.28	50S ribosomal protein L7Ae
3nvk.1.C	14.86	hetero-oligomer	HHblits	X-ray	3.21Å	0.27	0.28	50S ribosomal protein L7Ae
3nvk.1.D	14.86	hetero-oligomer	HHblits	X-ray	3.21Å	0.27	0.28	50S ribosomal protein L7Ae
3nmu.2.B	14.86	hetero-oligomer	HHblits	X-ray	2.73Å	0.27	0.28	50S ribosomal protein L7Ae
4by9.1.D	14.86	hetero-oligomer	HHblits	NMR	NA	0.27	0.28	50S RIBOSOMAL PROTEIN L7AE
4by9.1.G	14.86	hetero-oligomer	HHblits	NMR	NA	0.27	0.28	50S RIBOSOMAL PROTEIN L7AE
4by9.1.J	14.86	hetero-oligomer	HHblits	NMR	NA	0.27	0.28	50S RIBOSOMAL PROTEIN L7AE
4by9.1.M	14.86	hetero-oligomer	HHblits	NMR	NA	0.27	0.28	50S RIBOSOMAL PROTEIN L7AE
3fhl.1.A	14.67	homo-dimer	HHblits	X-ray	1.93Å	0.25	0.29	Putative oxidoreductase
3fhl.1.B	14.67	homo-dimer	HHblits	X-ray	1.93Å	0.25	0.29	Putative oxidoreductase
3gka.1.A	10.53	monomer	HHblits	X-ray	2.30Å	0.24	0.29	N-ethylmaleimide reductase
5uhw.1.A	11.11	homo-dimer	HHblits	X-ray	2.24Å	0.28	0.27	Oxidoreductase protein
4mge.1.A	9.59	monomer	HHblits	X-ray	1.85Å	0.26	0.28	PTS system, cellobiose-specific IIB component
4mge.2.A	9.59	monomer	HHblits	X-ray	1.85Å	0.26	0.28	PTS system, cellobiose-specific IIB component
4egj.1.A	19.44	monomer	HHblits	X-ray	2.30Å	0.28	0.27	D-alanine--D-alanine ligase
3j9t.1.C	20.59	hetero-oligomer	HHblits	EM	NA	0.31	0.26	V-type proton ATPase catalytic subunit A
3j9t.1.E	20.59	hetero-oligomer	HHblits	EM	NA	0.31	0.26	V-type proton ATPase catalytic subunit A
3j9t.1.G	20.59	hetero-oligomer	HHblits	EM	NA	0.31	0.26	V-type proton ATPase catalytic subunit A
3j9u.1.C	20.59	hetero-oligomer	HHblits	EM	NA	0.31	0.26	V-type proton ATPase catalytic subunit A
3j9u.1.E	20.59	hetero-oligomer	HHblits	EM	NA	0.31	0.26	V-type proton ATPase catalytic subunit A
3j9u.1.G	20.59	hetero-oligomer	HHblits	EM	NA	0.31	0.26	V-type proton ATPase catalytic subunit A
3j9v.1.E	20.59	hetero-oligomer	HHblits	EM	NA	0.31	0.26	V-type proton ATPase catalytic subunit A
3j9v.1.G	20.59	hetero-oligomer	HHblits	EM	NA	0.31	0.26	V-type proton ATPase catalytic subunit A
3j9v.1.I	20.59	hetero-oligomer	HHblits	EM	NA	0.31	0.26	V-type proton ATPase catalytic subunit A
1o5t.1.A	9.72	homo-dimer	HHblits	X-ray	2.50Å	0.27	0.27	Tryptophanyl-tRNA synthetase
2qui.1.B	9.72	homo-dimer	HHblits	X-ray	2.40Å	0.27	0.27	Tryptophanyl-tRNA synthetase
2quk.1.A	9.72	homo-dimer	HHblits	X-ray	2.80Å	0.27	0.27	Tryptophanyl-tRNA synthetase
2qui.1.A	9.72	homo-dimer	HHblits	X-ray	2.40Å	0.27	0.27	Tryptophanyl-tRNA synthetase
3lft.1.A	14.08	monomer	HHblits	X-ray	1.35Å	0.28	0.27	uncharacterized protein
1r6u.1.A	9.72	homo-dimer	HHblits	X-ray	2.00Å	0.27	0.27	Tryptophanyl-tRNA synthetase
1r6u.1.B	9.72	homo-dimer	HHblits	X-ray	2.00Å	0.27	0.27	Tryptophanyl-tRNA synthetase
4to8.1.A	18.31	homo-dimer	HHblits	X-ray	2.10Å	0.28	0.27	Fructose-1,6-bisphosphate aldolase, class II
3t9p.1.A	16.90	homo-dimer	HHblits	X-ray	1.97Å	0.28	0.27	Mandelate racemase/muconate lactonizing enzyme family protein
4mkx.1.A	12.68	homo-tetramer	HHblits	X-ray	1.60Å	0.28	0.27	Inositol dehydrogenase
5bw9.2.G	20.90	hetero-oligomer	HHblits	X-ray	7.00Å	0.32	0.25	V-type proton ATPase catalytic subunit A
5voz.1.A	20.90	hetero-oligomer	HHblits	EM	NA	0.32	0.25	V-type proton ATPase catalytic subunit A,V-type proton ATPase catalytic subunit A
5voz.1.E	20.90	hetero-oligomer	HHblits	EM	NA	0.32	0.25	V-type proton ATPase catalytic subunit A,V-type proton ATPase catalytic subunit A
5voy.1.A	20.90	hetero-oligomer	HHblits	EM	NA	0.32	0.25	V-type proton ATPase catalytic subunit A,V-type proton ATPase catalytic subunit A
5voy.1.C	20.90	hetero-oligomer	HHblits	EM	NA	0.32	0.25	V-type proton ATPase catalytic subunit A,V-type proton ATPase catalytic subunit A
5voz.1.C	20.90	hetero-oligomer	HHblits	EM	NA	0.32	0.25	V-type proton ATPase catalytic subunit A,V-type proton ATPase catalytic subunit A
5d80.1.C	20.90	hetero-oligomer	HHblits	X-ray	6.20Å	0.32	0.25	V-type proton ATPase catalytic subunit A
5vox.1.A	20.90	hetero-oligomer	HHblits	EM	NA	0.32	0.25	V-type proton ATPase catalytic subunit A,V-type proton ATPase catalytic subunit A
5vox.1.C	20.90	hetero-oligomer	HHblits	EM	NA	0.32	0.25	V-type proton ATPase catalytic subunit A,V-type proton ATPase catalytic subunit A
5bw9.2.H	20.90	hetero-oligomer	HHblits	X-ray	7.00Å	0.32	0.25	V-type proton ATPase catalytic subunit A
5voy.1.E	20.90	hetero-oligomer	HHblits	EM	NA	0.32	0.25	V-type proton ATPase catalytic subunit A,V-type proton ATPase catalytic subunit A
1m1b.1.A	15.71	homo-tetramer	HHblits	X-ray	2.25Å	0.28	0.27	PHOSPHOENOLPYRUVATE PHOSPHOMUTASE
1s2v.1.A	15.71	homo-tetramer	HHblits	X-ray	2.10Å	0.28	0.27	Phosphoenolpyruvate phosphomutase
1s2w.1.A	15.71	monomer	HHblits	X-ray	1.69Å	0.28	0.27	Phosphoenolpyruvate phosphomutase
1ulh.1.A	9.86	homo-dimer	HHblits	X-ray	2.31Å	0.27	0.27	Tryptophanyl-tRNA synthetase
1ulh.1.B	9.86	homo-dimer	HHblits	X-ray	2.31Å	0.27	0.27	Tryptophanyl-tRNA synthetase
3m2t.1.A	18.84	homo-tetramer	HHblits	X-ray	2.30Å	0.29	0.26	Probable dehydrogenase
3q2k.1.A	22.39	homo-octamer	HHblits	X-ray	2.13Å	0.31	0.25	oxidoreductase
3q2k.1.B	22.39	homo-octamer	HHblits	X-ray	2.13Å	0.31	0.25	oxidoreductase
3ec7.1.A	13.24	homo-tetramer	HHblits	X-ray	2.15Å	0.30	0.26	Putative Dehydrogenase
3nkl.1.A	19.40	homo-dimer	HHblits	X-ray	1.90Å	0.30	0.25	UDP-D-quinovosamine 4-dehydrogenase
3nkl.1.B	19.40	homo-dimer	HHblits	X-ray	1.90Å	0.30	0.25	UDP-D-quinovosamine 4-dehydrogenase
4fx7.1.A	14.29	monomer	HHblits	X-ray	2.08Å	0.26	0.27	Imidazole glycerol phosphate synthase subunit HisF
4m19.1.A	8.96	homo-tetramer	HHblits	X-ray	2.00Å	0.29	0.25	4-hydroxy-tetrahydrodipicolinate synthase
4r53.1.C	8.96	homo-tetramer	HHblits	X-ray	2.00Å	0.29	0.25	4-hydroxy-tetrahydrodipicolinate synthase
1h6c.1.A	10.00	homo-tetramer	HHblits	X-ray	2.20Å	0.25	0.27	PRECURSOR FORM OF GLUCOSE-FRUCTOSE OXIDOREDUCTASE
1v2g.1.A	13.24	monomer	HHblits	X-ray	2.00Å	0.28	0.26	Acyl-CoA thioesterase I
1yzf.1.A	14.93	monomer	HHblits	X-ray	1.90Å	0.29	0.25	lipase/acylhydrolase
2o14.1.A	19.70	monomer	HHblits	X-ray	2.10Å	0.29	0.25	Hypothetical protein yxiM
3q2i.1.A	13.43	homo-octamer	HHblits	X-ray	1.50Å	0.28	0.25	dehydrogenase
3rcb.1.A	19.40	monomer	HHblits	X-ray	2.49Å	0.28	0.25	Sugar 3-ketoreductase
4hf7.1.A	15.15	homo-dimer	HHblits	X-ray	1.77Å	0.29	0.25	Putative acylhydrolase
3rc7.1.A	19.40	monomer	HHblits	X-ray	2.00Å	0.28	0.25	Sugar 3-ketoreductase
3rc9.1.A	17.91	monomer	HHblits	X-ray	1.91Å	0.28	0.25	Sugar 3-ketoreductase
5ktn.1.A	16.92	monomer	HHblits	X-ray	1.34Å	0.30	0.25	Quinolinate synthase A
5ktm.1.A	16.92	monomer	HHblits	X-ray	1.44Å	0.30	0.25	Quinolinate synthase A
2w90.1.A	15.38	homo-dimer	HHblits	X-ray	2.20Å	0.30	0.25	6-PHOSPHOGLUCONATE DEHYDROGENASE, DECARBOXYLATING
2w90.1.B	15.38	homo-dimer	HHblits	X-ray	2.20Å	0.30	0.25	6-PHOSPHOGLUCONATE DEHYDROGENASE, DECARBOXYLATING
3f4l.1.A	13.04	homo-dimer	HHblits	X-ray	2.00Å	0.25	0.26	Putative oxidoreductase yhhX
3e9m.1.A	7.25	homo-dimer	HHblits	X-ray	2.70Å	0.25	0.26	Oxidoreductase, Gfo/Idh/MocA family
3e9m.1.B	7.25	homo-dimer	HHblits	X-ray	2.70Å	0.25	0.26	Oxidoreductase, Gfo/Idh/MocA family
3e9m.2.A	7.25	homo-dimer	HHblits	X-ray	2.70Å	0.25	0.26	Oxidoreductase, Gfo/Idh/MocA family
3rc1.1.A	16.42	monomer	HHblits	X-ray	1.71Å	0.27	0.25	Sugar 3-ketoreductase
1evj.1.A	10.45	homo-dimer	HHblits	X-ray	2.70Å	0.27	0.25	GLUCOSE-FRUCTOSE OXIDOREDUCTASE
4jj6.1.A	7.25	homo-octamer	HHblits	X-ray	1.80Å	0.24	0.26	Acetyl xylan esterase
1j00.1.A	13.64	monomer	HHblits	X-ray	2.00Å	0.28	0.25	Thioesterase I
1u8u.1.A	13.64	monomer	HHblits	X-ray	2.08Å	0.28	0.25	Acyl-CoA thioesterase I
1ryd.1.A	10.45	homo-tetramer	HHblits	X-ray	2.20Å	0.26	0.25	glucose-fructose oxidoreductase
1rye.1.B	10.45	homo-tetramer	HHblits	X-ray	2.30Å	0.26	0.25	glucose-fructose oxidoreductase
1rye.1.A	10.45	homo-tetramer	HHblits	X-ray	2.30Å	0.26	0.25	glucose-fructose oxidoreductase
4oap.1.A	7.35	homo-octamer	HHblits	X-ray	1.93Å	0.25	0.26	Acetyl xylan esterase
1ofg.1.A	8.96	homo-tetramer	HHblits	X-ray	2.70Å	0.26	0.25	GLUCOSE-FRUCTOSE OXIDOREDUCTASE
1zh8.1.A	16.67	homo-dimer	HHblits	X-ray	2.50Å	0.26	0.25	oxidoreductase
5a02.1.A	5.97	homo-dimer	HHblits	X-ray	2.00Å	0.25	0.25	ALDOSE-ALDOSE OXIDOREDUCTASE
3dfu.1.A	10.77	homo-dimer	HHblits	X-ray	2.07Å	0.27	0.25	Uncharacterized Protein from 6-Phosphogluconate Dehydrogenase-Like Family
3dfu.1.B	10.77	homo-dimer	HHblits	X-ray	2.07Å	0.27	0.25	Uncharacterized Protein from 6-Phosphogluconate Dehydrogenase-Like Family
4hhe.1.A	15.87	homo-dimer	HHblits	X-ray	2.80Å	0.29	0.24	Quinolinate synthase A
4lda.1.A	19.05	monomer	HHblits	X-ray	2.40Å	0.28	0.24	TadZ
4lda.3.A	19.05	monomer	HHblits	X-ray	2.40Å	0.28	0.24	TadZ
4lda.4.A	19.05	monomer	HHblits	X-ray	2.40Å	0.28	0.24	TadZ
4lda.5.A	19.05	monomer	HHblits	X-ray	2.40Å	0.28	0.24	TadZ
1wzu.1.A	16.13	monomer	HHblits	X-ray	2.00Å	0.29	0.24	Quinolinate synthetase A
4zk6.1.A	16.13	monomer	HHblits	X-ray	1.89Å	0.29	0.24	Quinolinate synthase A
4zk6.2.A	16.13	monomer	HHblits	X-ray	1.89Å	0.29	0.24	Quinolinate synthase A
3qrw.1.A	17.74	homo-tetramer	HHblits	X-ray	2.79Å	0.29	0.24	ketoacyl reductase
3qrw.1.B	17.74	homo-tetramer	HHblits	X-ray	2.79Å	0.29	0.24	ketoacyl reductase
3ri3.1.A	17.74	homo-tetramer	HHblits	X-ray	2.29Å	0.29	0.24	ketoacyl reductase
3i05.1.A	11.11	homo-dimer	HHblits	X-ray	2.80Å	0.28	0.24	Tryptophanyl-tRNA synthetase
2ake.1.B	11.11	homo-dimer	HHblits	X-ray	3.10Å	0.28	0.24	Tryptophanyl-tRNA synthetase
1r6t.1.A	11.11	homo-dimer	HHblits	X-ray	2.10Å	0.27	0.24	Tryptophanyl-tRNA synthetase
1r6t.1.B	11.11	homo-dimer	HHblits	X-ray	2.10Å	0.27	0.24	Tryptophanyl-tRNA synthetase
2azx.1.B	11.11	homo-dimer	HHblits	X-ray	2.80Å	0.27	0.24	Tryptophanyl-tRNA synthetase
3pbk.1.A	9.52	monomer	HHblits	X-ray	3.00Å	0.26	0.24	Fatty Acyl-Adenylate Ligase
4u63.1.A	11.29	monomer	HHblits	X-ray	1.67Å	0.28	0.24	DNA photolyase
4mg4.1.A	22.95	homo-dimer	HHblits	X-ray	1.70Å	0.29	0.23	Phosphonomutase
4mg4.2.B	22.95	homo-dimer	HHblits	X-ray	1.70Å	0.29	0.23	Phosphonomutase
5jrh.1.A	14.29	monomer	HHblits	X-ray	1.64Å	0.26	0.24	Acetyl-coenzyme A synthetase
2p2b.1.A	14.29	monomer	HHblits	X-ray	2.20Å	0.26	0.24	Acetyl-coenzyme A synthetase
2p2f.1.A	12.70	monomer	HHblits	X-ray	2.58Å	0.26	0.24	Acetyl-coenzyme A synthetase
4avf.1.A	13.11	homo-tetramer	HHblits	X-ray	2.23Å	0.28	0.23	INOSINE-5'-MONOPHOSPHATE DEHYDROGENASE
3q94.1.A	16.67	homo-dimer	HHblits	X-ray	2.30Å	0.29	0.23	Fructose-bisphosphate aldolase, class II
4mg4.1.A	14.52	homo-dimer	HHblits	X-ray	1.70Å	0.26	0.24	Phosphonomutase
4mg4.2.B	14.52	homo-dimer	HHblits	X-ray	1.70Å	0.26	0.24	Phosphonomutase
2p2q.1.A	12.90	monomer	HHblits	X-ray	2.42Å	0.26	0.24	Acetyl-coenzyme A synthetase
4pbs.1.A	13.11	homo-dimer	HHblits	X-ray	2.01Å	0.27	0.23	Tyrosine--tRNA ligase
2p2m.1.A	11.29	monomer	HHblits	X-ray	2.11Å	0.25	0.24	Acetyl-coenzyme A synthetase
1pg3.1.A	11.29	monomer	HHblits	X-ray	2.30Å	0.25	0.24	acetyl-CoA synthetase
2p20.1.A	11.29	monomer	HHblits	X-ray	2.22Å	0.25	0.24	Acetyl-coenzyme A synthetase
4nae.1.B	30.77	hetero-oligomer	HHblits	X-ray	2.00Å	0.35	0.20	Heptaprenylglyceryl phosphate synthase
3noy.1.A	24.07	homo-dimer	HHblits	X-ray	2.70Å	0.32	0.21	4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
3noy.2.A	24.07	homo-dimer	HHblits	X-ray	2.70Å	0.32	0.21	4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
1j0e.1.A	12.28	homo-dimer	HHblits	X-ray	2.45Å	0.27	0.22	1-aminocyclopropane-1-carboxylate deaminase
3qw3.1.A	18.18	homo-dimer	HHblits	X-ray	1.70Å	0.29	0.21	Orotidine-5-phosphate decarboxylase/orotate phosphoribosyltransferase, putative (Ompdcase-oprtase, putative)
4mwa.1.A	14.81	homo-tetramer	HHblits	X-ray	1.85Å	0.29	0.21	4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
4mwa.1.B	14.81	homo-tetramer	HHblits	X-ray	1.85Å	0.29	0.21	4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
4mwa.1.C	14.81	homo-tetramer	HHblits	X-ray	1.85Å	0.29	0.21	4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
4mwa.1.D	14.81	homo-tetramer	HHblits	X-ray	1.85Å	0.29	0.21	4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
4mwa.2.B	14.81	homo-tetramer	HHblits	X-ray	1.85Å	0.29	0.21	4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
4mwa.2.D	14.81	homo-tetramer	HHblits	X-ray	1.85Å	0.29	0.21	4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
3qw4.1.B	18.52	homo-tetramer	HHblits	X-ray	3.00Å	0.29	0.21	UMP synthase
3qw4.1.A	18.52	homo-tetramer	HHblits	X-ray	3.00Å	0.29	0.21	UMP synthase
2f6u.1.A	19.23	homo-dimer	HHblits	X-ray	1.55Å	0.31	0.20	(S)-3-O-Geranylgeranylglyceryl Phosphate Synthase
2f6x.1.A	19.23	homo-dimer	HHblits	X-ray	2.00Å	0.31	0.20	(S)-3-O-Geranylgeranylglyceryl Phosphate Synthase
3qvj.1.A	14.81	homo-hexamer	HHblits	X-ray	2.10Å	0.27	0.21	Putative hydantoin racemase
3bol.1.A	15.38	homo-dimer	HHblits	X-ray	1.85Å	0.28	0.20	5-methyltetrahydrofolate S-homocysteine methyltransferase
1q7m.2.A	15.38	monomer	HHblits	X-ray	2.10Å	0.28	0.20	5-methyltetrahydrofolate S-homocysteine methyltransferase
1q7q.1.A	15.38	monomer	HHblits	X-ray	3.10Å	0.28	0.20	5-methyltetrahydrofolate S-homocysteine methyltransferase
1q8a.2.A	15.38	monomer	HHblits	X-ray	1.70Å	0.28	0.20	5-methyltetrahydrofolate S-homocysteine methyltransferase
4fq5.1.A	11.11	homo-tetramer	HHblits	X-ray	2.10Å	0.25	0.21	Maleate cis-trans isomerase
4fq5.1.B	11.11	homo-tetramer	HHblits	X-ray	2.10Å	0.25	0.21	Maleate cis-trans isomerase
3dtv.3.A	20.00	monomer	HHblits	X-ray	2.10Å	0.31	0.19	Arylmalonate decarboxylase
3dtv.2.A	20.00	monomer	HHblits	X-ray	2.10Å	0.31	0.19	Arylmalonate decarboxylase
3dtv.1.A	20.00	monomer	HHblits	X-ray	2.10Å	0.31	0.19	Arylmalonate decarboxylase
3dtv.4.A	20.00	monomer	HHblits	X-ray	2.10Å	0.31	0.19	Arylmalonate decarboxylase
3eis.1.A	20.00	monomer	HHblits	X-ray	2.10Å	0.31	0.19	Arylmalonate decarboxylase
3eis.2.A	20.00	monomer	HHblits	X-ray	2.10Å	0.31	0.19	Arylmalonate decarboxylase
4fq7.1.A	11.32	homo-tetramer	HHblits	X-ray	3.00Å	0.26	0.20	Maleate cis-trans isomerase
2xed.1.A	9.62	monomer	HHblits	X-ray	1.95Å	0.27	0.20	PUTATIVE MALEATE ISOMERASE
3ixm.1.A	18.37	monomer	HHblits	X-ray	1.90Å	0.30	0.19	Arylmalonate decarboxylase
1fwr.1.A	22.00	homo-trimer	HHblits	X-ray	2.70Å	0.28	0.19	KDPG ALDOLASE
2egu.1.A	31.91	monomer	HHblits	X-ray	1.90Å	0.33	0.18	Cysteine synthase
1fui.1.A	13.46	homo-trimer	HHblits	X-ray	2.50Å	0.25	0.20	L-FUCOSE ISOMERASE
2q5c.1.A	18.00	monomer	HHblits	X-ray	1.49Å	0.28	0.19	NtrC family transcriptional regulator
3g8r.1.A	20.83	homo-dimer	HHblits	X-ray	2.49Å	0.30	0.18	Probable spore coat polysaccharide biosynthesis protein E
3g8r.1.B	20.83	homo-dimer	HHblits	X-ray	2.49Å	0.30	0.18	Probable spore coat polysaccharide biosynthesis protein E
4c22.1.A	7.84	homo-hexamer	HHblits	X-ray	2.70Å	0.25	0.19	L-FUCOSE ISOMERASE
3x44.1.A	18.75	homo-tetramer	HHblits	X-ray	1.90Å	0.29	0.18	O-ureido-L-serine synthase
3ga5.1.A	12.24	monomer	HHblits	X-ray	1.87Å	0.28	0.19	D-galactose-binding periplasmic protein
1a96.1.A	12.24	homo-tetramer	HHblits	X-ray	2.00Å	0.27	0.19	XANTHINE-GUANINE PHOSPHORIBOSYLTRANSFERASE
1a96.1.C	12.24	homo-tetramer	HHblits	X-ray	2.00Å	0.27	0.19	XANTHINE-GUANINE PHOSPHORIBOSYLTRANSFERASE
1nul.1.B	12.24	homo-tetramer	HHblits	X-ray	1.80Å	0.27	0.19	XANTHINE-GUANINE PHOSPHORIBOSYLTRANSFERASE
4jls.2.A	12.24	homo-tetramer	HHblits	X-ray	2.20Å	0.27	0.19	Xanthine phosphoribosyltransferase
4ipi.1.A	23.91	homo-dimer	HHblits	X-ray	1.75Å	0.31	0.17	Polysialic acid capsule biosynthesis protein SiaC
4ipj.1.A	23.91	homo-dimer	HHblits	X-ray	2.15Å	0.31	0.17	Polysialic acid capsule biosynthesis protein SiaC
4ix1.1.A	10.20	homo-dimer	HHblits	X-ray	2.80Å	0.26	0.19	hypothetical protein
4ix1.1.B	10.20	homo-dimer	HHblits	X-ray	2.80Å	0.26	0.19	hypothetical protein
4c20.1.A	6.00	monomer	HHblits	X-ray	2.41Å	0.25	0.19	L-FUCOSE ISOMERASE
4c21.1.A	6.00	homo-hexamer	HHblits	X-ray	2.55Å	0.25	0.19	L-FUCOSE ISOMERASE
3mjf.1.A	12.50	monomer	HHblits	X-ray	1.47Å	0.28	0.18	Phosphoribosylamine--glycine ligase
3w3a.1.A	22.22	hetero-oligomer	HHblits	X-ray	3.90Å	0.33	0.17	V-type ATP synthase alpha chain
3w3a.1.B	22.22	hetero-oligomer	HHblits	X-ray	3.90Å	0.33	0.17	V-type ATP synthase alpha chain
3w3a.1.C	22.22	hetero-oligomer	HHblits	X-ray	3.90Å	0.33	0.17	V-type ATP synthase alpha chain
5gar.1.A	22.22	hetero-oligomer	HHblits	EM	NA	0.33	0.17	V-type ATP synthase alpha chain
5gar.1.B	22.22	hetero-oligomer	HHblits	EM	NA	0.33	0.17	V-type ATP synthase alpha chain
5gar.1.C	22.22	hetero-oligomer	HHblits	EM	NA	0.33	0.17	V-type ATP synthase alpha chain
5gas.1.A	22.22	hetero-oligomer	HHblits	EM	NA	0.33	0.17	V-type ATP synthase alpha chain
5gas.1.C	22.22	hetero-oligomer	HHblits	EM	NA	0.33	0.17	V-type ATP synthase alpha chain
5gas.1.B	22.22	hetero-oligomer	HHblits	EM	NA	0.33	0.17	V-type ATP synthase alpha chain
1rdu.1.A	14.89	monomer	HHblits	NMR	NA	0.29	0.18	conserved hypothetical protein
1eo1.1.A	17.02	monomer	HHblits	NMR	NA	0.29	0.18	HYPOTHETICAL PROTEIN MTH1175
2wqp.1.A	24.44	homo-dimer	HHblits	X-ray	1.75Å	0.32	0.17	POLYSIALIC ACID CAPSULE BIOSYNTHESIS PROTEIN SIAC
1xuu.1.A	24.44	homo-dimer	HHblits	X-ray	1.90Å	0.32	0.17	polysialic acid capsule biosynthesis protein SiaC
2ip4.1.A	19.57	monomer	HHblits	X-ray	2.80Å	0.30	0.17	Phosphoribosylamine--glycine ligase
2ip4.2.A	19.57	monomer	HHblits	X-ray	2.80Å	0.30	0.17	Phosphoribosylamine--glycine ligase
3x43.1.A	19.57	homo-tetramer	HHblits	X-ray	2.25Å	0.30	0.17	O-ureido-L-serine synthase
3x43.1.B	19.57	homo-tetramer	HHblits	X-ray	2.25Å	0.30	0.17	O-ureido-L-serine synthase
3a9t.1.A	12.24	homo-hexamer	HHblits	X-ray	2.61Å	0.25	0.19	D-arabinose isomerase
2yya.1.A	14.89	monomer	HHblits	X-ray	2.40Å	0.26	0.18	Phosphoribosylamine--glycine ligase
3zei.1.A	22.73	homo-dimer	HHblits	X-ray	2.00Å	0.31	0.17	O-ACETYLSERINE SULFHYDRYLASE
2isq.1.A	20.00	homo-dimer	HHblits	X-ray	2.80Å	0.29	0.17	Cysteine synthase
5mb9.1.A	18.18	hetero-oligomer	HHblits	X-ray	3.20Å	0.30	0.17	Putative heat shock protein
5mb9.2.A	18.18	hetero-oligomer	HHblits	X-ray	3.20Å	0.30	0.17	Putative heat shock protein
4naf.1.A	28.57	hetero-oligomer	HHblits	X-ray	1.90Å	0.34	0.16	Heptaprenylglyceryl phosphate synthase
2qk4.1.A	15.56	monomer	HHblits	X-ray	2.45Å	0.28	0.17	Trifunctional purine biosynthetic protein adenosine-3
4h4z.1.A	31.71	homo-dimer	HHblits	X-ray	1.95Å	0.35	0.16	Biphenyl dioxygenase ferredoxin reductase subunit
4h4x.1.A	31.71	homo-dimer	HHblits	X-ray	1.50Å	0.35	0.16	Biphenyl dioxygenase ferredoxin reductase subunit
2gr3.1.A	31.71	homo-dimer	HHblits	X-ray	1.50Å	0.35	0.16	ferredoxin reductase
5vev.1.A	11.11	monomer	HHblits	X-ray	1.90Å	0.27	0.17	Phosphoribosylamine--glycine ligase
2ys6.1.A	13.33	monomer	HHblits	X-ray	2.21Å	0.27	0.17	Phosphoribosylglycinamide synthetase
4qwv.1.A	11.63	monomer	HHblits	X-ray	2.45Å	0.30	0.16	High-affinity leucine-specific transport system periplasmic binding protein, Chemotaxis protein CheY
2xcl.1.A	15.22	monomer	HHblits	X-ray	2.10Å	0.25	0.17	PHOSPHORIBOSYLAMINE--GLYCINE LIGASE
3lxd.1.A	23.81	monomer	HHblits	X-ray	2.50Å	0.32	0.16	FAD-dependent pyridine nucleotide-disulphide oxidoreductase
4h4v.1.A	32.50	homo-dimer	HHblits	X-ray	1.40Å	0.35	0.15	Biphenyl dioxygenase ferredoxin reductase subunit
4h4r.1.A	32.50	homo-dimer	HHblits	X-ray	1.40Å	0.35	0.15	Biphenyl dioxygenase ferredoxin reductase subunit
4h4t.1.A	32.50	homo-dimer	HHblits	X-ray	1.50Å	0.35	0.15	Biphenyl dioxygenase ferredoxin reductase subunit
2yvg.1.A	32.50	homo-dimer	HHblits	X-ray	1.60Å	0.35	0.15	Ferredoxin reductase
2yvj.1.A	32.50	hetero-oligomer	HHblits	X-ray	1.90Å	0.35	0.15	Ferredoxin reductase
2yvj.1.C	32.50	hetero-oligomer	HHblits	X-ray	1.90Å	0.35	0.15	Ferredoxin reductase
1d7y.1.A	32.50	homo-dimer	HHblits	X-ray	2.10Å	0.35	0.15	FERREDOXIN REDUCTASE
4h4p.1.A	32.50	homo-dimer	HHblits	X-ray	1.50Å	0.35	0.15	Biphenyl dioxygenase ferredoxin reductase subunit
4fdc.1.A	24.39	monomer	HHblits	X-ray	2.40Å	0.33	0.16	Apoptosis-inducing factor 1, mitochondrial
5fs9.1.A	24.39	monomer	HHblits	X-ray	1.75Å	0.33	0.16	APOPTOSIS-INDUCING FACTOR 1, MITOCHONDRIAL
5fmh.1.A	24.39	monomer	HHblits	X-ray	1.80Å	0.33	0.16	APOPTOSIS-INDUCING FACTOR 1, MITOCHONDRIAL
5fs8.1.A	24.39	monomer	HHblits	X-ray	1.40Å	0.33	0.16	APOPTOSIS-INDUCING FACTOR 1, MITOCHONDRIAL
1zfj.1.A	24.39	homo-tetramer	HHblits	X-ray	1.90Å	0.32	0.16	INOSINE MONOPHOSPHATE DEHYDROGENASE
3ics.1.A	19.51	homo-dimer	HHblits	X-ray	1.94Å	0.32	0.16	Coenzyme A-Disulfide Reductase
3lb8.1.A	19.05	hetero-oligomer	HHblits	X-ray	2.60Å	0.30	0.16	Putidaredoxin reductase
3lb8.2.A	19.05	hetero-oligomer	HHblits	X-ray	2.60Å	0.30	0.16	Putidaredoxin reductase
4bur.1.A	25.00	monomer	HHblits	X-ray	2.88Å	0.33	0.15	APOPTOSIS INDUCING FACTOR 1, MITOCHONDRIAL
4bur.3.A	25.00	monomer	HHblits	X-ray	2.88Å	0.33	0.15	APOPTOSIS INDUCING FACTOR 1, MITOCHONDRIAL
1m6i.1.A	25.00	monomer	HHblits	X-ray	1.80Å	0.33	0.15	Programmed cell death protein 8
5fs6.1.A	25.00	monomer	HHblits	X-ray	1.90Å	0.33	0.15	APOPTOSIS-INDUCING FACTOR 1, MITOCHONDRIAL
4lii.1.A	25.00	monomer	HHblits	X-ray	1.88Å	0.33	0.15	Apoptosis-inducing factor 1, mitochondrial
5fs7.1.A	25.00	monomer	HHblits	X-ray	1.85Å	0.33	0.15	APOPTOSIS-INDUCING FACTOR 1, MITOCHONDRIAL
3gd4.1.A	25.00	homo-dimer	HHblits	X-ray	2.24Å	0.33	0.15	Apoptosis-inducing factor 1, mitochondrial
3gd4.1.B	25.00	homo-dimer	HHblits	X-ray	2.24Å	0.33	0.15	Apoptosis-inducing factor 1, mitochondrial
5miu.1.A	25.00	monomer	HHblits	X-ray	3.50Å	0.33	0.15	Apoptosis-inducing factor 1, mitochondrial
5miv.1.A	25.00	homo-dimer	HHblits	X-ray	3.10Å	0.33	0.15	Apoptosis-inducing factor 1, mitochondrial
5miv.1.B	25.00	homo-dimer	HHblits	X-ray	3.10Å	0.33	0.15	Apoptosis-inducing factor 1, mitochondrial
3gd3.1.A	25.00	monomer	HHblits	X-ray	2.95Å	0.33	0.15	Apoptosis-inducing factor 1, mitochondrial
3gd3.2.A	25.00	monomer	HHblits	X-ray	2.95Å	0.33	0.15	Apoptosis-inducing factor 1, mitochondrial
3gd3.4.A	25.00	monomer	HHblits	X-ray	2.95Å	0.33	0.15	Apoptosis-inducing factor 1, mitochondrial
3hyv.1.A	25.64	homo-trimer	HHblits	X-ray	2.30Å	0.35	0.15	Sulfide-quinone reductase
2v3a.1.A	27.50	monomer	HHblits	X-ray	2.40Å	0.33	0.15	RUBREDOXIN REDUCTASE
2v3b.1.A	27.50	hetero-oligomer	HHblits	X-ray	2.45Å	0.33	0.15	RUBREDOXIN REDUCTASE
3ef6.1.A	25.64	monomer	HHblits	X-ray	1.80Å	0.35	0.15	Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase
4emi.1.A	25.64	monomer	HHblits	X-ray	1.81Å	0.35	0.15	TodA
4emj.1.A	25.64	hetero-oligomer	HHblits	X-ray	2.40Å	0.35	0.15	TodA
2c7g.1.A	9.30	homo-dimer	HHblits	X-ray	1.80Å	0.27	0.16	NADPH-FERREDOXIN REDUCTASE FPRA
3kd9.1.A	17.07	homo-dimer	HHblits	X-ray	2.75Å	0.31	0.16	Coenzyme A disulfide reductase
4fx9.1.A	17.07	homo-dimer	HHblits	X-ray	2.70Å	0.31	0.16	Coenzyme A disulfide reductase
2y85.1.A	19.51	monomer	HHblits	X-ray	2.40Å	0.30	0.16	PHOSPHORIBOSYL ISOMERASE A
3zs4.1.A	19.51	monomer	HHblits	X-ray	1.90Å	0.30	0.16	PHOSPHORIBOSYL ISOMERASE A
5jcm.1.A	16.67	monomer	HHblits	X-ray	1.90Å	0.28	0.16	Os09g0567300 protein
5jcl.1.A	16.67	monomer	HHblits	X-ray	1.80Å	0.28	0.16	Os09g0567300 protein
5kvi.1.A	25.64	monomer	HHblits	X-ray	2.00Å	0.34	0.15	Apoptosis-inducing factor 1, mitochondrial
1gv4.1.A	25.64	monomer	HHblits	X-ray	2.00Å	0.34	0.15	PROGRAMED CELL DEATH PROTEIN 8
5kvh.1.A	25.64	homo-dimer	HHblits	X-ray	2.27Å	0.34	0.15	Apoptosis-inducing factor 1, mitochondrial
1q1r.1.A	19.51	monomer	HHblits	X-ray	1.91Å	0.30	0.16	Putidaredoxin reductase
1q1w.2.A	19.51	monomer	HHblits	X-ray	2.60Å	0.30	0.16	Putidaredoxin reductase
3j7a.1.R	17.07	hetero-oligomer	HHblits	EM	NA	0.29	0.16	40S ribosomal protein eS12
3ipc.1.A	17.50	monomer	HHblits	X-ray	1.30Å	0.30	0.15	ABC transporter, substrate binding protein (Amino acid)
5ere.1.A	19.51	monomer	HHblits	X-ray	2.00Å	0.28	0.16	Extracellular ligand-binding receptor
1usi.1.A	12.50	monomer	HHblits	X-ray	1.80Å	0.30	0.15	LEUCINE-SPECIFIC BINDING PROTEIN
1usg.1.A	12.50	homo-dimer	HHblits	X-ray	1.53Å	0.30	0.15	LEUCINE-SPECIFIC BINDING PROTEIN
3zfh.1.A	15.00	homo-tetramer	HHblits	X-ray	2.25Å	0.30	0.15	INOSINE 5'-MONOPHOSPHATE DEHYDROGENASE
3ipa.1.A	17.50	monomer	HHblits	X-ray	1.55Å	0.30	0.15	ABC transporter, substrate binding protein (Amino acid)
4dqw.1.A	15.00	homo-octamer	HHblits	X-ray	2.51Å	0.30	0.15	Inosine-5'-monophosphate dehydrogenase
4dqw.1.B	15.00	homo-octamer	HHblits	X-ray	2.51Å	0.30	0.15	Inosine-5'-monophosphate dehydrogenase
2liv.1.A	12.50	monomer	HHblits	X-ray	2.40Å	0.30	0.15	LEUCINE
3iwa.1.A	17.50	homo-dimer	HHblits	X-ray	2.30Å	0.30	0.15	FAD-dependent pyridine nucleotide-disulphide oxidoreductase
3noy.1.A	15.00	homo-dimer	HHblits	X-ray	2.70Å	0.29	0.15	4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
3noy.2.A	15.00	homo-dimer	HHblits	X-ray	2.70Å	0.29	0.15	4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
4v8m.14.A	22.50	monomer	HHblits	EM	5.57Å	0.29	0.15	40S RIBOSOMAL PROTEIN S12
4n0q.1.A	22.50	monomer	HHblits	X-ray	2.30Å	0.29	0.15	Leu/Ile/Val-binding protein homolog 3
3ma8.1.A	17.50	homo-tetramer	HHblits	X-ray	2.64Å	0.29	0.15	Pyruvate kinase
1lqu.1.A	9.76	monomer	HHblits	X-ray	1.25Å	0.27	0.16	FprA
5l1n.1.A	17.95	homo-dimer	HHblits	X-ray	3.60Å	0.31	0.15	Coenzyme A disulfide reductase
3urm.1.A	21.05	monomer	HHblits	X-ray	1.80Å	0.33	0.14	Multiple sugar-binding periplasmic receptor ChvE
3iuy.1.A	12.20	monomer	HHblits	X-ray	2.40Å	0.27	0.16	Probable ATP-dependent RNA helicase DDX53
5jci.1.A	17.50	monomer	HHblits	X-ray	1.70Å	0.28	0.15	Os09g0567300 protein
3hjw.1.C	20.51	hetero-oligomer	HHblits	X-ray	2.35Å	0.30	0.15	50S ribosomal protein L7Ae
2czw.1.A	20.51	monomer	HHblits	X-ray	1.90Å	0.30	0.15	50S ribosomal protein L7Ae
3eoe.1.A	17.95	homo-tetramer	HHblits	X-ray	2.31Å	0.30	0.15	Pyruvate kinase
3eoe.1.B	17.95	homo-tetramer	HHblits	X-ray	2.31Å	0.30	0.15	Pyruvate kinase
3gg8.1.B	17.95	homo-tetramer	HHblits	X-ray	2.21Å	0.30	0.15	Pyruvate kinase
3gg8.1.A	17.95	homo-tetramer	HHblits	X-ray	2.21Å	0.30	0.15	Pyruvate kinase
3cge.1.A	12.50	homo-dimer	HHblits	X-ray	2.26Å	0.28	0.15	Pyridine nucleotide-disulfide oxidoreductase, class I
4avf.1.A	12.82	homo-tetramer	HHblits	X-ray	2.23Å	0.29	0.15	INOSINE-5'-MONOPHOSPHATE DEHYDROGENASE
3rv3.1.A	12.20	homo-dimer	HHblits	X-ray	1.91Å	0.25	0.16	Biotin carboxylase
4n0q.1.A	17.95	monomer	HHblits	X-ray	2.30Å	0.29	0.15	Leu/Ile/Val-binding protein homolog 3
4kv7.1.A	23.08	monomer	HHblits	X-ray	1.20Å	0.29	0.15	Probable leucine/isoleucine/valine-binding protein
4u5c.1.A	4.76	hetero-oligomer	HHblits	X-ray	3.69Å	0.23	0.16	Glutamate receptor 2
4u5c.1.B	4.76	hetero-oligomer	HHblits	X-ray	3.69Å	0.23	0.16	Glutamate receptor 2
4u5c.1.C	4.76	hetero-oligomer	HHblits	X-ray	3.69Å	0.23	0.16	Glutamate receptor 2
4u5c.1.D	4.76	hetero-oligomer	HHblits	X-ray	3.69Å	0.23	0.16	Glutamate receptor 2
4u5d.1.A	4.76	hetero-oligomer	HHblits	X-ray	3.58Å	0.23	0.16	Glutamate receptor 2
4u5d.1.B	4.76	hetero-oligomer	HHblits	X-ray	3.58Å	0.23	0.16	Glutamate receptor 2
4u5d.1.C	4.76	hetero-oligomer	HHblits	X-ray	3.58Å	0.23	0.16	Glutamate receptor 2
4u5d.1.D	4.76	hetero-oligomer	HHblits	X-ray	3.58Å	0.23	0.16	Glutamate receptor 2
2gps.1.A	12.20	monomer	HHblits	X-ray	2.80Å	0.25	0.16	Biotin carboxylase
1fq0.1.A	24.32	homo-trimer	HHblits	X-ray	2.10Å	0.33	0.14	KDPG ALDOLASE
1eua.1.C	24.32	homo-trimer	HHblits	X-ray	1.95Å	0.33	0.14	KDPG ALDOLASE
1wau.1.A	24.32	homo-trimer	HHblits	X-ray	2.80Å	0.33	0.14	KHG/KDPG ALDOLASE
3gve.1.A	23.08	homo-dimer	HHblits	X-ray	1.25Å	0.28	0.15	YfkN protein
2ozb.1.B	20.51	hetero-oligomer	HHblits	X-ray	2.60Å	0.28	0.15	U4/U6.U5 tri-snRNP 15.5 kDa protein
2ozb.2.B	20.51	hetero-oligomer	HHblits	X-ray	2.60Å	0.28	0.15	U4/U6.U5 tri-snRNP 15.5 kDa protein
3siu.1.A	20.51	hetero-oligomer	HHblits	X-ray	2.63Å	0.28	0.15	NHP2-like protein 1
3siu.2.A	20.51	hetero-oligomer	HHblits	X-ray	2.63Å	0.28	0.15	NHP2-like protein 1
3siv.1.A	20.51	hetero-oligomer	HHblits	X-ray	3.30Å	0.28	0.15	NHP2-like protein 1
3siv.1.D	20.51	hetero-oligomer	HHblits	X-ray	3.30Å	0.28	0.15	NHP2-like protein 1
3siv.2.A	20.51	hetero-oligomer	HHblits	X-ray	3.30Å	0.28	0.15	NHP2-like protein 1
3siv.2.D	20.51	hetero-oligomer	HHblits	X-ray	3.30Å	0.28	0.15	NHP2-like protein 1
1x7i.1.A	18.42	homo-dimer	HHblits	X-ray	1.70Å	0.30	0.14	Copper homeostasis protein cutC
1x7i.1.B	18.42	homo-dimer	HHblits	X-ray	1.70Å	0.30	0.14	Copper homeostasis protein cutC
1twd.1.A	18.42	homo-dimer	HHblits	X-ray	1.70Å	0.30	0.14	Copper homeostasis protein cutC
1twd.1.B	18.42	homo-dimer	HHblits	X-ray	1.70Å	0.30	0.14	Copper homeostasis protein cutC
1g21.1.B	13.16	hetero-oligomer	HHblits	X-ray	3.00Å	0.30	0.14	NITROGENASE MOLYBDENUM-IRON PROTEIN BETA CHAIN
3cgb.1.A	12.82	homo-dimer	HHblits	X-ray	1.90Å	0.28	0.15	Pyridine nucleotide-disulfide oxidoreductase, class I
4x9s.1.A	12.50	monomer	HHblits	X-ray	1.60Å	0.26	0.15	Phosphoribosyl isomerase A
3lkv.1.A	21.05	homo-dimer	HHblits	X-ray	2.20Å	0.30	0.14	uncharacterized CONSERVED DOMAIN PROTEIN
4nas.1.A	24.32	homo-dimer	HHblits	X-ray	1.92Å	0.32	0.14	Ribulose-bisphosphate carboxylase
1e1m.1.A	15.38	monomer	HHblits	X-ray	1.85Å	0.27	0.15	ADRENODOXIN REDUCTASE
1e1l.1.A	15.38	monomer	HHblits	X-ray	2.30Å	0.27	0.15	ADRENODOXIN REDUCTASE
1e6e.2.A	15.38	hetero-oligomer	HHblits	X-ray	2.30Å	0.27	0.15	NADPH\:ADRENODOXIN OXIDOREDUCTASE
1e6e.1.A	15.38	hetero-oligomer	HHblits	X-ray	2.30Å	0.27	0.15	NADPH\:ADRENODOXIN OXIDOREDUCTASE
4lck.1.A	12.82	monomer	HHblits	X-ray	3.20Å	0.27	0.15	Ribosomal protein YbxF
4lck.2.A	12.82	monomer	HHblits	X-ray	3.20Å	0.27	0.15	Ribosomal protein YbxF
3v7e.1.A	12.82	monomer	HHblits	X-ray	2.80Å	0.27	0.15	Ribosome-associated protein L7Ae-like
4tzz.2.A	12.82	monomer	HHblits	X-ray	3.64Å	0.27	0.15	Ribosome-associated protein L7Ae-like
4tzp.2.A	12.82	monomer	HHblits	X-ray	8.50Å	0.27	0.15	Ribosome-associated protein L7Ae-like
4tzw.1.A	12.82	monomer	HHblits	X-ray	4.67Å	0.27	0.15	Ribosome-associated protein L7Ae-like
4kv7.1.A	12.50	monomer	HHblits	X-ray	1.20Å	0.25	0.15	Probable leucine/isoleucine/valine-binding protein
3khd.1.A	15.79	homo-tetramer	HHblits	X-ray	2.70Å	0.29	0.14	Pyruvate kinase
1wbh.1.A	25.00	homo-trimer	HHblits	X-ray	1.55Å	0.33	0.14	KHG/KDPG ALDOLASE
4nut.1.A	18.42	hetero-oligomer	HHblits	X-ray	1.55Å	0.28	0.14	13 kDa ribonucleoprotein-associated protein
3jcm.1.G	18.42	hetero-oligomer	HHblits	EM	NA	0.28	0.14	13 kDa ribonucleoprotein-associated protein
1zwz.1.A	18.42	monomer	HHblits	X-ray	1.90Å	0.28	0.14	Snu13p
5wyk.1.G	18.42	hetero-oligomer	HHblits	EM	NA	0.28	0.14	13 kDa ribonucleoprotein-associated protein
5wyj.7.A	18.42	monomer	HHblits	EM	NA	0.28	0.14	13 kDa ribonucleoprotein-associated protein
5nrl.1.R	18.42	hetero-oligomer	HHblits	EM	NA	0.28	0.14	13 kDa ribonucleoprotein-associated protein
5wlc.48.A	18.42	monomer	HHblits	EM	NA	0.28	0.14	Snu13
5wlc.47.A	18.42	monomer	HHblits	EM	NA	0.28	0.14	Snu13
5kmp.1.A	13.51	homo-dimer	HHblits	X-ray	3.20Å	0.30	0.14	FAD-dependent pyridine nucleotide-disulfide oxidoreductase
2oek.1.A	21.62	homo-dimer	HHblits	X-ray	1.80Å	0.30	0.14	2,3-diketo-5-methylthiopentyl-1-phosphate enolase
2hqb.1.A	7.69	monomer	HHblits	X-ray	2.70Å	0.26	0.15	Transcriptional activator of comK gene
1xm3.1.A	13.51	homo-tetramer	HHblits	X-ray	1.80Å	0.30	0.14	Thiazole biosynthesis protein thiG
3ipa.1.A	7.69	monomer	HHblits	X-ray	1.55Å	0.25	0.15	ABC transporter, substrate binding protein (Amino acid)
2zvi.1.A	21.62	homo-dimer	HHblits	X-ray	2.30Å	0.29	0.14	2,3-diketo-5-methylthiopentyl-1-phosphate enolase
2zvi.1.B	21.62	homo-dimer	HHblits	X-ray	2.30Å	0.29	0.14	2,3-diketo-5-methylthiopentyl-1-phosphate enolase
2zvi.2.A	21.62	homo-dimer	HHblits	X-ray	2.30Å	0.29	0.14	2,3-diketo-5-methylthiopentyl-1-phosphate enolase
4f06.1.A	5.26	monomer	HHblits	X-ray	1.30Å	0.26	0.14	Extracellular ligand-binding receptor
3vrd.1.B	19.44	hetero-oligomer	HHblits	X-ray	1.50Å	0.30	0.14	Flavocytochrome c flavin subunit
5kmq.1.A	13.89	homo-dimer	HHblits	X-ray	2.70Å	0.30	0.14	FAD-dependent pyridine nucleotide-disulfide oxidoreductase
2lbp.1.A	7.69	monomer	HHblits	X-ray	2.40Å	0.24	0.15	LEUCINE-BINDING PROTEIN
4evs.1.A	5.41	monomer	HHblits	X-ray	1.45Å	0.26	0.14	PUTATIVE ABC TRANSPORTER SUBUNIT, SUBSTRATE-BINDING COMPONENT
5koj.1.B	13.89	hetero-oligomer	HHblits	X-ray	2.59Å	0.28	0.14	Nitrogenase FeMo beta subunit protein NifK
1usi.1.A	7.89	monomer	HHblits	X-ray	1.80Å	0.24	0.14	LEUCINE-SPECIFIC BINDING PROTEIN
1usg.1.A	7.89	homo-dimer	HHblits	X-ray	1.53Å	0.24	0.14	LEUCINE-SPECIFIC BINDING PROTEIN
3ipc.1.A	8.11	monomer	HHblits	X-ray	1.30Å	0.25	0.14	ABC transporter, substrate binding protein (Amino acid)
4nwz.1.A	17.65	homo-dimer	HHblits	X-ray	2.50Å	0.31	0.13	FAD-dependent pyridine nucleotide-disulfide oxidoreductase
1z16.1.A	8.11	monomer	HHblits	X-ray	1.72Å	0.24	0.14	Leu/Ile/Val-binding protein
1z15.1.A	8.11	monomer	HHblits	X-ray	1.70Å	0.24	0.14	Leu/Ile/Val-binding protein
3ijd.1.A	20.00	homo-dimer	HHblits	X-ray	2.00Å	0.28	0.13	uncharacterized protein
3cu5.1.A	21.21	homo-dimer	HHblits	X-ray	2.60Å	0.32	0.13	Two component transcriptional regulator, AraC family
3cu5.1.B	21.21	homo-dimer	HHblits	X-ray	2.60Å	0.32	0.13	Two component transcriptional regulator, AraC family
2qxy.1.A	21.88	homo-dimer	HHblits	X-ray	1.95Å	0.32	0.12	Response regulator
2qxy.1.B	21.88	homo-dimer	HHblits	X-ray	1.95Å	0.32	0.12	Response regulator
3gqb.1.A	29.03	hetero-oligomer	HHblits	X-ray	2.80Å	0.33	0.12	V-type ATP synthase alpha chain
3e61.1.A	19.35	homo-tetramer	HHblits	X-ray	2.00Å	0.32	0.12	Putative transcriptional repressor of ribose operon
2qsj.1.A	9.38	homo-dimer	HHblits	X-ray	2.10Å	0.29	0.12	DNA-binding response regulator, LuxR family
3ggg.2.B	30.00	homo-dimer	HHblits	X-ray	2.21Å	0.33	0.11	Prephenate dehydrogenase
3ggg.1.B	30.00	homo-dimer	HHblits	X-ray	2.21Å	0.33	0.11	Prephenate dehydrogenase
3ggg.2.A	30.00	homo-dimer	HHblits	X-ray	2.21Å	0.33	0.11	Prephenate dehydrogenase
3ggg.1.A	30.00	homo-dimer	HHblits	X-ray	2.21Å	0.33	0.11	Prephenate dehydrogenase
3ggo.1.A	30.00	homo-dimer	HHblits	X-ray	2.15Å	0.33	0.11	Prephenate dehydrogenase
3ggo.2.B	30.00	homo-dimer	HHblits	X-ray	2.15Å	0.33	0.11	Prephenate dehydrogenase
3ggp.2.A	30.00	homo-dimer	HHblits	X-ray	2.25Å	0.33	0.11	Prephenate dehydrogenase
5dmm.1.A	18.75	monomer	HHblits	X-ray	1.78Å	0.26	0.12	Homocysteine S-methyltransferase
5dmn.1.A	18.75	homo-dimer	HHblits	X-ray	2.89Å	0.26	0.12	Homocysteine S-methyltransferase
3oqb.1.A	9.38	homo-octamer	HHblits	X-ray	2.60Å	0.25	0.12	Oxidoreductase
3oqb.1.E	9.38	homo-octamer	HHblits	X-ray	2.60Å	0.25	0.12	Oxidoreductase
1kji.1.A	16.13	homo-dimer	HHblits	X-ray	1.60Å	0.26	0.12	phosphoribosylglycinamide formyltransferase 2
1kji.1.B	16.13	homo-dimer	HHblits	X-ray	1.60Å	0.26	0.12	phosphoribosylglycinamide formyltransferase 2
2xdq.1.A	6.67	hetero-oligomer	HHblits	X-ray	2.40Å	0.23	0.11	LIGHT-INDEPENDENT PROTOCHLOROPHYLLIDE REDUCTASE SUBUNIT N
3p94.1.A	18.52	monomer	HHblits	X-ray	1.93Å	0.29	0.10	GDSL-like Lipase
5a9s.1.B	28.00	hetero-oligomer	HHblits	X-ray	2.06Å	0.34	0.10	IMINE REDUCTASE
5a9r.1.A	28.00	homo-dimer	HHblits	X-ray	1.55Å	0.34	0.10	IMINE REDUCTASE
5a9s.1.A	28.00	hetero-oligomer	HHblits	X-ray	2.06Å	0.34	0.10	IMINE REDUCTASE
5fwn.1.B	28.00	homo-dimer	HHblits	X-ray	2.14Å	0.34	0.10	IMINE REDUCTASE
3iwp.1.B	19.23	homo-tetramer	HHblits	X-ray	2.50Å	0.31	0.10	Copper homeostasis protein cutC homolog
3iwp.1.A	19.23	homo-tetramer	HHblits	X-ray	2.50Å	0.31	0.10	Copper homeostasis protein cutC homolog
3iwp.2.B	19.23	homo-tetramer	HHblits	X-ray	2.50Å	0.31	0.10	Copper homeostasis protein cutC homolog
3iwp.2.C	19.23	homo-tetramer	HHblits	X-ray	2.50Å	0.31	0.10	Copper homeostasis protein cutC homolog
3iwp.2.D	19.23	homo-tetramer	HHblits	X-ray	2.50Å	0.31	0.10	Copper homeostasis protein cutC homolog
3iwp.3.A	19.23	homo-tetramer	HHblits	X-ray	2.50Å	0.31	0.10	Copper homeostasis protein cutC homolog
3iwp.3.B	19.23	homo-tetramer	HHblits	X-ray	2.50Å	0.31	0.10	Copper homeostasis protein cutC homolog
3iwp.3.C	19.23	homo-tetramer	HHblits	X-ray	2.50Å	0.31	0.10	Copper homeostasis protein cutC homolog
3iwp.3.D	19.23	homo-tetramer	HHblits	X-ray	2.50Å	0.31	0.10	Copper homeostasis protein cutC homolog
3pn9.1.A	11.11	homo-tetramer	HHblits	X-ray	2.00Å	0.26	0.10	Proline dipeptidase
3ic9.1.A	16.00	homo-dimer	HHblits	X-ray	2.15Å	0.32	0.10	dihydrolipoamide dehydrogenase
3ic9.1.B	16.00	homo-dimer	HHblits	X-ray	2.15Å	0.32	0.10	dihydrolipoamide dehydrogenase
3ic9.2.B	16.00	homo-dimer	HHblits	X-ray	2.15Å	0.32	0.10	dihydrolipoamide dehydrogenase
3a5d.1.A	29.17	hetero-oligomer	HHblits	X-ray	4.80Å	0.34	0.09	V-type ATP synthase alpha chain
3a5d.1.B	29.17	hetero-oligomer	HHblits	X-ray	4.80Å	0.34	0.09	V-type ATP synthase alpha chain
3a5d.2.C	29.17	hetero-oligomer	HHblits	X-ray	4.80Å	0.34	0.09	V-type ATP synthase alpha chain
4rsm.1.A	16.67	monomer	HHblits	X-ray	1.60Å	0.32	0.09	Periplasmic binding protein/LacI transcriptional regulator
4rs3.1.A	20.83	monomer	HHblits	X-ray	1.40Å	0.32	0.09	ABC transporter, carbohydrate uptake transporter-2 (CUT2) family, periplasmic sugar-binding protein
3pjd.1.A	11.54	homo-dimer	HHblits	X-ray	2.50Å	0.26	0.10	Enoyl-[acyl-carrier-protein] reductase [NADH]
5dkv.1.A	12.00	monomer	HHblits	X-ray	1.68Å	0.28	0.10	ABC transporter substrate binding protein (Ribose)
5dkv.4.A	12.00	monomer	HHblits	X-ray	1.68Å	0.28	0.10	ABC transporter substrate binding protein (Ribose)
3fwn.1.A	26.09	homo-dimer	HHblits	X-ray	1.50Å	0.34	0.09	6-phosphogluconate dehydrogenase, decarboxylating
3fwn.1.B	26.09	homo-dimer	HHblits	X-ray	1.50Å	0.34	0.09	6-phosphogluconate dehydrogenase, decarboxylating
2iz1.1.B	26.09	homo-dimer	HHblits	X-ray	2.30Å	0.34	0.09	6-PHOSPHOGLUCONATE DEHYDROGENASE, DECARBOXYLATING
2iz1.1.A	26.09	homo-dimer	HHblits	X-ray	2.30Å	0.34	0.09	6-PHOSPHOGLUCONATE DEHYDROGENASE, DECARBOXYLATING
2iyo.1.A	26.09	homo-dimer	HHblits	X-ray	2.40Å	0.34	0.09	6-PHOSPHOGLUCONATE DEHYDROGENASE, DECARBOXYLATING
1qh1.1.B	16.67	hetero-oligomer	HHblits	X-ray	1.60Å	0.31	0.09	PROTEIN (NITROGENASE MOLYBDENUM IRON PROTEIN)
3qg1.1.A	21.74	monomer	HHblits	X-ray	2.95Å	0.34	0.09	V-type ATP synthase alpha chain
5i9m.2.D	3.85	homo-tetramer	HHblits	X-ray	2.25Å	0.25	0.10	Enoyl-[acyl-carrier-protein] reductase [NADH]
4bku.1.C	3.85	homo-tetramer	HHblits	X-ray	1.84Å	0.25	0.10	ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
5i8w.1.C	3.85	homo-tetramer	HHblits	X-ray	1.63Å	0.25	0.10	Enoyl-[acyl-carrier-protein] reductase [NADH]
5cx1.1.B	12.50	hetero-oligomer	HHblits	X-ray	1.75Å	0.31	0.09	Nitrogenase molybdenum-iron protein beta chain
5bra.1.A	25.00	monomer	HHblits	X-ray	2.97Å	0.31	0.09	Putative periplasmic binding protein with substrate ribose
2w8z.1.A	21.74	homo-dimer	HHblits	X-ray	2.30Å	0.34	0.09	6-PHOSPHOGLUCONATE DEHYDROGENASE, DECARBOXYLATING
1glg.1.A	20.83	monomer	HHblits	X-ray	2.00Å	0.30	0.09	GALACTOSE/GLUCOSE-BINDING PROTEIN
2qw1.1.A	20.83	monomer	HHblits	X-ray	1.70Å	0.30	0.09	D-galactose-binding periplasmic protein
2fvy.1.A	20.83	monomer	HHblits	X-ray	0.92Å	0.30	0.09	D-galactose-binding periplasmic protein
2ipm.1.A	20.83	monomer	HHblits	X-ray	1.12Å	0.30	0.09	D-galactose-binding periplasmic protein
2ipn.1.A	20.83	monomer	HHblits	X-ray	1.15Å	0.30	0.09	D-galactose-binding periplasmic protein
4y9t.1.A	16.67	monomer	HHblits	X-ray	1.80Å	0.29	0.09	ABC transporter, solute binding protein
4zjp.1.A	26.09	monomer	HHblits	X-ray	1.63Å	0.31	0.09	Monosaccharide-transporting ATPase
3ma0.1.A	17.39	monomer	HHblits	X-ray	2.20Å	0.31	0.09	D-xylose-binding periplasmic protein
3m9w.1.A	17.39	monomer	HHblits	X-ray	2.15Å	0.31	0.09	D-xylose-binding periplasmic protein
2gx6.1.A	16.67	monomer	HHblits	X-ray	1.97Å	0.28	0.09	D-ribose-binding periplasmic protein
2ipl.1.A	21.74	monomer	HHblits	X-ray	1.20Å	0.31	0.09	D-galactose-binding periplasmic protein
5kws.1.A	21.74	monomer	HHblits	X-ray	1.32Å	0.30	0.09	Galactose-binding protein
3urm.1.A	13.04	monomer	HHblits	X-ray	1.80Å	0.30	0.09	Multiple sugar-binding periplasmic receptor ChvE
4ry9.1.A	26.09	monomer	HHblits	X-ray	1.40Å	0.30	0.09	Periplasmic binding protein/LacI transcriptional regulator
1gub.1.A	8.00	monomer	HHblits	X-ray	3.10Å	0.21	0.10	D-ALLOSE-BINDING PERIPLASMIC PROTEIN
1gud.1.A	8.00	monomer	HHblits	X-ray	1.71Å	0.21	0.10	D-ALLOSE-BINDING PERIPLASMIC PROTEIN
1gud.2.A	8.00	monomer	HHblits	X-ray	1.71Å	0.21	0.10	D-ALLOSE-BINDING PERIPLASMIC PROTEIN
1rpj.1.A	8.00	monomer	HHblits	X-ray	1.80Å	0.21	0.10	PROTEIN (PRECURSOR OF PERIPLASMIC SUGAR RECEPTOR)
2hph.1.A	22.73	monomer	HHblits	X-ray	1.33Å	0.31	0.08	D-galactose-binding periplasmic protein
4wxe.1.A	18.18	monomer	HHblits	X-ray	1.50Å	0.30	0.08	Transcriptional regulator, LacI family
1urp.1.A	23.81	monomer	HHblits	X-ray	2.30Å	0.31	0.08	D-RIBOSE-BINDING PROTEIN
2dri.1.A	23.81	monomer	HHblits	X-ray	1.60Å	0.31	0.08	D-RIBOSE-BINDING PROTEIN
2liv.1.A	14.29	monomer	HHblits	X-ray	2.40Å	0.30	0.08	LEUCINE
3pid.1.A	35.00	homo-dimer	HHblits	X-ray	1.40Å	0.32	0.08	UDP-glucose 6-dehydrogenase
3tro.1.A	14.29	homo-dimer	HHblits	X-ray	1.86Å	0.26	0.08	Dihydroorotate dehydrogenase
3c61.1.A	14.29	homo-dimer	HHblits	X-ray	1.80Å	0.26	0.08	Dihydroorotate dehydrogenase
3tq0.1.A	14.29	homo-dimer	HHblits	X-ray	1.90Å	0.26	0.08	Dihydroorotate dehydrogenase
4wzh.1.A	14.29	homo-dimer	HHblits	X-ray	2.12Å	0.26	0.08	Dihydroorotate dehydrogenase
3bbl.1.A	15.00	homo-dimer	HHblits	X-ray	2.35Å	0.28	0.08	Regulatory protein of LacI family
3sgz.1.A	10.00	homo-tetramer	HHblits	X-ray	1.35Å	0.27	0.08	Hydroxyacid oxidase 2
3k9c.1.A	33.33	homo-dimer	HHblits	X-ray	2.14Å	0.35	0.07	Transcriptional regulator, LacI family protein
4dqw.1.A	25.00	homo-octamer	HHblits	X-ray	2.51Å	0.30	0.06	Inosine-5'-monophosphate dehydrogenase
4dqw.1.B	25.00	homo-octamer	HHblits	X-ray	2.51Å	0.30	0.06	Inosine-5'-monophosphate dehydrogenase
3zfh.1.A	25.00	homo-tetramer	HHblits	X-ray	2.25Å	0.30	0.06	INOSINE 5'-MONOPHOSPHATE DEHYDROGENASE
1zfj.1.A	11.76	homo-tetramer	HHblits	X-ray	1.90Å	0.25	0.06	INOSINE MONOPHOSPHATE DEHYDROGENASE