SWISS-MODEL | Workspace | Model Results

SWISS-MODEL Homology Modelling Report

Model Building Report

This document lists the results for the homology modelling project "A0A013LPP4" submitted to SWISS-MODEL workspace on Oct. 18, 2017, 4:53 p.m..The submitted primary amino acid sequence is given in Table T1.

If you use any results in your research, please cite the relevant publications:

Marco Biasini; Stefan Bienert; Andrew Waterhouse; Konstantin Arnold; Gabriel Studer; Tobias Schmidt; Florian Kiefer; Tiziano Gallo Cassarino; Martino Bertoni; Lorenza Bordoli; Torsten Schwede. (2014). SWISS-MODEL: modelling protein tertiary and quaternary structure using evolutionary information. Nucleic Acids Research (1 July 2014) 42 (W1): W252-W258; doi: 10.1093/nar/gku340.
Arnold, K., Bordoli, L., Kopp, J. and Schwede, T. (2006) The SWISS-MODEL workspace: a web-based environment for protein structure homology modelling. Bioinformatics, 22, 195-201.
Benkert, P., Biasini, M. and Schwede, T. (2011) Toward the estimation of the absolute quality of individual protein structure models. Bioinformatics, 27, 343-350

Results

The SWISS-MODEL template library (SMTL version 2017-10-11, PDB release 2017-10-06) was searched with Blast (Altschul et al., 1997) and HHBlits (Remmert, et al., 2011) for evolutionary related structures matching the target sequence in Table T1. For details on the template search, see Materials and Methods. Overall 653 templates were found (Table T2).

Models

The following models were built (see Materials and Methods "Model Building"):

Model #01	File	Built with	Oligo-State	Ligands	GMQE	QMEAN
	PDB	ProMod3 Version 1.1.0.	MONOMER (matching prediction)	1 x DGL: D-GLUTAMIC ACID;	0.67	-1.57

QMEAN	-1.57
Cβ	-0.63
All Atom	0.01
Solvation	0.48
Torsion	-1.63

Template	Seq Identity	Oligo-state	Found by	Method	Resolution	Seq Similarity	Range	Coverage	Description
5ijw.1.B	35.55	homo-dimer	HHblits	X-ray	1.76Å	0.36		0.89	Glutamate racemase

Ligand	Added to Model	Description
DGL	✓	D-GLUTAMIC ACID
DGL	✕ - Binding site not conserved.	D-GLUTAMIC ACID
IOD	✕ - Not biologically relevant.	IODIDE ION
IOD	✕ - Not biologically relevant.	IODIDE ION
IOD	✕ - Not biologically relevant.	IODIDE ION

Target    MTAIQPLFSELEPMPKASADAPIGIFDSGIGGMSVAAEIAKYLPNERIVYYADTAYVPYGPRSDQEIRELTARAVDWLYR
5ijw.1.B  -----------------DRLAPIGIFDSGVGGLTVARAIIDQLPDEDIVYVGDTGNGPYGPLTIPQIRAHSLAIGDDLVS

Target    QGCKIAVVACNTASAFSLDHLREHYGEH-FPIVGL-VPALKPAVLQTRSKVVAVLATPATFRGQLIKDVVEKFAVPAGVK
5ijw.1.B  RGVKALVIACNTASSACLRDARERY--SPVPVVEVILPAVRRAVAATRNGRIGVIGTQATIASGAYQDAFAA-A--RDTE

Target    VMTLTSLELVPCVEAGQQMGETCLKALKEVLQPAAEQGADYLVLGCTHYPFLNQAIHHLFDNQFTLVDSGLAVARQTARI
5ijw.1.B  VFTVACPRFVDFVERGVTSGRQVLGLAEGYLEPLQLAEVDTLVLGCTHYPMLSGLIQLAMGDNVTLVSSAEETAKDLLRV

Target    LIKNELLCDQIGQN---VARIECYVSGNNAEALQPVLQHMIPQELTWTLHNLN
5ijw.1.B  LTELDLLRPHPD-DPSVTAVRRFEATGDPEAFTA-LAARFLGPTL--------

Model #02	File	Built with	Oligo-State	Ligands	GMQE	QMEAN
	PDB	ProMod3 Version 1.1.0.	MONOMER (matching prediction)	1 x TLA: L(+)-TARTARIC ACID;	0.58	-1.97

QMEAN	-1.97
Cβ	-0.62
All Atom	-0.36
Solvation	0.07
Torsion	-1.86

Template	Seq Identity	Oligo-state	Found by	Method	Resolution	Seq Similarity	Range	Coverage	Description
2jfw.1.A	36.53	homo-dimer	BLAST	X-ray	2.00Å	0.39	14 - 239	0.76	GLUTAMATE RACEMASE

Ligand	Added to Model	Description
TLA	✓	L(+)-TARTARIC ACID
TLA	✕ - Binding site not conserved.	L(+)-TARTARIC ACID

Target    MTAIQPLFSELEPMPKASADAPIGIFDSGIGGMSVAAEIAKYLPNERIVYYADTAYVPYGPRSDQEIRELTARAVDWLYR
2jfw.1.A  -------------MIRLTDNRPIGFIDSGVGGLTVVKEALKQLPNENILFVGDTARCPYGPRPAEQVIQYTWEMTDYLVE

Target    QGCKIAVVACNTASAFSLDHLREHYGEHFPIVGLV-PALKPAVLQTRSKVVAVLATPATFRGQLIKDVVEKFAVPAGVKV
2jfw.1.A  QGIKMLVIACNTATAVALEEIKAAL--SIPVIGVILPGTRAAVKKTQNKQVGIIGTIGTVKSQAYEKAL-KEKVPE----

Target    MTLTSL---ELVPCVEAGQQMGETCLKALKEVLQPAAEQGADYLVLGCTHYPFLNQAIHHLFDNQFTLVDSGLAVARQTA
2jfw.1.A  LTVTSLACPKFVSVVESNEYHSSVAKKIVAETLAPLTTKKIDTLILGCTHYPLLRPIIQNVMGENVQLIDSGAETVGEVS

Target    RILIKNELLCDQIGQNVARIECYVSGNNAEALQPVLQHMIPQELTWTLHNLN
2jfw.1.A  MLL-------------------------------------------------

Materials and Methods

Template Search

Template search with Blast and HHBlits has been performed against the SWISS-MODEL template library (SMTL, last update: 2017-10-11, last included PDB release: 2017-10-06).

The target sequence was searched with BLAST (Altschul et al., 1997) against the primary amino acid sequence contained in the SMTL. A total of 37 templates were found.

An initial HHblits profile has been built using the procedure outlined in (Remmert, et al., 2011), followed by 1 iteration of HHblits against NR20. The obtained profile has then be searched against all profiles of the SMTL. A total of 622 templates were found.

Template Selection

For each identified template, the template's quality has been predicted from features of the target-template alignment. The templates with the highest quality have then been selected for model building.

Model Building

Models are built based on the target-template alignment using ProMod3. Coordinates which are conserved between the target and the template are copied from the template to the model. Insertions and deletions are remodelled using a fragment library. Side chains are then rebuilt. Finally, the geometry of the resulting model is regularized by using a force field. In case loop modelling with ProMod3 fails, an alternative model is built with PROMOD-II (Guex, et al., 1997).

Model Quality Estimation

The global and per-residue model quality has been assessed using the QMEAN scoring function (Benkert, et al., 2011) . For improved performance, weights of the individual QMEAN terms have been trained specifically for SWISS-MODEL.

Ligand Modelling

Ligands present in the template structure are transferred by homology to the model when the following criteria are met (Gallo -Casserino, to be published): (a) The ligands are annotated as biologically relevant in the template library, (b) the ligand is in contact with the model, (c) the ligand is not clashing with the protein, (d) the residues in contact with the ligand are conserved between the target and the template. If any of these four criteria is not satisfied, a certain ligand will not be included in the model. The model summary includes information on why and which ligand has not been included.

Oligomeric State Conservation

Homo-oligomeric structure of the target protein is predicted based on the analysis of pairwise interfaces of the identified template structures. For each relevant interface between polypeptide chains (interfaces with more than 10 residue-residue interactions), the QscoreOligomer (Mariani et al., 2011) is predicted from features such as similarity to target and frequency of observing this interface in the identified templates (Kiefer, Bertoni, Biasini, to be published). The prediction is performed with a random forest regressor using these features as input parameters to predict the probability of conservation for each interface. The QscoreOligomer of the whole complex is then calculated as the weight-averaged QscoreOligomer of the interfaces. The oligomeric state of the target is predicted to be the same as in the template when QscoreOligomer is predicted to be higher or equal to 0.5.

References

Altschul, S.F., Madden, T.L., Schaffer, A.A., Zhang, J., Zhang, Z., Miller, W. and Lipman, D.J. (1997) Gapped BLAST and PSI-BLAST: a new generation of protein database search programs. Nucleic Acids Res, 25, 3389-3402.
Remmert, M., Biegert, A., Hauser, A. and Soding, J. (2012) HHblits: lightning-fast iterative protein sequence searching by HMM-HMM alignment. Nat Methods, 9, 173-175.
Guex, N. and Peitsch, M.C. (1997) SWISS-MODEL and the Swiss-PdbViewer: an environment for comparative protein modeling. Electrophoresis, 18, 2714-2723.
Sali, A. and Blundell, T.L. (1993) Comparative protein modelling by satisfaction of spatial restraints. J Mol Biol, 234, 779-815.
Benkert, P., Biasini, M. and Schwede, T. (2011) Toward the estimation of the absolute quality of individual protein structure models. Bioinformatics, 27, 343-350.
Mariani, V., Kiefer, F., Schmidt, T., Haas, J. and Schwede, T. (2011) Assessment of template based protein structure predictions in CASP9. Proteins, 79 Suppl 10, 37-58.

Table T1:

Primary amino acid sequence for which templates were searched and models were built.

MTAIQPLFSELEPMPKASADAPIGIFDSGIGGMSVAAEIAKYLPNERIVYYADTAYVPYGPRSDQEIRELTARAVDWLYRQGCKIAVVACNTASAFSLDH
LREHYGEHFPIVGLVPALKPAVLQTRSKVVAVLATPATFRGQLIKDVVEKFAVPAGVKVMTLTSLELVPCVEAGQQMGETCLKALKEVLQPAAEQGADYL
VLGCTHYPFLNQAIHHLFDNQFTLVDSGLAVARQTARILIKNELLCDQIGQNVARIECYVSGNNAEALQPVLQHMIPQELTWTLHNLN

Table T2:

Template	Seq Identity	Oligo-state	Found by	Method	Resolution	Seq Similarity	Coverage	Description
2jfw.1.A	30.30	homo-dimer	HHblits	X-ray	2.00Å	0.36	0.92	GLUTAMATE RACEMASE
2jfp.1.A	30.80	homo-dimer	HHblits	X-ray	1.98Å	0.36	0.91	GLUTAMATE RACEMASE
2jfo.1.B	30.80	homo-dimer	HHblits	X-ray	2.50Å	0.36	0.91	GLUTAMATE RACEMASE
2jfn.1.A	33.97	monomer	HHblits	X-ray	1.90Å	0.36	0.91	GLUTAMATE RACEMASE
2vvt.1.A	30.89	homo-dimer	HHblits	X-ray	1.65Å	0.36	0.90	GLUTAMATE RACEMASE
2vvt.1.B	30.89	homo-dimer	HHblits	X-ray	1.65Å	0.36	0.90	GLUTAMATE RACEMASE
3hfr.1.A	29.39	homo-dimer	HHblits	X-ray	2.30Å	0.35	0.91	Glutamate racemase
3hfr.1.B	29.39	homo-dimer	HHblits	X-ray	2.30Å	0.35	0.91	Glutamate racemase
2oho.1.A	29.62	homo-dimer	HHblits	X-ray	2.25Å	0.36	0.90	Glutamate Racemase
2oho.1.B	29.62	homo-dimer	HHblits	X-ray	2.25Å	0.36	0.90	Glutamate Racemase
2jfq.1.A	28.57	homo-dimer	HHblits	X-ray	2.15Å	0.36	0.90	GLUTAMATE RACEMASE
2jfq.1.B	28.57	homo-dimer	HHblits	X-ray	2.15Å	0.36	0.90	GLUTAMATE RACEMASE
1zuw.1.A	31.64	homo-dimer	HHblits	X-ray	1.75Å	0.36	0.89	glutamate racemase 1
1zuw.1.B	31.64	homo-dimer	HHblits	X-ray	1.75Å	0.36	0.89	glutamate racemase 1
2ohv.1.A	29.84	homo-dimer	HHblits	X-ray	2.50Å	0.36	0.90	Glutamate Racemase
2ohg.1.A	29.84	homo-dimer	HHblits	X-ray	2.50Å	0.36	0.90	Glutamate racemase
5ijw.1.A	35.55	homo-dimer	HHblits	X-ray	1.76Å	0.36	0.89	Glutamate racemase
5ijw.1.B	35.55	homo-dimer	HHblits	X-ray	1.76Å	0.36	0.89	Glutamate racemase
2gzm.1.A	31.50	homo-dimer	HHblits	X-ray	1.99Å	0.36	0.88	Glutamate racemase
2gzm.1.B	31.50	homo-dimer	HHblits	X-ray	1.99Å	0.36	0.88	Glutamate racemase
2gzm.2.B	31.50	homo-dimer	HHblits	X-ray	1.99Å	0.36	0.88	Glutamate racemase
5hj7.1.A	34.12	homo-dimer	HHblits	X-ray	2.30Å	0.36	0.89	Glutamate racemase
2dwu.1.A	28.91	homo-dimer	HHblits	X-ray	1.60Å	0.35	0.89	Glutamate racemase
2dwu.2.A	28.91	homo-dimer	HHblits	X-ray	1.60Å	0.35	0.89	Glutamate racemase
2jfn.1.A	39.34	monomer	BLAST	X-ray	1.90Å	0.38	0.85	GLUTAMATE RACEMASE
3out.1.A	29.20	homo-hexamer	HHblits	X-ray	1.65Å	0.35	0.87	Glutamate racemase
1b73.1.A	31.43	homo-dimer	HHblits	X-ray	2.30Å	0.35	0.85	GLUTAMATE RACEMASE
5w1q.1.A	27.35	homo-dimer	HHblits	X-ray	1.95Å	0.35	0.85	Glutamate racemase
2jfy.1.B	27.05	homo-dimer	HHblits	X-ray	1.90Å	0.35	0.85	GLUTAMATE RACEMASE
2jfz.1.A	27.05	homo-dimer	HHblits	X-ray	1.86Å	0.35	0.85	GLUTAMATE RACEMASE
2jfx.1.A	27.05	homo-dimer	HHblits	X-ray	2.30Å	0.35	0.85	GLUTAMATE RACEMASE
2jfx.1.B	27.05	homo-dimer	HHblits	X-ray	2.30Å	0.35	0.85	GLUTAMATE RACEMASE
2jfy.1.A	27.05	homo-dimer	HHblits	X-ray	1.90Å	0.35	0.85	GLUTAMATE RACEMASE
4b1f.1.B	27.05	homo-dimer	HHblits	X-ray	2.05Å	0.35	0.85	GLUTAMATE RACEMASE
2w4i.1.A	27.05	homo-tetramer	HHblits	X-ray	1.87Å	0.35	0.85	GLUTAMATE RACEMASE
3uho.1.A	28.10	monomer	HHblits	X-ray	2.20Å	0.35	0.84	Glutamate racemase
3uhf.2.A	28.10	monomer	HHblits	X-ray	1.83Å	0.35	0.84	Glutamate racemase
3uhp.1.A	28.10	monomer	HHblits	X-ray	2.79Å	0.35	0.84	Glutamate racemase
5w1q.1.A	33.48	homo-dimer	BLAST	X-ray	1.95Å	0.38	0.79	Glutamate racemase
1zuw.1.A	36.49	homo-dimer	BLAST	X-ray	1.75Å	0.39	0.77	glutamate racemase 1
1zuw.1.B	36.49	homo-dimer	BLAST	X-ray	1.75Å	0.39	0.77	glutamate racemase 1
2jfw.1.A	36.53	homo-dimer	BLAST	X-ray	2.00Å	0.39	0.76	GLUTAMATE RACEMASE
2jfq.1.A	33.33	homo-dimer	BLAST	X-ray	2.15Å	0.38	0.77	GLUTAMATE RACEMASE
2jfq.1.B	33.33	homo-dimer	BLAST	X-ray	2.15Å	0.38	0.77	GLUTAMATE RACEMASE
2gzm.1.A	35.29	homo-dimer	BLAST	X-ray	1.99Å	0.38	0.77	Glutamate racemase
2gzm.1.B	35.29	homo-dimer	BLAST	X-ray	1.99Å	0.38	0.77	Glutamate racemase
2gzm.2.B	35.29	homo-dimer	BLAST	X-ray	1.99Å	0.38	0.77	Glutamate racemase
5ijw.1.A	40.27	homo-dimer	BLAST	X-ray	1.76Å	0.38	0.77	Glutamate racemase
5ijw.1.B	40.27	homo-dimer	BLAST	X-ray	1.76Å	0.38	0.77	Glutamate racemase
5hj7.1.A	38.64	homo-dimer	BLAST	X-ray	2.30Å	0.38	0.76	Glutamate racemase
2dwu.1.A	32.29	homo-dimer	BLAST	X-ray	1.60Å	0.37	0.77	Glutamate racemase
2dwu.2.A	32.29	homo-dimer	BLAST	X-ray	1.60Å	0.37	0.77	Glutamate racemase
2jfp.1.A	36.62	homo-dimer	BLAST	X-ray	1.98Å	0.39	0.74	GLUTAMATE RACEMASE
2jfo.1.B	36.62	homo-dimer	BLAST	X-ray	2.50Å	0.39	0.74	GLUTAMATE RACEMASE
2vvt.1.A	36.62	homo-dimer	BLAST	X-ray	1.65Å	0.39	0.74	GLUTAMATE RACEMASE
2vvt.1.B	36.62	homo-dimer	BLAST	X-ray	1.65Å	0.39	0.74	GLUTAMATE RACEMASE
2ohv.1.A	35.68	homo-dimer	BLAST	X-ray	2.50Å	0.38	0.74	Glutamate Racemase
2ohg.1.A	35.68	homo-dimer	BLAST	X-ray	2.50Å	0.38	0.74	Glutamate racemase
2oho.1.A	35.68	homo-dimer	BLAST	X-ray	2.25Å	0.38	0.74	Glutamate Racemase
2oho.1.B	35.68	homo-dimer	BLAST	X-ray	2.25Å	0.38	0.74	Glutamate Racemase
3hfr.1.A	36.79	homo-dimer	BLAST	X-ray	2.30Å	0.39	0.74	Glutamate racemase
3hfr.1.B	36.79	homo-dimer	BLAST	X-ray	2.30Å	0.39	0.74	Glutamate racemase
3out.1.A	34.91	homo-hexamer	BLAST	X-ray	1.65Å	0.39	0.74	Glutamate racemase
3uho.1.A	34.76	monomer	BLAST	X-ray	2.20Å	0.38	0.73	Glutamate racemase
3uhf.2.A	34.76	monomer	BLAST	X-ray	1.83Å	0.38	0.73	Glutamate racemase
3uhp.1.A	34.76	monomer	BLAST	X-ray	2.79Å	0.38	0.73	Glutamate racemase
1b73.1.A	37.13	homo-dimer	BLAST	X-ray	2.30Å	0.38	0.70	GLUTAMATE RACEMASE
2jfy.1.B	32.64	homo-dimer	BLAST	X-ray	1.90Å	0.38	0.67	GLUTAMATE RACEMASE
2jfz.1.A	32.64	homo-dimer	BLAST	X-ray	1.86Å	0.38	0.67	GLUTAMATE RACEMASE
2jfx.1.A	32.64	homo-dimer	BLAST	X-ray	2.30Å	0.38	0.67	GLUTAMATE RACEMASE
2jfx.1.B	32.64	homo-dimer	BLAST	X-ray	2.30Å	0.38	0.67	GLUTAMATE RACEMASE
2jfy.1.A	32.64	homo-dimer	BLAST	X-ray	1.90Å	0.38	0.67	GLUTAMATE RACEMASE
4b1f.1.B	32.64	homo-dimer	BLAST	X-ray	2.05Å	0.38	0.67	GLUTAMATE RACEMASE
2w4i.1.A	32.64	homo-tetramer	BLAST	X-ray	1.87Å	0.38	0.67	GLUTAMATE RACEMASE
4fq7.1.A	18.01	homo-tetramer	HHblits	X-ray	3.00Å	0.29	0.73	Maleate cis-trans isomerase
4fq5.1.A	16.98	homo-tetramer	HHblits	X-ray	2.10Å	0.28	0.74	Maleate cis-trans isomerase
4fq5.1.B	16.98	homo-tetramer	HHblits	X-ray	2.10Å	0.28	0.74	Maleate cis-trans isomerase
1jfl.1.A	19.61	homo-dimer	HHblits	X-ray	1.90Å	0.30	0.71	ASPARTATE RACEMASE
3s81.1.A	19.61	homo-dimer	HHblits	X-ray	1.80Å	0.30	0.71	Putative aspartate racemase
2eq5.1.A	16.99	homo-dimer	HHblits	X-ray	2.20Å	0.29	0.72	228aa long hypothetical hydantoin racemase
2eq5.2.B	16.99	homo-dimer	HHblits	X-ray	2.20Å	0.29	0.72	228aa long hypothetical hydantoin racemase
2dx7.1.A	19.12	homo-dimer	HHblits	X-ray	2.00Å	0.30	0.71	aspartate racemase
2dx7.1.B	19.12	homo-dimer	HHblits	X-ray	2.00Å	0.30	0.71	aspartate racemase
3ojc.1.A	18.05	homo-tetramer	HHblits	X-ray	1.75Å	0.29	0.71	Putative aspartate/glutamate racemase
3ojc.1.B	18.05	homo-tetramer	HHblits	X-ray	1.75Å	0.29	0.71	Putative aspartate/glutamate racemase
3ojc.1.C	18.05	homo-tetramer	HHblits	X-ray	1.75Å	0.29	0.71	Putative aspartate/glutamate racemase
3ojc.1.D	18.05	homo-tetramer	HHblits	X-ray	1.75Å	0.29	0.71	Putative aspartate/glutamate racemase
5ell.1.A	17.07	homo-dimer	HHblits	X-ray	1.80Å	0.29	0.71	Asp/Glu_racemase family protein
5ell.1.B	17.07	homo-dimer	HHblits	X-ray	1.80Å	0.29	0.71	Asp/Glu_racemase family protein
5hqt.1.A	16.59	homo-dimer	HHblits	X-ray	1.60Å	0.29	0.71	aspartate/glutamate racemase
5elm.1.A	16.59	homo-dimer	HHblits	X-ray	2.00Å	0.29	0.71	Asp/Glu_racemase family protein
5elm.1.B	16.59	homo-dimer	HHblits	X-ray	2.00Å	0.29	0.71	Asp/Glu_racemase family protein
5elm.2.A	16.59	homo-dimer	HHblits	X-ray	2.00Å	0.29	0.71	Asp/Glu_racemase family protein
5elm.2.B	16.59	homo-dimer	HHblits	X-ray	2.00Å	0.29	0.71	Asp/Glu_racemase family protein
2zsk.1.A	17.82	homo-dimer	HHblits	X-ray	2.55Å	0.30	0.70	226aa long hypothetical aspartate racemase
2xed.1.A	15.46	monomer	HHblits	X-ray	1.95Å	0.28	0.72	PUTATIVE MALEATE ISOMERASE
2xec.1.A	16.02	homo-dimer	HHblits	X-ray	2.20Å	0.28	0.72	PUTATIVE MALEATE ISOMERASE
5b19.1.A	18.69	homo-dimer	HHblits	X-ray	1.85Å	0.30	0.69	Aspartate racemase
5b19.1.B	18.69	homo-dimer	HHblits	X-ray	1.85Å	0.30	0.69	Aspartate racemase
3qvj.1.A	15.42	homo-hexamer	HHblits	X-ray	2.10Å	0.29	0.70	Putative hydantoin racemase
4ix1.1.A	12.08	homo-dimer	HHblits	X-ray	2.80Å	0.26	0.72	hypothetical protein
4ix1.1.B	12.08	homo-dimer	HHblits	X-ray	2.80Å	0.26	0.72	hypothetical protein
5lfd.1.A	17.91	homo-hexamer	HHblits	X-ray	2.15Å	0.29	0.70	Allantoin racemase
4wt7.1.A	16.26	monomer	HHblits	X-ray	2.00Å	0.27	0.70	ABC transporter substrate binding protein (Ribose)
3qvl.1.A	14.93	homo-hexamer	HHblits	X-ray	1.82Å	0.28	0.70	Putative hydantoin racemase
4rs3.1.A	17.50	monomer	HHblits	X-ray	1.40Å	0.28	0.69	ABC transporter, carbohydrate uptake transporter-2 (CUT2) family, periplasmic sugar-binding protein
2dgd.1.A	10.34	homo-octamer	HHblits	X-ray	2.90Å	0.27	0.70	223aa long hypothetical arylmalonate decarboxylase
5kws.1.A	12.81	monomer	HHblits	X-ray	1.32Å	0.26	0.70	Galactose-binding protein
4irx.1.A	12.94	monomer	HHblits	X-ray	1.45Å	0.27	0.70	Sugar ABC transporter, periplasmic sugar-binding protein
3l49.1.A	12.87	monomer	HHblits	X-ray	2.30Å	0.26	0.70	ABC sugar (Ribose) transporter, periplasmic substrate-binding subunit
3ixm.1.A	16.24	monomer	HHblits	X-ray	1.90Å	0.27	0.68	Arylmalonate decarboxylase
3dg9.1.A	15.74	monomer	HHblits	X-ray	1.50Å	0.27	0.68	Arylmalonate decarboxylase
3dtv.3.A	15.74	monomer	HHblits	X-ray	2.10Å	0.27	0.68	Arylmalonate decarboxylase
3dtv.2.A	15.74	monomer	HHblits	X-ray	2.10Å	0.27	0.68	Arylmalonate decarboxylase
3dtv.1.A	15.74	monomer	HHblits	X-ray	2.10Å	0.27	0.68	Arylmalonate decarboxylase
3dtv.4.A	15.74	monomer	HHblits	X-ray	2.10Å	0.27	0.68	Arylmalonate decarboxylase
3eis.1.A	15.74	monomer	HHblits	X-ray	2.10Å	0.27	0.68	Arylmalonate decarboxylase
3eis.2.A	15.74	monomer	HHblits	X-ray	2.10Å	0.27	0.68	Arylmalonate decarboxylase
2vlb.1.A	15.74	monomer	HHblits	X-ray	1.92Å	0.27	0.68	ARYLMALONATE DECARBOXYLASE
2vlb.2.A	15.74	monomer	HHblits	X-ray	1.92Å	0.27	0.68	ARYLMALONATE DECARBOXYLASE
2vlb.3.A	15.74	monomer	HHblits	X-ray	1.92Å	0.27	0.68	ARYLMALONATE DECARBOXYLASE
2vlb.4.A	15.74	monomer	HHblits	X-ray	1.92Å	0.27	0.68	ARYLMALONATE DECARBOXYLASE
2qu7.1.A	13.78	homo-dimer	HHblits	X-ray	2.30Å	0.27	0.68	Putative transcriptional regulator
3ixl.1.A	14.72	monomer	HHblits	X-ray	1.45Å	0.27	0.68	Arylmalonate decarboxylase
3ctp.1.A	13.78	homo-dimer	HHblits	X-ray	1.41Å	0.27	0.68	Periplasmic binding protein/LacI transcriptional regulator
4wzz.1.A	13.13	monomer	HHblits	X-ray	1.70Å	0.27	0.56	Putative sugar ABC transporter, substrate-binding protein
2fn9.1.A	13.13	monomer	HHblits	X-ray	1.40Å	0.26	0.56	ribose ABC transporter, periplasmic ribose-binding protein
2fn9.2.A	13.13	monomer	HHblits	X-ray	1.40Å	0.26	0.56	ribose ABC transporter, periplasmic ribose-binding protein
1jye.1.A	13.75	homo-dimer	HHblits	X-ray	1.70Å	0.25	0.56	Lactose Operon Repressor
4xxh.1.A	16.03	homo-dimer	HHblits	X-ray	2.40Å	0.26	0.54	HTH-type transcriptional regulator TreR
4ccz.1.A	15.49	monomer	HHblits	X-ray	2.70Å	0.27	0.49	METHIONINE SYNTHASE
3pp7.1.A	11.43	homo-tetramer	HHblits	X-ray	2.35Å	0.25	0.49	Pyruvate kinase
2zya.1.A	11.68	homo-dimer	HHblits	X-ray	1.60Å	0.26	0.48	6-phosphogluconate dehydrogenase, decarboxylating
2zya.1.B	11.68	homo-dimer	HHblits	X-ray	1.60Å	0.26	0.48	6-phosphogluconate dehydrogenase, decarboxylating
2zyg.1.A	12.50	homo-dimer	HHblits	X-ray	2.10Å	0.26	0.47	6-phosphogluconate dehydrogenase, decarboxylating
3lop.1.A	12.12	monomer	HHblits	X-ray	1.55Å	0.27	0.46	Substrate binding periplasmic protein
1gr0.1.A	13.49	homo-tetramer	HHblits	X-ray	1.95Å	0.27	0.44	INOSITOL-3-PHOSPHATE SYNTHASE
4fx7.1.A	14.29	monomer	HHblits	X-ray	2.08Å	0.27	0.44	Imidazole glycerol phosphate synthase subunit HisF
3tdn.1.A	14.40	homo-dimer	HHblits	X-ray	1.40Å	0.27	0.43	FLR SYMMETRIC ALPHA-BETA TIM BARREL
4mwa.1.A	11.29	homo-tetramer	HHblits	X-ray	1.85Å	0.27	0.43	4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
4mwa.1.B	11.29	homo-tetramer	HHblits	X-ray	1.85Å	0.27	0.43	4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
4mwa.1.C	11.29	homo-tetramer	HHblits	X-ray	1.85Å	0.27	0.43	4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
4mwa.1.D	11.29	homo-tetramer	HHblits	X-ray	1.85Å	0.27	0.43	4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
4mwa.2.B	11.29	homo-tetramer	HHblits	X-ray	1.85Å	0.27	0.43	4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
4mwa.2.D	11.29	homo-tetramer	HHblits	X-ray	1.85Å	0.27	0.43	4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
3og3.1.A	13.71	monomer	HHblits	X-ray	2.08Å	0.27	0.43	Imidazole glycerol phosphate synthase subunit hisF
4axk.1.A	15.70	monomer	HHblits	X-ray	2.25Å	0.27	0.42	1-(5-PHOSPHORIBOSYL)-5-((5'-PHOSPHORIBOSYLAMINO) METHYLIDENEAMINO)IMIDAZOLE-4-CARBOXAMIDE ISOMERASE
4axk.2.A	15.70	monomer	HHblits	X-ray	2.25Å	0.27	0.42	1-(5-PHOSPHORIBOSYL)-5-((5'-PHOSPHORIBOSYLAMINO) METHYLIDENEAMINO)IMIDAZOLE-4-CARBOXAMIDE ISOMERASE
4wxe.1.A	14.17	monomer	HHblits	X-ray	1.50Å	0.27	0.42	Transcriptional regulator, LacI family
2y88.1.A	17.36	monomer	HHblits	X-ray	1.33Å	0.26	0.42	PHOSPHORIBOSYL ISOMERASE A
2y89.1.A	17.36	monomer	HHblits	X-ray	2.50Å	0.26	0.42	PHOSPHORIBOSYL ISOMERASE A
1vzw.1.A	15.97	monomer	HHblits	X-ray	1.80Å	0.26	0.41	PHOSPHORIBOSYL ISOMERASE A
2vep.1.A	15.97	monomer	HHblits	X-ray	1.80Å	0.26	0.41	PHOSPHORIBOSYL ISOMERASE A
2x30.1.A	15.97	monomer	HHblits	X-ray	1.95Å	0.26	0.41	PHOSPHORIBOSYL ISOMERASE A
3nnd.1.A	15.97	homo-tetramer	HHblits	X-ray	2.80Å	0.26	0.41	Possible substrate binding protein of ABC transporter system
1z16.1.A	13.04	monomer	HHblits	X-ray	1.72Å	0.28	0.40	Leu/Ile/Val-binding protein
1z15.1.A	13.04	monomer	HHblits	X-ray	1.70Å	0.28	0.40	Leu/Ile/Val-binding protein
4u28.1.A	17.80	monomer	HHblits	X-ray	1.33Å	0.26	0.41	Phosphoribosyl isomerase A
2lbp.1.A	11.30	monomer	HHblits	X-ray	2.40Å	0.28	0.40	LEUCINE-BINDING PROTEIN
4rk3.1.A	16.38	homo-dimer	HHblits	X-ray	1.80Å	0.27	0.40	Transcriptional regulator, LacI family
4evs.1.A	17.39	monomer	HHblits	X-ray	1.45Å	0.28	0.40	PUTATIVE ABC TRANSPORTER SUBUNIT, SUBSTRATE-BINDING COMPONENT
4rk5.1.A	15.52	homo-dimer	HHblits	X-ray	1.35Å	0.27	0.40	Transcriptional regulator, LacI family
3i09.1.A	17.39	monomer	HHblits	X-ray	1.80Å	0.27	0.40	Periplasmic branched-chain amino acid-binding protein
4f06.1.A	15.79	monomer	HHblits	X-ray	1.30Å	0.27	0.40	Extracellular ligand-binding receptor
3n0w.1.A	12.28	monomer	HHblits	X-ray	1.88Å	0.25	0.40	ABC branched chain amino acid family transporter, periplasmic ligand binding protein
1jfl.1.A	17.92	homo-dimer	HHblits	X-ray	1.90Å	0.30	0.37	ASPARTATE RACEMASE
1iu9.1.A	19.23	monomer	HHblits	X-ray	2.04Å	0.30	0.36	aspartate racemase
2w8z.1.A	11.11	homo-dimer	HHblits	X-ray	2.30Å	0.27	0.38	6-PHOSPHOGLUCONATE DEHYDROGENASE, DECARBOXYLATING
2dx7.1.A	17.48	homo-dimer	HHblits	X-ray	2.00Å	0.30	0.36	aspartate racemase
2dx7.1.B	17.48	homo-dimer	HHblits	X-ray	2.00Å	0.30	0.36	aspartate racemase
2iz1.1.B	16.82	homo-dimer	HHblits	X-ray	2.30Å	0.27	0.37	6-PHOSPHOGLUCONATE DEHYDROGENASE, DECARBOXYLATING
2iz1.1.A	16.82	homo-dimer	HHblits	X-ray	2.30Å	0.27	0.37	6-PHOSPHOGLUCONATE DEHYDROGENASE, DECARBOXYLATING
2iyo.1.A	16.82	homo-dimer	HHblits	X-ray	2.40Å	0.27	0.37	6-PHOSPHOGLUCONATE DEHYDROGENASE, DECARBOXYLATING
2w90.1.A	12.15	homo-dimer	HHblits	X-ray	2.20Å	0.27	0.37	6-PHOSPHOGLUCONATE DEHYDROGENASE, DECARBOXYLATING
2w90.1.B	12.15	homo-dimer	HHblits	X-ray	2.20Å	0.27	0.37	6-PHOSPHOGLUCONATE DEHYDROGENASE, DECARBOXYLATING
3s81.1.A	8.33	homo-dimer	HHblits	X-ray	1.80Å	0.26	0.38	Putative aspartate racemase
5b19.1.A	12.26	homo-dimer	HHblits	X-ray	1.85Å	0.27	0.37	Aspartate racemase
5b19.1.B	12.26	homo-dimer	HHblits	X-ray	1.85Å	0.27	0.37	Aspartate racemase
3ojc.1.A	13.21	homo-tetramer	HHblits	X-ray	1.75Å	0.27	0.37	Putative aspartate/glutamate racemase
3ojc.1.B	13.21	homo-tetramer	HHblits	X-ray	1.75Å	0.27	0.37	Putative aspartate/glutamate racemase
3ojc.1.C	13.21	homo-tetramer	HHblits	X-ray	1.75Å	0.27	0.37	Putative aspartate/glutamate racemase
3ojc.1.D	13.21	homo-tetramer	HHblits	X-ray	1.75Å	0.27	0.37	Putative aspartate/glutamate racemase
2eq5.1.A	10.58	homo-dimer	HHblits	X-ray	2.20Å	0.28	0.36	228aa long hypothetical hydantoin racemase
2eq5.2.B	10.58	homo-dimer	HHblits	X-ray	2.20Å	0.28	0.36	228aa long hypothetical hydantoin racemase
2jfq.1.A	14.71	homo-dimer	HHblits	X-ray	2.15Å	0.29	0.35	GLUTAMATE RACEMASE
2jfq.1.B	14.71	homo-dimer	HHblits	X-ray	2.15Å	0.29	0.35	GLUTAMATE RACEMASE
3qvj.1.A	18.81	homo-hexamer	HHblits	X-ray	2.10Å	0.30	0.35	Putative hydantoin racemase
5elm.1.A	15.24	homo-dimer	HHblits	X-ray	2.00Å	0.27	0.36	Asp/Glu_racemase family protein
5elm.1.B	15.24	homo-dimer	HHblits	X-ray	2.00Å	0.27	0.36	Asp/Glu_racemase family protein
5elm.2.A	15.24	homo-dimer	HHblits	X-ray	2.00Å	0.27	0.36	Asp/Glu_racemase family protein
5elm.2.B	15.24	homo-dimer	HHblits	X-ray	2.00Å	0.27	0.36	Asp/Glu_racemase family protein
5hqt.1.A	15.24	homo-dimer	HHblits	X-ray	1.60Å	0.26	0.36	aspartate/glutamate racemase
5ell.1.A	17.31	homo-dimer	HHblits	X-ray	1.80Å	0.27	0.36	Asp/Glu_racemase family protein
5ell.1.B	17.31	homo-dimer	HHblits	X-ray	1.80Å	0.27	0.36	Asp/Glu_racemase family protein
3qvl.1.A	17.82	homo-hexamer	HHblits	X-ray	1.82Å	0.29	0.35	Putative hydantoin racemase
2jfw.1.A	14.00	homo-dimer	HHblits	X-ray	2.00Å	0.30	0.35	GLUTAMATE RACEMASE
2vvt.1.A	14.85	homo-dimer	HHblits	X-ray	1.65Å	0.28	0.35	GLUTAMATE RACEMASE
2vvt.1.B	14.85	homo-dimer	HHblits	X-ray	1.65Å	0.28	0.35	GLUTAMATE RACEMASE
2jfp.1.A	13.86	homo-dimer	HHblits	X-ray	1.98Å	0.28	0.35	GLUTAMATE RACEMASE
2jfo.1.B	13.86	homo-dimer	HHblits	X-ray	2.50Å	0.28	0.35	GLUTAMATE RACEMASE
1zuw.1.A	14.85	homo-dimer	HHblits	X-ray	1.75Å	0.28	0.35	glutamate racemase 1
1zuw.1.B	14.85	homo-dimer	HHblits	X-ray	1.75Å	0.28	0.35	glutamate racemase 1
2zsk.1.A	10.58	homo-dimer	HHblits	X-ray	2.55Å	0.26	0.36	226aa long hypothetical aspartate racemase
3hfr.1.A	14.85	homo-dimer	HHblits	X-ray	2.30Å	0.28	0.35	Glutamate racemase
3hfr.1.B	14.85	homo-dimer	HHblits	X-ray	2.30Å	0.28	0.35	Glutamate racemase
2pn1.1.A	11.54	homo-dimer	HHblits	X-ray	2.00Å	0.25	0.36	Carbamoylphosphate synthase large subunit
2dwu.1.A	13.86	homo-dimer	HHblits	X-ray	1.60Å	0.28	0.35	Glutamate racemase
2dwu.2.A	13.86	homo-dimer	HHblits	X-ray	1.60Å	0.28	0.35	Glutamate racemase
5hj7.1.A	11.88	homo-dimer	HHblits	X-ray	2.30Å	0.27	0.35	Glutamate racemase
3rcb.1.A	12.87	monomer	HHblits	X-ray	2.49Å	0.27	0.35	Sugar 3-ketoreductase
2gzm.1.A	10.89	homo-dimer	HHblits	X-ray	1.99Å	0.27	0.35	Glutamate racemase
2gzm.1.B	10.89	homo-dimer	HHblits	X-ray	1.99Å	0.27	0.35	Glutamate racemase
2gzm.2.B	10.89	homo-dimer	HHblits	X-ray	1.99Å	0.27	0.35	Glutamate racemase
3uho.1.A	16.00	monomer	HHblits	X-ray	2.20Å	0.28	0.35	Glutamate racemase
3uhf.2.A	16.00	monomer	HHblits	X-ray	1.83Å	0.28	0.35	Glutamate racemase
3uhp.1.A	16.00	monomer	HHblits	X-ray	2.79Å	0.28	0.35	Glutamate racemase
3gfg.1.A	7.77	homo-dimer	HHblits	X-ray	2.59Å	0.25	0.36	Uncharacterized oxidoreductase yvaA
2oho.1.A	9.90	homo-dimer	HHblits	X-ray	2.25Å	0.27	0.35	Glutamate Racemase
2oho.1.B	9.90	homo-dimer	HHblits	X-ray	2.25Å	0.27	0.35	Glutamate Racemase
5ijw.1.A	8.82	homo-dimer	HHblits	X-ray	1.76Å	0.26	0.35	Glutamate racemase
5ijw.1.B	8.82	homo-dimer	HHblits	X-ray	1.76Å	0.26	0.35	Glutamate racemase
2ohv.1.A	10.00	homo-dimer	HHblits	X-ray	2.50Å	0.27	0.35	Glutamate Racemase
2ohg.1.A	10.00	homo-dimer	HHblits	X-ray	2.50Å	0.27	0.35	Glutamate racemase
5w1q.1.A	14.00	homo-dimer	HHblits	X-ray	1.95Å	0.27	0.35	Glutamate racemase
1b73.1.A	11.22	homo-dimer	HHblits	X-ray	2.30Å	0.28	0.34	GLUTAMATE RACEMASE
3out.1.A	10.10	homo-hexamer	HHblits	X-ray	1.65Å	0.27	0.34	Glutamate racemase
5lfd.1.A	12.24	homo-hexamer	HHblits	X-ray	2.15Å	0.27	0.34	Allantoin racemase
2vlb.1.A	11.22	monomer	HHblits	X-ray	1.92Å	0.26	0.34	ARYLMALONATE DECARBOXYLASE
2vlb.2.A	11.22	monomer	HHblits	X-ray	1.92Å	0.26	0.34	ARYLMALONATE DECARBOXYLASE
2vlb.3.A	11.22	monomer	HHblits	X-ray	1.92Å	0.26	0.34	ARYLMALONATE DECARBOXYLASE
2vlb.4.A	11.22	monomer	HHblits	X-ray	1.92Å	0.26	0.34	ARYLMALONATE DECARBOXYLASE
2dgd.1.A	16.67	homo-octamer	HHblits	X-ray	2.90Å	0.28	0.33	223aa long hypothetical arylmalonate decarboxylase
2jfn.1.A	12.50	monomer	HHblits	X-ray	1.90Å	0.28	0.33	GLUTAMATE RACEMASE
2xec.1.A	8.33	homo-dimer	HHblits	X-ray	2.20Å	0.26	0.33	PUTATIVE MALEATE ISOMERASE
3dg9.1.A	9.38	monomer	HHblits	X-ray	1.50Å	0.25	0.33	Arylmalonate decarboxylase
3dtv.3.A	8.33	monomer	HHblits	X-ray	2.10Å	0.25	0.33	Arylmalonate decarboxylase
3dtv.2.A	8.33	monomer	HHblits	X-ray	2.10Å	0.25	0.33	Arylmalonate decarboxylase
3dtv.1.A	8.33	monomer	HHblits	X-ray	2.10Å	0.25	0.33	Arylmalonate decarboxylase
3dtv.4.A	8.33	monomer	HHblits	X-ray	2.10Å	0.25	0.33	Arylmalonate decarboxylase
3eis.1.A	8.33	monomer	HHblits	X-ray	2.10Å	0.25	0.33	Arylmalonate decarboxylase
3eis.2.A	8.33	monomer	HHblits	X-ray	2.10Å	0.25	0.33	Arylmalonate decarboxylase
3ixm.1.A	8.33	monomer	HHblits	X-ray	1.90Å	0.25	0.33	Arylmalonate decarboxylase
2bdq.1.A	18.48	homo-dimer	HHblits	X-ray	2.30Å	0.28	0.32	copper homeostasis protein CutC
2jkv.1.A	10.75	homo-dimer	HHblits	X-ray	2.53Å	0.27	0.32	6-PHOSPHOGLUCONATE DEHYDROGENASE, DECARBOXYLATING
5ocw.1.B	16.30	hetero-oligomer	HHblits	X-ray	4.00Å	0.27	0.32	Tryptophan synthase beta chain
2qk4.1.A	13.98	monomer	HHblits	X-ray	2.45Å	0.26	0.32	Trifunctional purine biosynthetic protein adenosine-3
1xtu.1.A	10.99	homo-tetramer	HHblits	X-ray	2.80Å	0.27	0.32	Probable uracil phosphoribosyltransferase
3g6w.1.A	10.99	homo-tetramer	HHblits	X-ray	2.90Å	0.27	0.32	Uracil phosphoribosyltransferase
3g6w.1.B	10.99	homo-tetramer	HHblits	X-ray	2.90Å	0.27	0.32	Uracil phosphoribosyltransferase
1xtv.1.B	10.99	homo-tetramer	HHblits	X-ray	2.60Å	0.27	0.32	Probable uracil phosphoribosyltransferase
1xtv.1.C	10.99	homo-tetramer	HHblits	X-ray	2.60Å	0.27	0.32	Probable uracil phosphoribosyltransferase
1xtt.1.A	10.99	homo-tetramer	HHblits	X-ray	1.80Å	0.27	0.32	Probable uracil phosphoribosyltransferase
1xtt.1.B	10.99	homo-tetramer	HHblits	X-ray	1.80Å	0.27	0.32	Probable uracil phosphoribosyltransferase
1vst.1.A	10.99	homo-tetramer	HHblits	X-ray	2.80Å	0.27	0.32	Uracil phosphoribosyltransferase
3d4o.1.A	14.29	homo-dimer	HHblits	X-ray	2.10Å	0.27	0.32	Dipicolinate synthase subunit A
3d4o.1.B	14.29	homo-dimer	HHblits	X-ray	2.10Å	0.27	0.32	Dipicolinate synthase subunit A
2gpw.1.A	13.04	monomer	HHblits	X-ray	2.20Å	0.26	0.32	Biotin carboxylase
2gpw.4.A	13.04	monomer	HHblits	X-ray	2.20Å	0.26	0.32	Biotin carboxylase
1gso.1.A	12.09	monomer	HHblits	X-ray	1.60Å	0.26	0.32	PROTEIN (GLYCINAMIDE RIBONUCLEOTIDE SYNTHETASE)
2gps.1.A	13.04	monomer	HHblits	X-ray	2.80Å	0.25	0.32	Biotin carboxylase
3wgi.1.B	15.73	homo-dimer	HHblits	X-ray	3.25Å	0.28	0.31	Redox-sensing transcriptional repressor rex
3wg9.2.A	15.73	homo-dimer	HHblits	X-ray	1.97Å	0.28	0.31	Redox-sensing transcriptional repressor rex
3wg9.2.B	15.73	homo-dimer	HHblits	X-ray	1.97Å	0.28	0.31	Redox-sensing transcriptional repressor rex
3wgh.1.B	15.73	homo-dimer	HHblits	X-ray	2.05Å	0.28	0.31	Redox-sensing transcriptional repressor rex
3wgg.1.A	15.73	homo-dimer	HHblits	X-ray	2.10Å	0.28	0.31	Redox-sensing transcriptional repressor rex
3wgg.1.B	15.73	homo-dimer	HHblits	X-ray	2.10Å	0.28	0.31	Redox-sensing transcriptional repressor rex
3rc9.1.A	9.89	monomer	HHblits	X-ray	1.91Å	0.26	0.32	Sugar 3-ketoreductase
1o5o.1.A	18.39	homo-tetramer	HHblits	X-ray	2.30Å	0.29	0.30	Uracil phosphoribosyltransferase
4mv4.2.A	10.99	monomer	HHblits	X-ray	1.61Å	0.26	0.32	Biotin carboxylase
4jn6.1.B	17.05	hetero-oligomer	HHblits	X-ray	1.93Å	0.28	0.31	Acetaldehyde dehydrogenase
1c30.1.A	11.11	hetero-oligomer	HHblits	X-ray	2.00Å	0.26	0.31	CARBAMOYL PHOSPHATE SYNTHETASE: LARGE SUBUNIT
1bxr.1.A	11.11	hetero-oligomer	HHblits	X-ray	2.10Å	0.26	0.31	CARBAMOYL-PHOSPHATE SYNTHASE
2c00.1.A	9.89	monomer	HHblits	X-ray	2.50Å	0.25	0.32	BIOTIN CARBOXYLASE
2c00.2.A	9.89	monomer	HHblits	X-ray	2.50Å	0.25	0.32	BIOTIN CARBOXYLASE
2vqd.1.A	9.89	monomer	HHblits	X-ray	2.41Å	0.25	0.32	BIOTIN CARBOXYLASE
1m6v.1.A	10.00	hetero-oligomer	HHblits	X-ray	2.10Å	0.26	0.31	carbamoyl phosphate synthetase large chain
3mjf.1.A	12.22	monomer	HHblits	X-ray	1.47Å	0.26	0.31	Phosphoribosylamine--glycine ligase
1ulz.1.A	7.78	homo-dimer	HHblits	X-ray	2.20Å	0.25	0.31	pyruvate carboxylase n-terminal domain
3ouu.1.A	10.00	homo-dimer	HHblits	X-ray	2.25Å	0.25	0.31	Biotin carboxylase
3rv4.1.A	12.36	homo-dimer	HHblits	X-ray	1.98Å	0.26	0.31	Biotin carboxylase
2ip4.1.A	11.36	monomer	HHblits	X-ray	2.80Å	0.27	0.31	Phosphoribosylamine--glycine ligase
2ip4.2.A	11.36	monomer	HHblits	X-ray	2.80Å	0.27	0.31	Phosphoribosylamine--glycine ligase
3g8d.1.A	11.24	monomer	HHblits	X-ray	1.90Å	0.26	0.31	Biotin carboxylase
3lp8.1.A	14.77	monomer	HHblits	X-ray	2.15Å	0.26	0.31	Phosphoribosylamine-glycine ligase
1dv2.1.A	11.24	monomer	HHblits	X-ray	2.50Å	0.25	0.31	BIOTIN CARBOXYLASE
2yya.1.A	13.95	monomer	HHblits	X-ray	2.40Å	0.28	0.30	Phosphoribosylamine--glycine ligase
3u9s.1.A	10.11	hetero-oligomer	HHblits	X-ray	3.50Å	0.25	0.31	Methylcrotonyl-CoA carboxylase, alpha-subunit
3u9t.1.A	10.11	hetero-oligomer	HHblits	X-ray	2.90Å	0.25	0.31	Methylcrotonyl-CoA carboxylase, alpha-subunit
2xcl.1.A	14.77	monomer	HHblits	X-ray	2.10Å	0.26	0.31	PHOSPHORIBOSYLAMINE--GLYCINE LIGASE
1iu9.1.A	19.05	monomer	HHblits	X-ray	2.04Å	0.29	0.29	aspartate racemase
2ys6.1.A	12.36	monomer	HHblits	X-ray	2.21Å	0.25	0.31	Phosphoribosylglycinamide synthetase
2vpq.1.A	8.99	homo-dimer	HHblits	X-ray	2.10Å	0.25	0.31	ACETYL-COA CARBOXYLASE
2jfy.1.B	12.64	homo-dimer	HHblits	X-ray	1.90Å	0.26	0.30	GLUTAMATE RACEMASE
2jfz.1.A	12.64	homo-dimer	HHblits	X-ray	1.86Å	0.26	0.30	GLUTAMATE RACEMASE
2jfx.1.A	12.64	homo-dimer	HHblits	X-ray	2.30Å	0.26	0.30	GLUTAMATE RACEMASE
2jfx.1.B	12.64	homo-dimer	HHblits	X-ray	2.30Å	0.26	0.30	GLUTAMATE RACEMASE
2jfy.1.A	12.64	homo-dimer	HHblits	X-ray	1.90Å	0.26	0.30	GLUTAMATE RACEMASE
4b1f.1.B	12.64	homo-dimer	HHblits	X-ray	2.05Å	0.26	0.30	GLUTAMATE RACEMASE
2w4i.1.A	12.64	homo-tetramer	HHblits	X-ray	1.87Å	0.26	0.30	GLUTAMATE RACEMASE
2w6m.1.A	11.36	monomer	HHblits	X-ray	2.00Å	0.25	0.31	BIOTIN CARBOXYLASE
1bnc.1.B	11.36	homo-dimer	HHblits	X-ray	2.40Å	0.25	0.31	BIOTIN CARBOXYLASE
1bnc.1.A	11.36	homo-dimer	HHblits	X-ray	2.40Å	0.25	0.31	BIOTIN CARBOXYLASE
4hr7.1.A	11.36	hetero-oligomer	HHblits	X-ray	2.50Å	0.25	0.31	Biotin carboxylase
4hr7.1.C	11.36	hetero-oligomer	HHblits	X-ray	2.50Å	0.25	0.31	Biotin carboxylase
4hr7.1.E	11.36	hetero-oligomer	HHblits	X-ray	2.50Å	0.25	0.31	Biotin carboxylase
4hr7.1.F	11.36	hetero-oligomer	HHblits	X-ray	2.50Å	0.25	0.31	Biotin carboxylase
2j9g.2.A	11.36	monomer	HHblits	X-ray	2.05Å	0.25	0.31	BIOTIN CARBOXYLASE
2vr1.2.A	11.36	monomer	HHblits	X-ray	2.60Å	0.25	0.31	BIOTIN CARBOXYLASE
2ipn.1.A	18.07	monomer	HHblits	X-ray	1.15Å	0.29	0.29	D-galactose-binding periplasmic protein
2ipm.1.A	18.07	monomer	HHblits	X-ray	1.12Å	0.29	0.29	D-galactose-binding periplasmic protein
3g8c.1.A	11.36	monomer	HHblits	X-ray	2.00Å	0.25	0.31	Biotin carboxylase
3g8c.2.A	11.36	monomer	HHblits	X-ray	2.00Å	0.25	0.31	Biotin carboxylase
2ipl.1.A	18.07	monomer	HHblits	X-ray	1.20Å	0.29	0.29	D-galactose-binding periplasmic protein
2hph.1.A	16.87	monomer	HHblits	X-ray	1.33Å	0.29	0.29	D-galactose-binding periplasmic protein
3rv3.1.A	10.34	homo-dimer	HHblits	X-ray	1.91Å	0.25	0.30	Biotin carboxylase
3d1l.1.A	8.05	homo-dimer	HHblits	X-ray	2.19Å	0.25	0.30	Putative NADP oxidoreductase BF3122
3d1l.1.B	8.05	homo-dimer	HHblits	X-ray	2.19Å	0.25	0.30	Putative NADP oxidoreductase BF3122
1kji.1.A	14.12	homo-dimer	HHblits	X-ray	1.60Å	0.27	0.30	phosphoribosylglycinamide formyltransferase 2
1kji.1.B	14.12	homo-dimer	HHblits	X-ray	1.60Å	0.27	0.30	phosphoribosylglycinamide formyltransferase 2
3gfg.1.A	13.10	homo-dimer	HHblits	X-ray	2.59Å	0.28	0.29	Uncharacterized oxidoreductase yvaA
1ez1.1.A	13.95	homo-dimer	HHblits	X-ray	1.75Å	0.26	0.30	PHOSPHORIBOSYLGLYCINAMIDE FORMYLTRANSFERASE 2
1ez1.1.B	13.95	homo-dimer	HHblits	X-ray	1.75Å	0.26	0.30	PHOSPHORIBOSYLGLYCINAMIDE FORMYLTRANSFERASE 2
2ehj.1.A	17.07	homo-tetramer	HHblits	X-ray	2.80Å	0.29	0.28	Uracil phosphoribosyltransferase
2ehj.1.C	17.07	homo-tetramer	HHblits	X-ray	2.80Å	0.29	0.28	Uracil phosphoribosyltransferase
5e38.1.B	15.85	homo-tetramer	HHblits	X-ray	3.00Å	0.29	0.28	Uracil phosphoribosyltransferase
5e38.1.A	15.85	homo-tetramer	HHblits	X-ray	3.00Å	0.29	0.28	Uracil phosphoribosyltransferase
5e38.1.D	15.85	homo-tetramer	HHblits	X-ray	3.00Å	0.29	0.28	Uracil phosphoribosyltransferase
3i23.1.A	9.41	homo-dimer	HHblits	X-ray	2.30Å	0.26	0.30	Oxidoreductase, Gfo/Idh/MocA family
5vev.1.A	14.12	monomer	HHblits	X-ray	1.90Å	0.26	0.30	Phosphoribosylamine--glycine ligase
5ktk.1.A	15.85	monomer	HHblits	X-ray	1.98Å	0.29	0.28	Polyketide synthase PksJ
2pn1.1.A	11.76	homo-dimer	HHblits	X-ray	2.00Å	0.25	0.30	Carbamoylphosphate synthase large subunit
4n54.1.A	13.41	homo-tetramer	HHblits	X-ray	2.05Å	0.28	0.28	Inositol dehydrogenase
4n54.1.C	13.41	homo-tetramer	HHblits	X-ray	2.05Å	0.28	0.28	Inositol dehydrogenase
4n54.1.D	13.41	homo-tetramer	HHblits	X-ray	2.05Å	0.28	0.28	Inositol dehydrogenase
3q2i.1.A	10.84	homo-octamer	HHblits	X-ray	1.50Å	0.27	0.29	dehydrogenase
3rcb.1.A	9.64	monomer	HHblits	X-ray	2.49Å	0.26	0.29	Sugar 3-ketoreductase
3cea.1.A	9.64	homo-tetramer	HHblits	X-ray	2.40Å	0.26	0.29	Myo-inositol 2-dehydrogenase
4ew6.1.A	13.25	homo-dimer	HHblits	X-ray	2.30Å	0.26	0.29	D-galactose-1-dehydrogenase protein
4pz0.1.A	9.76	monomer	HHblits	X-ray	1.25Å	0.27	0.28	sugar ABC transporter, sugar-binding protein
3q2k.1.A	14.81	homo-octamer	HHblits	X-ray	2.13Å	0.28	0.28	oxidoreductase
3q2k.1.B	14.81	homo-octamer	HHblits	X-ray	2.13Å	0.28	0.28	oxidoreductase
3gbp.1.A	17.50	monomer	HHblits	X-ray	2.40Å	0.29	0.28	GALACTOSE-BINDING PROTEIN
1tm2.1.A	14.63	monomer	HHblits	X-ray	1.90Å	0.27	0.28	sugar transport protein
1tjy.1.A	14.63	monomer	HHblits	X-ray	1.30Å	0.27	0.28	sugar transport protein
5ere.1.A	12.05	monomer	HHblits	X-ray	2.00Å	0.25	0.29	Extracellular ligand-binding receptor
2fqx.1.A	5.95	monomer	HHblits	X-ray	1.70Å	0.24	0.29	Membrane lipoprotein tmpC
3d1l.1.A	22.67	homo-dimer	HHblits	X-ray	2.19Å	0.33	0.26	Putative NADP oxidoreductase BF3122
3d1l.1.B	22.67	homo-dimer	HHblits	X-ray	2.19Å	0.33	0.26	Putative NADP oxidoreductase BF3122
3gbv.1.A	9.76	homo-dimer	HHblits	X-ray	2.20Å	0.26	0.28	Putative LacI-family transcriptional regulator
3gbv.1.B	9.76	homo-dimer	HHblits	X-ray	2.20Å	0.26	0.28	Putative LacI-family transcriptional regulator
3e9m.1.A	8.54	homo-dimer	HHblits	X-ray	2.70Å	0.26	0.28	Oxidoreductase, Gfo/Idh/MocA family
3e9m.1.B	8.54	homo-dimer	HHblits	X-ray	2.70Å	0.26	0.28	Oxidoreductase, Gfo/Idh/MocA family
3e9m.2.A	8.54	homo-dimer	HHblits	X-ray	2.70Å	0.26	0.28	Oxidoreductase, Gfo/Idh/MocA family
3vot.1.A	8.54	monomer	HHblits	X-ray	1.80Å	0.25	0.28	L-amino acid ligase, BL00235
3vot.2.A	8.54	monomer	HHblits	X-ray	1.80Å	0.25	0.28	L-amino acid ligase, BL00235
3e9m.1.A	14.10	homo-dimer	HHblits	X-ray	2.70Å	0.29	0.27	Oxidoreductase, Gfo/Idh/MocA family
3e9m.1.B	14.10	homo-dimer	HHblits	X-ray	2.70Å	0.29	0.27	Oxidoreductase, Gfo/Idh/MocA family
3e9m.2.A	14.10	homo-dimer	HHblits	X-ray	2.70Å	0.29	0.27	Oxidoreductase, Gfo/Idh/MocA family
3t7c.1.A	13.75	homo-tetramer	HHblits	X-ray	1.95Å	0.26	0.28	Carveol dehydrogenase
3q2i.1.A	16.67	homo-octamer	HHblits	X-ray	1.50Å	0.28	0.27	dehydrogenase
3rc1.1.A	10.13	monomer	HHblits	X-ray	1.71Å	0.27	0.27	Sugar 3-ketoreductase
5bra.1.A	8.54	monomer	HHblits	X-ray	2.97Å	0.24	0.28	Putative periplasmic binding protein with substrate ribose
1gub.1.A	11.25	monomer	HHblits	X-ray	3.10Å	0.25	0.28	D-ALLOSE-BINDING PERIPLASMIC PROTEIN
1gud.1.A	11.25	monomer	HHblits	X-ray	1.71Å	0.25	0.28	D-ALLOSE-BINDING PERIPLASMIC PROTEIN
1gud.2.A	11.25	monomer	HHblits	X-ray	1.71Å	0.25	0.28	D-ALLOSE-BINDING PERIPLASMIC PROTEIN
1rpj.1.A	11.25	monomer	HHblits	X-ray	1.80Å	0.25	0.28	PROTEIN (PRECURSOR OF PERIPLASMIC SUGAR RECEPTOR)
3lft.1.A	16.88	monomer	HHblits	X-ray	1.35Å	0.28	0.27	uncharacterized protein
3bbl.1.A	10.00	homo-dimer	HHblits	X-ray	2.35Å	0.25	0.28	Regulatory protein of LacI family
3rc7.1.A	15.79	monomer	HHblits	X-ray	2.00Å	0.29	0.26	Sugar 3-ketoreductase
3g85.1.A	19.74	monomer	HHblits	X-ray	1.84Å	0.28	0.26	Transcriptional regulator (LacI family)
3og3.1.A	15.58	monomer	HHblits	X-ray	2.08Å	0.27	0.27	Imidazole glycerol phosphate synthase subunit hisF
5ky3.1.A	10.81	hetero-oligomer	HHblits	X-ray	1.53Å	0.29	0.26	GDP-fucose protein O-fucosyltransferase 1
5ky7.1.A	10.81	hetero-oligomer	HHblits	X-ray	1.60Å	0.29	0.26	GDP-fucose protein O-fucosyltransferase 1
2oek.1.A	18.92	homo-dimer	HHblits	X-ray	1.80Å	0.29	0.26	2,3-diketo-5-methylthiopentyl-1-phosphate enolase
4gmg.1.A	9.21	homo-dimer	HHblits	X-ray	2.31Å	0.26	0.26	Yersiniabactin biosynthetic protein YbtU
5kvq.1.B	9.21	homo-dimer	HHblits	X-ray	1.45Å	0.26	0.26	Irp3 protein
1efa.1.C	15.58	homo-dimer	HHblits	X-ray	2.60Å	0.25	0.27	LAC REPRESSOR
1jwl.1.D	15.58	homo-dimer	HHblits	X-ray	4.00Å	0.25	0.27	Lactose Operon Repressor
1ez1.1.A	7.79	homo-dimer	HHblits	X-ray	1.75Å	0.24	0.27	PHOSPHORIBOSYLGLYCINAMIDE FORMYLTRANSFERASE 2
1ez1.1.B	7.79	homo-dimer	HHblits	X-ray	1.75Å	0.24	0.27	PHOSPHORIBOSYLGLYCINAMIDE FORMYLTRANSFERASE 2
2rdm.1.A	12.99	homo-hexamer	HHblits	X-ray	1.76Å	0.24	0.27	Response regulator receiver protein
2rdm.1.B	12.99	homo-hexamer	HHblits	X-ray	1.76Å	0.24	0.27	Response regulator receiver protein
2rdm.1.C	12.99	homo-hexamer	HHblits	X-ray	1.76Å	0.24	0.27	Response regulator receiver protein
4nas.1.A	16.44	homo-dimer	HHblits	X-ray	1.92Å	0.28	0.25	Ribulose-bisphosphate carboxylase
2nvw.1.A	15.28	homo-dimer	HHblits	X-ray	2.10Å	0.29	0.25	Galactose/lactose metabolism regulatory protein GAL80
2nvw.1.B	15.28	homo-dimer	HHblits	X-ray	2.10Å	0.29	0.25	Galactose/lactose metabolism regulatory protein GAL80
3cwo.1.A	6.58	homo-dimer	HHblits	X-ray	3.10Å	0.25	0.26	beta/alpha-barrel protein based on 1THF and 1TMY
2lle.1.A	6.58	monomer	HHblits	NMR	NA	0.25	0.26	Chemotaxis protein CheY, Imidazole glycerol phosphate synthase subunit HisF chimera
4gmf.1.A	9.33	homo-dimer	HHblits	X-ray	1.85Å	0.26	0.26	Yersiniabactin biosynthetic protein YbtU
3hzr.1.A	12.16	homo-dimer	HHblits	X-ray	3.00Å	0.26	0.26	Tryptophanyl-tRNA synthetase
2zvi.1.A	16.67	homo-dimer	HHblits	X-ray	2.30Å	0.29	0.25	2,3-diketo-5-methylthiopentyl-1-phosphate enolase
2zvi.1.B	16.67	homo-dimer	HHblits	X-ray	2.30Å	0.29	0.25	2,3-diketo-5-methylthiopentyl-1-phosphate enolase
2zvi.2.A	16.67	homo-dimer	HHblits	X-ray	2.30Å	0.29	0.25	2,3-diketo-5-methylthiopentyl-1-phosphate enolase
4gmf.1.A	12.33	homo-dimer	HHblits	X-ray	1.85Å	0.26	0.25	Yersiniabactin biosynthetic protein YbtU
3e1k.1.A	15.49	hetero-oligomer	HHblits	X-ray	3.00Å	0.29	0.25	Galactose/lactose metabolism regulatory protein GAL80
3gka.1.A	7.89	monomer	HHblits	X-ray	2.30Å	0.23	0.26	N-ethylmaleimide reductase
4egj.1.A	16.67	monomer	HHblits	X-ray	2.30Å	0.27	0.25	D-alanine--D-alanine ligase
1usl.1.A	8.22	homo-dimer	HHblits	X-ray	1.88Å	0.26	0.25	RIBOSE 5-PHOSPHATE ISOMERASE B
3nkl.1.A	14.29	homo-dimer	HHblits	X-ray	1.90Å	0.28	0.24	UDP-D-quinovosamine 4-dehydrogenase
3nkl.1.B	14.29	homo-dimer	HHblits	X-ray	1.90Å	0.28	0.24	UDP-D-quinovosamine 4-dehydrogenase
2hjp.1.A	12.68	homo-tetramer	HHblits	X-ray	1.90Å	0.27	0.25	Phosphonopyruvate hydrolase
4mkx.1.A	15.94	homo-tetramer	HHblits	X-ray	1.60Å	0.29	0.24	Inositol dehydrogenase
4gmg.1.A	17.14	homo-dimer	HHblits	X-ray	2.31Å	0.27	0.24	Yersiniabactin biosynthetic protein YbtU
5kvq.1.B	17.14	homo-dimer	HHblits	X-ray	1.45Å	0.27	0.24	Irp3 protein
1o5t.1.A	6.94	homo-dimer	HHblits	X-ray	2.50Å	0.25	0.25	Tryptophanyl-tRNA synthetase
1ulh.1.A	6.94	homo-dimer	HHblits	X-ray	2.31Å	0.25	0.25	Tryptophanyl-tRNA synthetase
1ulh.1.B	6.94	homo-dimer	HHblits	X-ray	2.31Å	0.25	0.25	Tryptophanyl-tRNA synthetase
2qui.1.B	6.94	homo-dimer	HHblits	X-ray	2.40Å	0.25	0.25	Tryptophanyl-tRNA synthetase
2quk.1.A	6.94	homo-dimer	HHblits	X-ray	2.80Å	0.25	0.25	Tryptophanyl-tRNA synthetase
2qui.1.A	6.94	homo-dimer	HHblits	X-ray	2.40Å	0.25	0.25	Tryptophanyl-tRNA synthetase
1dhr.1.A	14.29	homo-dimer	HHblits	X-ray	2.30Å	0.27	0.24	DIHYDROPTERIDINE REDUCTASE
1m1b.1.A	9.86	homo-tetramer	HHblits	X-ray	2.25Å	0.26	0.25	PHOSPHOENOLPYRUVATE PHOSPHOMUTASE
1s2v.1.A	9.86	homo-tetramer	HHblits	X-ray	2.10Å	0.26	0.25	Phosphoenolpyruvate phosphomutase
1s2w.1.A	9.86	monomer	HHblits	X-ray	1.69Å	0.26	0.25	Phosphoenolpyruvate phosphomutase
3ec7.1.A	14.93	homo-tetramer	HHblits	X-ray	2.15Å	0.30	0.23	Putative Dehydrogenase
1r6u.1.A	6.94	homo-dimer	HHblits	X-ray	2.00Å	0.24	0.25	Tryptophanyl-tRNA synthetase
1r6u.1.B	6.94	homo-dimer	HHblits	X-ray	2.00Å	0.24	0.25	Tryptophanyl-tRNA synthetase
5unc.1.A	10.00	homo-tetramer	HHblits	X-ray	1.71Å	0.26	0.24	PHOSPHOENOLPYRUVATE PHOSPHOMUTASE
3q2k.1.A	17.91	homo-octamer	HHblits	X-ray	2.13Å	0.30	0.23	oxidoreductase
3q2k.1.B	17.91	homo-octamer	HHblits	X-ray	2.13Å	0.30	0.23	oxidoreductase
4iyj.1.A	14.93	homo-dimer	HHblits	X-ray	1.37Å	0.29	0.23	GDSL-like protein
4ppy.1.A	15.15	homo-dimer	HHblits	X-ray	2.00Å	0.29	0.23	Putative acylhydrolase
4hf7.1.A	12.12	homo-dimer	HHblits	X-ray	1.77Å	0.28	0.23	Putative acylhydrolase
3rc7.1.A	12.31	monomer	HHblits	X-ray	2.00Å	0.28	0.23	Sugar 3-ketoreductase
3lft.1.A	12.50	monomer	HHblits	X-ray	1.35Å	0.27	0.22	uncharacterized protein
3i05.1.A	9.52	homo-dimer	HHblits	X-ray	2.80Å	0.27	0.22	Tryptophanyl-tRNA synthetase
4mg4.1.A	19.67	homo-dimer	HHblits	X-ray	1.70Å	0.30	0.21	Phosphonomutase
4mg4.2.B	19.67	homo-dimer	HHblits	X-ray	1.70Å	0.30	0.21	Phosphonomutase
4wza.1.A	16.39	hetero-oligomer	HHblits	X-ray	1.90Å	0.29	0.21	Nitrogenase molybdenum-iron protein alpha chain
5cx1.1.A	16.39	hetero-oligomer	HHblits	X-ray	1.75Å	0.28	0.21	Nitrogenase molybdenum-iron protein alpha chain
2ake.1.B	7.94	homo-dimer	HHblits	X-ray	3.10Å	0.25	0.22	Tryptophanyl-tRNA synthetase
1r6t.1.A	7.94	homo-dimer	HHblits	X-ray	2.10Å	0.25	0.22	Tryptophanyl-tRNA synthetase
1r6t.1.B	7.94	homo-dimer	HHblits	X-ray	2.10Å	0.25	0.22	Tryptophanyl-tRNA synthetase
2azx.1.B	7.94	homo-dimer	HHblits	X-ray	2.80Å	0.25	0.22	Tryptophanyl-tRNA synthetase
4lda.1.A	7.94	monomer	HHblits	X-ray	2.40Å	0.24	0.22	TadZ
4lda.3.A	7.94	monomer	HHblits	X-ray	2.40Å	0.24	0.22	TadZ
4lda.4.A	7.94	monomer	HHblits	X-ray	2.40Å	0.24	0.22	TadZ
4lda.5.A	7.94	monomer	HHblits	X-ray	2.40Å	0.24	0.22	TadZ
3ixl.1.A	8.47	monomer	HHblits	X-ray	1.45Å	0.25	0.20	Arylmalonate decarboxylase
2ofw.1.B	20.00	homo-dimer	HHblits	X-ray	2.05Å	0.30	0.19	APS kinase domain of the PAPS synthetase 1
2ofw.1.A	20.00	homo-dimer	HHblits	X-ray	2.05Å	0.30	0.19	APS kinase domain of the PAPS synthetase 1
1x7i.1.A	20.37	homo-dimer	HHblits	X-ray	1.70Å	0.29	0.19	Copper homeostasis protein cutC
1x7i.1.B	20.37	homo-dimer	HHblits	X-ray	1.70Å	0.29	0.19	Copper homeostasis protein cutC
1twd.1.A	20.37	homo-dimer	HHblits	X-ray	1.70Å	0.29	0.19	Copper homeostasis protein cutC
1twd.1.B	20.37	homo-dimer	HHblits	X-ray	1.70Å	0.29	0.19	Copper homeostasis protein cutC
4mwa.1.A	12.96	homo-tetramer	HHblits	X-ray	1.85Å	0.28	0.19	4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
4mwa.1.B	12.96	homo-tetramer	HHblits	X-ray	1.85Å	0.28	0.19	4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
4mwa.1.C	12.96	homo-tetramer	HHblits	X-ray	1.85Å	0.28	0.19	4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
4mwa.1.D	12.96	homo-tetramer	HHblits	X-ray	1.85Å	0.28	0.19	4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
4mwa.2.B	12.96	homo-tetramer	HHblits	X-ray	1.85Å	0.28	0.19	4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
4mwa.2.D	12.96	homo-tetramer	HHblits	X-ray	1.85Å	0.28	0.19	4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase
1yht.1.A	15.09	monomer	HHblits	X-ray	2.00Å	0.29	0.18	DspB
2xed.1.A	11.54	monomer	HHblits	X-ray	1.95Å	0.28	0.18	PUTATIVE MALEATE ISOMERASE
4fq5.1.A	7.55	homo-tetramer	HHblits	X-ray	2.10Å	0.26	0.18	Maleate cis-trans isomerase
4fq5.1.B	7.55	homo-tetramer	HHblits	X-ray	2.10Å	0.26	0.18	Maleate cis-trans isomerase
4fq7.1.A	7.69	homo-tetramer	HHblits	X-ray	3.00Å	0.26	0.18	Maleate cis-trans isomerase
1wau.1.A	18.00	homo-trimer	HHblits	X-ray	2.80Å	0.28	0.17	KHG/KDPG ALDOLASE
1fwr.1.A	18.00	homo-trimer	HHblits	X-ray	2.70Å	0.28	0.17	KDPG ALDOLASE
3fph.1.A	12.24	homo-dimer	HHblits	X-ray	1.80Å	0.29	0.17	Putative uncharacterized protein
3fph.1.B	12.24	homo-dimer	HHblits	X-ray	1.80Å	0.29	0.17	Putative uncharacterized protein
3fpj.1.B	12.24	homo-dimer	HHblits	X-ray	1.80Å	0.29	0.17	Putative uncharacterized protein
3fpg.1.A	12.24	homo-dimer	HHblits	X-ray	2.00Å	0.29	0.17	Putative uncharacterized protein
5ccb.1.B	19.15	hetero-oligomer	HHblits	X-ray	2.00Å	0.28	0.16	tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit TRM6
5cd1.1.B	19.15	hetero-oligomer	HHblits	X-ray	3.60Å	0.28	0.16	tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit TRM6
4ix1.1.A	4.08	homo-dimer	HHblits	X-ray	2.80Å	0.24	0.17	hypothetical protein
4ix1.1.B	4.08	homo-dimer	HHblits	X-ray	2.80Å	0.24	0.17	hypothetical protein
5vev.1.A	8.70	monomer	HHblits	X-ray	1.90Å	0.28	0.16	Phosphoribosylamine--glycine ligase
2xcl.1.A	10.42	monomer	HHblits	X-ray	2.10Å	0.24	0.17	PHOSPHORIBOSYLAMINE--GLYCINE LIGASE
5eqj.1.A	14.58	hetero-oligomer	HHblits	X-ray	2.20Å	0.24	0.17	tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit TRM6
1qh1.1.B	15.91	hetero-oligomer	HHblits	X-ray	1.60Å	0.30	0.15	PROTEIN (NITROGENASE MOLYBDENUM IRON PROTEIN)
1kfe.1.B	6.52	hetero-oligomer	HHblits	X-ray	1.75Å	0.25	0.16	TRYPTOPHAN SYNTHASE BETA CHAIN
4h4x.1.A	26.83	homo-dimer	HHblits	X-ray	1.50Å	0.34	0.14	Biphenyl dioxygenase ferredoxin reductase subunit
2gr3.1.A	26.83	homo-dimer	HHblits	X-ray	1.50Å	0.34	0.14	ferredoxin reductase
3pr2.1.B	6.52	hetero-oligomer	HHblits	X-ray	1.85Å	0.25	0.16	Tryptophan synthase beta chain
4h4v.1.A	27.50	homo-dimer	HHblits	X-ray	1.40Å	0.34	0.14	Biphenyl dioxygenase ferredoxin reductase subunit
2yvg.1.A	27.50	homo-dimer	HHblits	X-ray	1.60Å	0.34	0.14	Ferredoxin reductase
2yvj.1.A	27.50	hetero-oligomer	HHblits	X-ray	1.90Å	0.34	0.14	Ferredoxin reductase
2yvj.1.C	27.50	hetero-oligomer	HHblits	X-ray	1.90Å	0.34	0.14	Ferredoxin reductase
1d7y.1.A	27.50	homo-dimer	HHblits	X-ray	2.10Å	0.34	0.14	FERREDOXIN REDUCTASE
4h4t.1.A	27.50	homo-dimer	HHblits	X-ray	1.50Å	0.34	0.14	Biphenyl dioxygenase ferredoxin reductase subunit
4h4r.1.A	27.50	homo-dimer	HHblits	X-ray	1.40Å	0.34	0.14	Biphenyl dioxygenase ferredoxin reductase subunit
4h4z.1.A	27.50	homo-dimer	HHblits	X-ray	1.95Å	0.34	0.14	Biphenyl dioxygenase ferredoxin reductase subunit
4h4p.1.A	27.50	homo-dimer	HHblits	X-ray	1.50Å	0.34	0.14	Biphenyl dioxygenase ferredoxin reductase subunit
2tsy.1.B	6.67	hetero-oligomer	HHblits	X-ray	2.50Å	0.25	0.16	TRYPTOPHAN SYNTHASE
1ubs.1.B	6.67	hetero-oligomer	HHblits	X-ray	1.90Å	0.25	0.16	TRYPTOPHAN SYNTHASE
2o2j.1.A	15.56	homo-dimer	HHblits	X-ray	2.56Å	0.25	0.16	Tryptophan synthase beta chain
2o2j.1.B	15.56	homo-dimer	HHblits	X-ray	2.56Å	0.25	0.16	Tryptophan synthase beta chain
2o2e.1.B	15.56	homo-dimer	HHblits	X-ray	2.20Å	0.25	0.16	Tryptophan synthase beta chain
5tcf.1.B	15.56	hetero-oligomer	HHblits	X-ray	2.46Å	0.25	0.16	Tryptophan synthase beta chain
5tcg.1.B	15.56	hetero-oligomer	HHblits	X-ray	2.40Å	0.25	0.16	Tryptophan synthase beta chain
4bur.1.A	19.51	monomer	HHblits	X-ray	2.88Å	0.32	0.14	APOPTOSIS INDUCING FACTOR 1, MITOCHONDRIAL
4bur.3.A	19.51	monomer	HHblits	X-ray	2.88Å	0.32	0.14	APOPTOSIS INDUCING FACTOR 1, MITOCHONDRIAL
1m6i.1.A	19.51	monomer	HHblits	X-ray	1.80Å	0.32	0.14	Programmed cell death protein 8
2j9z.1.B	6.67	hetero-oligomer	HHblits	X-ray	1.80Å	0.25	0.16	TRYPTOPHAN SYNTHASE BETA CHAIN
5fmh.1.A	19.51	monomer	HHblits	X-ray	1.80Å	0.32	0.14	APOPTOSIS-INDUCING FACTOR 1, MITOCHONDRIAL
5fs9.1.A	19.51	monomer	HHblits	X-ray	1.75Å	0.32	0.14	APOPTOSIS-INDUCING FACTOR 1, MITOCHONDRIAL
5fs8.1.A	19.51	monomer	HHblits	X-ray	1.40Å	0.32	0.14	APOPTOSIS-INDUCING FACTOR 1, MITOCHONDRIAL
4fdc.1.A	19.51	monomer	HHblits	X-ray	2.40Å	0.32	0.14	Apoptosis-inducing factor 1, mitochondrial
5jcm.1.A	21.43	monomer	HHblits	X-ray	1.90Å	0.30	0.15	Os09g0567300 protein
5jcl.1.A	21.43	monomer	HHblits	X-ray	1.80Å	0.30	0.15	Os09g0567300 protein
4fx9.1.A	22.50	homo-dimer	HHblits	X-ray	2.70Å	0.33	0.14	Coenzyme A disulfide reductase
3ef6.1.A	25.00	monomer	HHblits	X-ray	1.80Å	0.33	0.14	Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase
4emi.1.A	25.00	monomer	HHblits	X-ray	1.81Å	0.33	0.14	TodA
4emj.1.A	25.00	hetero-oligomer	HHblits	X-ray	2.40Å	0.33	0.14	TodA
3lxd.1.A	21.95	monomer	HHblits	X-ray	2.50Å	0.31	0.14	FAD-dependent pyridine nucleotide-disulphide oxidoreductase
3ics.1.A	22.50	homo-dimer	HHblits	X-ray	1.94Å	0.33	0.14	Coenzyme A-Disulfide Reductase
4qwv.1.A	9.30	monomer	HHblits	X-ray	2.45Å	0.27	0.15	High-affinity leucine-specific transport system periplasmic binding protein, Chemotaxis protein CheY
4lii.1.A	20.00	monomer	HHblits	X-ray	1.88Å	0.32	0.14	Apoptosis-inducing factor 1, mitochondrial
3gd4.1.A	20.00	homo-dimer	HHblits	X-ray	2.24Å	0.32	0.14	Apoptosis-inducing factor 1, mitochondrial
3gd4.1.B	20.00	homo-dimer	HHblits	X-ray	2.24Å	0.32	0.14	Apoptosis-inducing factor 1, mitochondrial
1gv4.1.A	20.00	monomer	HHblits	X-ray	2.00Å	0.32	0.14	PROGRAMED CELL DEATH PROTEIN 8
5fs6.1.A	20.00	monomer	HHblits	X-ray	1.90Å	0.32	0.14	APOPTOSIS-INDUCING FACTOR 1, MITOCHONDRIAL
5kvi.1.A	20.00	monomer	HHblits	X-ray	2.00Å	0.32	0.14	Apoptosis-inducing factor 1, mitochondrial
3gd3.1.A	20.00	monomer	HHblits	X-ray	2.95Å	0.32	0.14	Apoptosis-inducing factor 1, mitochondrial
3gd3.2.A	20.00	monomer	HHblits	X-ray	2.95Å	0.32	0.14	Apoptosis-inducing factor 1, mitochondrial
3gd3.4.A	20.00	monomer	HHblits	X-ray	2.95Å	0.32	0.14	Apoptosis-inducing factor 1, mitochondrial
5fs7.1.A	20.00	monomer	HHblits	X-ray	1.85Å	0.32	0.14	APOPTOSIS-INDUCING FACTOR 1, MITOCHONDRIAL
5miu.1.A	20.00	monomer	HHblits	X-ray	3.50Å	0.32	0.14	Apoptosis-inducing factor 1, mitochondrial
5miv.1.A	20.00	homo-dimer	HHblits	X-ray	3.10Å	0.32	0.14	Apoptosis-inducing factor 1, mitochondrial
5miv.1.B	20.00	homo-dimer	HHblits	X-ray	3.10Å	0.32	0.14	Apoptosis-inducing factor 1, mitochondrial
5kvh.1.A	20.00	homo-dimer	HHblits	X-ray	2.27Å	0.32	0.14	Apoptosis-inducing factor 1, mitochondrial
3hyv.1.A	21.05	homo-trimer	HHblits	X-ray	2.30Å	0.36	0.13	Sulfide-quinone reductase
5jci.1.A	21.95	monomer	HHblits	X-ray	1.70Å	0.30	0.14	Os09g0567300 protein
3cge.1.A	21.95	homo-dimer	HHblits	X-ray	2.26Å	0.30	0.14	Pyridine nucleotide-disulfide oxidoreductase, class I
3kd9.1.A	23.08	homo-dimer	HHblits	X-ray	2.75Å	0.34	0.14	Coenzyme A disulfide reductase
5l1n.1.A	23.08	homo-dimer	HHblits	X-ray	3.60Å	0.34	0.14	Coenzyme A disulfide reductase
2pk8.1.A	20.00	homo-dimer	HHblits	X-ray	1.85Å	0.31	0.14	Uncharacterized protein PF0899
2y85.1.A	19.51	monomer	HHblits	X-ray	2.40Å	0.29	0.14	PHOSPHORIBOSYL ISOMERASE A
3zs4.1.A	19.51	monomer	HHblits	X-ray	1.90Å	0.29	0.14	PHOSPHORIBOSYL ISOMERASE A
2c7g.1.A	22.50	homo-dimer	HHblits	X-ray	1.80Å	0.31	0.14	NADPH-FERREDOXIN REDUCTASE FPRA
1lqu.1.A	22.50	monomer	HHblits	X-ray	1.25Å	0.31	0.14	FprA
2v3a.1.A	22.50	monomer	HHblits	X-ray	2.40Å	0.31	0.14	RUBREDOXIN REDUCTASE
2v3b.1.A	22.50	hetero-oligomer	HHblits	X-ray	2.45Å	0.31	0.14	RUBREDOXIN REDUCTASE
4ycs.1.A	9.52	monomer	HHblits	X-ray	1.98Å	0.27	0.15	Uncharacterized protein
4ycs.2.A	9.52	monomer	HHblits	X-ray	1.98Å	0.27	0.15	Uncharacterized protein
3cgb.1.A	22.50	homo-dimer	HHblits	X-ray	1.90Å	0.30	0.14	Pyridine nucleotide-disulfide oxidoreductase, class I
1e1m.1.A	23.08	monomer	HHblits	X-ray	1.85Å	0.32	0.14	ADRENODOXIN REDUCTASE
1e1l.1.A	23.08	monomer	HHblits	X-ray	2.30Å	0.32	0.14	ADRENODOXIN REDUCTASE
1e6e.2.A	23.08	hetero-oligomer	HHblits	X-ray	2.30Å	0.32	0.14	NADPH\:ADRENODOXIN OXIDOREDUCTASE
1e6e.1.A	23.08	hetero-oligomer	HHblits	X-ray	2.30Å	0.32	0.14	NADPH\:ADRENODOXIN OXIDOREDUCTASE
3lb8.1.A	20.00	hetero-oligomer	HHblits	X-ray	2.60Å	0.30	0.14	Putidaredoxin reductase
3lb8.2.A	20.00	hetero-oligomer	HHblits	X-ray	2.60Å	0.30	0.14	Putidaredoxin reductase
1q1r.1.A	20.00	monomer	HHblits	X-ray	1.91Å	0.30	0.14	Putidaredoxin reductase
1q1w.2.A	20.00	monomer	HHblits	X-ray	2.60Å	0.30	0.14	Putidaredoxin reductase
3rv3.1.A	14.63	homo-dimer	HHblits	X-ray	1.91Å	0.27	0.14	Biotin carboxylase
1bap.1.A	17.95	monomer	HHblits	X-ray	1.75Å	0.31	0.14	L-ARABINOSE-BINDING PROTEIN
5ere.1.A	19.51	monomer	HHblits	X-ray	2.00Å	0.27	0.14	Extracellular ligand-binding receptor
2gps.1.A	12.20	monomer	HHblits	X-ray	2.80Å	0.27	0.14	Biotin carboxylase
4fx7.1.A	12.20	monomer	HHblits	X-ray	2.08Å	0.26	0.14	Imidazole glycerol phosphate synthase subunit HisF
1glg.1.A	21.05	monomer	HHblits	X-ray	2.00Å	0.31	0.13	GALACTOSE/GLUCOSE-BINDING PROTEIN
2qw1.1.A	21.05	monomer	HHblits	X-ray	1.70Å	0.31	0.13	D-galactose-binding periplasmic protein
2fvy.1.A	21.05	monomer	HHblits	X-ray	0.92Å	0.31	0.13	D-galactose-binding periplasmic protein
2bc1.1.A	10.00	homo-dimer	HHblits	X-ray	2.15Å	0.27	0.14	NADH Oxidase
1f0k.1.A	9.52	homo-dimer	HHblits	X-ray	1.90Å	0.23	0.15	UDP-N-ACETYLGLUCOSAMINE-N-ACETYLMURAMYL-(PENTAPEPTIDE) PYROPHOSPHORYL-UNDECAPRENOL N-ACETYLGLUCOSAMINE TRANSFERASE
1f0k.1.B	9.52	homo-dimer	HHblits	X-ray	1.90Å	0.23	0.15	UDP-N-ACETYLGLUCOSAMINE-N-ACETYLMURAMYL-(PENTAPEPTIDE) PYROPHOSPHORYL-UNDECAPRENOL N-ACETYLGLUCOSAMINE TRANSFERASE
1nlm.1.A	9.52	homo-dimer	HHblits	X-ray	2.50Å	0.23	0.15	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase
1nlm.1.B	9.52	homo-dimer	HHblits	X-ray	2.50Å	0.23	0.15	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase
3i45.1.A	15.00	monomer	HHblits	X-ray	1.36Å	0.27	0.14	Twin-arginine translocation pathway signal protein
4kv7.1.A	15.00	monomer	HHblits	X-ray	1.20Å	0.26	0.14	Probable leucine/isoleucine/valine-binding protein
4n0q.1.A	23.08	monomer	HHblits	X-ray	2.30Å	0.28	0.14	Leu/Ile/Val-binding protein homolog 3
4lck.1.A	20.51	monomer	HHblits	X-ray	3.20Å	0.28	0.14	Ribosomal protein YbxF
4lck.2.A	20.51	monomer	HHblits	X-ray	3.20Å	0.28	0.14	Ribosomal protein YbxF
3v7e.1.A	20.51	monomer	HHblits	X-ray	2.80Å	0.28	0.14	Ribosome-associated protein L7Ae-like
4tzz.2.A	20.51	monomer	HHblits	X-ray	3.64Å	0.28	0.14	Ribosome-associated protein L7Ae-like
4tzp.2.A	20.51	monomer	HHblits	X-ray	8.50Å	0.28	0.14	Ribosome-associated protein L7Ae-like
4tzw.1.A	20.51	monomer	HHblits	X-ray	4.67Å	0.28	0.14	Ribosome-associated protein L7Ae-like
5odc.1.D	22.22	hetero-oligomer	HHblits	X-ray	2.30Å	0.34	0.13	Methyl-viologen reducing hydrogenase subunit D
4m88.1.A	17.95	monomer	HHblits	X-ray	1.76Å	0.27	0.14	Extracellular ligand-binding receptor
1usi.1.A	10.26	monomer	HHblits	X-ray	1.80Å	0.27	0.14	LEUCINE-SPECIFIC BINDING PROTEIN
1usg.1.A	10.26	homo-dimer	HHblits	X-ray	1.53Å	0.27	0.14	LEUCINE-SPECIFIC BINDING PROTEIN
2liv.1.A	10.26	monomer	HHblits	X-ray	2.40Å	0.26	0.14	LEUCINE
4kzk.1.A	10.53	monomer	HHblits	X-ray	1.50Å	0.28	0.13	L-arabinose ABC transporter, periplasmic L-arabinose-binding protein
3ipc.1.A	10.26	monomer	HHblits	X-ray	1.30Å	0.26	0.14	ABC transporter, substrate binding protein (Amino acid)
3ipa.1.A	10.26	monomer	HHblits	X-ray	1.55Å	0.26	0.14	ABC transporter, substrate binding protein (Amino acid)
4nut.1.A	21.05	hetero-oligomer	HHblits	X-ray	1.55Å	0.28	0.13	13 kDa ribonucleoprotein-associated protein
3jcm.1.G	21.05	hetero-oligomer	HHblits	EM	NA	0.28	0.13	13 kDa ribonucleoprotein-associated protein
1zwz.1.A	21.05	monomer	HHblits	X-ray	1.90Å	0.28	0.13	Snu13p
5wyk.1.G	21.05	hetero-oligomer	HHblits	EM	NA	0.28	0.13	13 kDa ribonucleoprotein-associated protein
5wyj.7.A	21.05	monomer	HHblits	EM	NA	0.28	0.13	13 kDa ribonucleoprotein-associated protein
5nrl.1.R	21.05	hetero-oligomer	HHblits	EM	NA	0.28	0.13	13 kDa ribonucleoprotein-associated protein
5wlc.48.A	21.05	monomer	HHblits	EM	NA	0.28	0.13	Snu13
5wlc.47.A	21.05	monomer	HHblits	EM	NA	0.28	0.13	Snu13
4zpj.1.A	12.82	monomer	HHblits	X-ray	2.24Å	0.26	0.14	Extracellular ligand-binding receptor
4n0q.1.A	15.38	monomer	HHblits	X-ray	2.30Å	0.25	0.14	Leu/Ile/Val-binding protein homolog 3
4m88.1.A	12.82	monomer	HHblits	X-ray	1.76Å	0.25	0.14	Extracellular ligand-binding receptor
5kmq.1.A	27.78	homo-dimer	HHblits	X-ray	2.70Å	0.31	0.13	FAD-dependent pyridine nucleotide-disulfide oxidoreductase
4evq.1.A	5.13	monomer	HHblits	X-ray	1.40Å	0.25	0.14	Putative ABC transporter subunit, substrate-binding component
3i45.1.A	12.50	monomer	HHblits	X-ray	1.36Å	0.23	0.14	Twin-arginine translocation pathway signal protein
3ipa.1.A	10.26	monomer	HHblits	X-ray	1.55Å	0.24	0.14	ABC transporter, substrate binding protein (Amino acid)
3lop.1.A	16.22	monomer	HHblits	X-ray	1.55Å	0.28	0.13	Substrate binding periplasmic protein
2lbp.1.A	10.26	monomer	HHblits	X-ray	2.40Å	0.23	0.14	LEUCINE-BINDING PROTEIN
4evq.1.A	7.69	monomer	HHblits	X-ray	1.40Å	0.23	0.14	Putative ABC transporter subunit, substrate-binding component
4f06.1.A	2.63	monomer	HHblits	X-ray	1.30Å	0.24	0.13	Extracellular ligand-binding receptor
4nwz.1.A	25.71	homo-dimer	HHblits	X-ray	2.50Å	0.30	0.12	FAD-dependent pyridine nucleotide-disulfide oxidoreductase
3vrd.1.B	17.14	hetero-oligomer	HHblits	X-ray	1.50Å	0.30	0.12	Flavocytochrome c flavin subunit
4mg4.1.A	11.43	homo-dimer	HHblits	X-ray	1.70Å	0.24	0.12	Phosphonomutase
4mg4.2.B	11.43	homo-dimer	HHblits	X-ray	1.70Å	0.24	0.12	Phosphonomutase
1nvm.1.B	12.12	hetero-oligomer	HHblits	X-ray	1.70Å	0.29	0.11	acetaldehyde dehydrogenase (acylating)
1nvm.2.B	12.12	hetero-oligomer	HHblits	X-ray	1.70Å	0.29	0.11	acetaldehyde dehydrogenase (acylating)
4evs.1.A	2.86	monomer	HHblits	X-ray	1.45Å	0.24	0.12	PUTATIVE ABC TRANSPORTER SUBUNIT, SUBSTRATE-BINDING COMPONENT
5kmp.1.A	29.03	homo-dimer	HHblits	X-ray	3.20Å	0.32	0.11	FAD-dependent pyridine nucleotide-disulfide oxidoreductase
2vdc.1.G	20.69	hetero-oligomer	HHblits	EM	9.50Å	0.34	0.10	GLUTAMATE SYNTHASE [NADPH] SMALL CHAIN
5u1o.1.A	31.03	homo-dimer	HHblits	X-ray	2.31Å	0.33	0.10	Glutathione reductase
1glg.1.A	9.68	monomer	HHblits	X-ray	2.00Å	0.27	0.11	GALACTOSE/GLUCOSE-BINDING PROTEIN
2qw1.1.A	9.68	monomer	HHblits	X-ray	1.70Å	0.27	0.11	D-galactose-binding periplasmic protein
2fvy.1.A	9.68	monomer	HHblits	X-ray	0.92Å	0.27	0.11	D-galactose-binding periplasmic protein
1gub.1.A	3.23	monomer	HHblits	X-ray	3.10Å	0.24	0.11	D-ALLOSE-BINDING PERIPLASMIC PROTEIN
1gud.1.A	3.23	monomer	HHblits	X-ray	1.71Å	0.24	0.11	D-ALLOSE-BINDING PERIPLASMIC PROTEIN
1gud.2.A	3.23	monomer	HHblits	X-ray	1.71Å	0.24	0.11	D-ALLOSE-BINDING PERIPLASMIC PROTEIN
1rpj.1.A	3.23	monomer	HHblits	X-ray	1.80Å	0.24	0.11	PROTEIN (PRECURSOR OF PERIPLASMIC SUGAR RECEPTOR)
3nnd.1.A	17.24	homo-tetramer	HHblits	X-ray	2.80Å	0.23	0.10	Possible substrate binding protein of ABC transporter system
5u63.1.A	26.92	homo-dimer	HHblits	X-ray	1.99Å	0.31	0.09	Thioredoxin reductase
2whd.1.A	23.08	homo-dimer	HHblits	X-ray	2.60Å	0.31	0.09	THIOREDOXIN REDUCTASE
3ic9.1.A	20.00	homo-dimer	HHblits	X-ray	2.15Å	0.33	0.09	dihydrolipoamide dehydrogenase
3ic9.1.B	20.00	homo-dimer	HHblits	X-ray	2.15Å	0.33	0.09	dihydrolipoamide dehydrogenase
3ic9.2.B	20.00	homo-dimer	HHblits	X-ray	2.15Å	0.33	0.09	dihydrolipoamide dehydrogenase
3p94.1.A	3.70	monomer	HHblits	X-ray	1.93Å	0.24	0.09	GDSL-like Lipase
2w90.1.A	30.43	homo-dimer	HHblits	X-ray	2.20Å	0.36	0.08	6-PHOSPHOGLUCONATE DEHYDROGENASE, DECARBOXYLATING
2w90.1.B	30.43	homo-dimer	HHblits	X-ray	2.20Å	0.36	0.08	6-PHOSPHOGLUCONATE DEHYDROGENASE, DECARBOXYLATING
2iz1.1.B	26.09	homo-dimer	HHblits	X-ray	2.30Å	0.35	0.08	6-PHOSPHOGLUCONATE DEHYDROGENASE, DECARBOXYLATING
2iz1.1.A	26.09	homo-dimer	HHblits	X-ray	2.30Å	0.35	0.08	6-PHOSPHOGLUCONATE DEHYDROGENASE, DECARBOXYLATING
3itj.1.A	20.83	homo-dimer	HHblits	X-ray	2.40Å	0.31	0.08	Thioredoxin reductase 1
3itj.1.B	20.83	homo-dimer	HHblits	X-ray	2.40Å	0.31	0.08	Thioredoxin reductase 1
3itj.2.B	20.83	homo-dimer	HHblits	X-ray	2.40Å	0.31	0.08	Thioredoxin reductase 1
4rpg.1.A	26.09	homo-dimer	HHblits	X-ray	2.40Å	0.34	0.08	UDP-galactopyranose mutase
4rpl.2.B	26.09	homo-dimer	HHblits	X-ray	2.25Å	0.34	0.08	UDP-galactopyranose mutase
3fwn.1.A	26.09	homo-dimer	HHblits	X-ray	1.50Å	0.34	0.08	6-phosphogluconate dehydrogenase, decarboxylating
3fwn.1.B	26.09	homo-dimer	HHblits	X-ray	1.50Å	0.34	0.08	6-phosphogluconate dehydrogenase, decarboxylating
2zya.1.A	26.09	homo-dimer	HHblits	X-ray	1.60Å	0.34	0.08	6-phosphogluconate dehydrogenase, decarboxylating
2zya.1.B	26.09	homo-dimer	HHblits	X-ray	1.60Å	0.34	0.08	6-phosphogluconate dehydrogenase, decarboxylating
4rs3.1.A	12.50	monomer	HHblits	X-ray	1.40Å	0.30	0.08	ABC transporter, carbohydrate uptake transporter-2 (CUT2) family, periplasmic sugar-binding protein
5vt3.1.A	26.09	homo-dimer	HHblits	X-ray	1.98Å	0.33	0.08	Thioredoxin reductase
2fn9.1.A	13.04	monomer	HHblits	X-ray	1.40Å	0.31	0.08	ribose ABC transporter, periplasmic ribose-binding protein
2fn9.2.A	13.04	monomer	HHblits	X-ray	1.40Å	0.31	0.08	ribose ABC transporter, periplasmic ribose-binding protein
2ipm.1.A	8.33	monomer	HHblits	X-ray	1.12Å	0.27	0.08	D-galactose-binding periplasmic protein
2ipn.1.A	8.33	monomer	HHblits	X-ray	1.15Å	0.27	0.08	D-galactose-binding periplasmic protein
1tm2.1.A	13.64	monomer	HHblits	X-ray	1.90Å	0.33	0.08	sugar transport protein
1tjy.1.A	13.64	monomer	HHblits	X-ray	1.30Å	0.33	0.08	sugar transport protein
3l49.1.A	13.04	monomer	HHblits	X-ray	2.30Å	0.28	0.08	ABC sugar (Ribose) transporter, periplasmic substrate-binding subunit
2w8z.1.A	30.00	homo-dimer	HHblits	X-ray	2.30Å	0.36	0.07	6-PHOSPHOGLUCONATE DEHYDROGENASE, DECARBOXYLATING
2ipl.1.A	9.09	monomer	HHblits	X-ray	1.20Å	0.28	0.08	D-galactose-binding periplasmic protein
2iyo.1.A	25.00	homo-dimer	HHblits	X-ray	2.40Å	0.36	0.07	6-PHOSPHOGLUCONATE DEHYDROGENASE, DECARBOXYLATING
5kws.1.A	9.09	monomer	HHblits	X-ray	1.32Å	0.28	0.08	Galactose-binding protein
4zpj.1.A	18.18	monomer	HHblits	X-ray	2.24Å	0.28	0.08	Extracellular ligand-binding receptor
1usi.1.A	23.81	monomer	HHblits	X-ray	1.80Å	0.31	0.07	LEUCINE-SPECIFIC BINDING PROTEIN
1usg.1.A	23.81	homo-dimer	HHblits	X-ray	1.53Å	0.31	0.07	LEUCINE-SPECIFIC BINDING PROTEIN
2liv.1.A	25.00	monomer	HHblits	X-ray	2.40Å	0.31	0.07	LEUCINE
4wt7.1.A	30.00	monomer	HHblits	X-ray	2.00Å	0.30	0.07	ABC transporter substrate binding protein (Ribose)
3tri.1.A	15.00	homo-dimer	HHblits	X-ray	2.50Å	0.29	0.07	Pyrroline-5-carboxylate reductase
3tri.1.B	15.00	homo-dimer	HHblits	X-ray	2.50Å	0.29	0.07	Pyrroline-5-carboxylate reductase
3bbl.1.A	15.00	homo-dimer	HHblits	X-ray	2.35Å	0.25	0.07	Regulatory protein of LacI family
3cr7.1.A	29.41	homo-dimer	HHblits	X-ray	2.50Å	0.33	0.06	Adenylyl-sulfate kinase
3cr7.1.B	29.41	homo-dimer	HHblits	X-ray	2.50Å	0.33	0.06	Adenylyl-sulfate kinase